F374258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 201 | 248 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0000024|Ga0451576_0000024_283063_284424 |
| Length | 453 |
| Sequence | MSFAWAKQYEPQSAFTKWIDEKLPLPRLVYNAVGAGYPVPRNLNYMWNFGVLAGFCLVLQIITGVVLAMHYAANAQVAFGTVEHIMRNVNYGWMLRYAHANGASFFFIVIYLHIFRGFFYSSYKAPREMIWLLGVVIFLLMMATAFMGYVLPWGQMSFWGAQVITGLFGAIPLVGEPLQVWLLGGFAPDNAALNRFFSLHFLLPFVIAGVVILHIWALHIPGSSNPTGVEVKQESDTVPFHPYYTSKDGFGLGVFLILFTLMVFFLPNALGHPDNYIEANPLSTPALIVPEWYFYPFYAILRAFTGDLTIPFTGIVLIPAKLLGVIAMFGSILVWFFLPWLDKSPVRSGHYRPLFRKFFWFGLIPTMAALFYLGGAHAEEPYIMLSQIFTAYYFMHFLVILPIISQIEVPKPLPFSITEGVLGKDAAAPASRAGSVDGGGAGSLPDGSLQPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 2 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 3 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 10 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 11 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 12 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 13 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 14 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 15 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 148 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 149 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 152 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 155 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 161 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 174 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 175 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 176 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 182 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 188 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 189 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 191 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 192 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 193 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 195 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 196 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 197 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 198 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 199 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.11 |
| Metatranscriptomes | 1.13 |
| Isolates | 6.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.29 |
| Nodule | 0.38 |
| Rhizoplane | 2.26 |
| Rhizosphere | 72.18 |
| Stem | 0 |
| Stem Tuber | 0.38 |
| Unclassified | 10.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000512 | 3300001915 | Bacteria | 11846 |
| 2 | JGI24741J21665_1002184 | 3300001915 | Bacteria | 5193 |
| 3 | JGI24740J21852_10001317 | 3300001979 | Bacteria | 11286 |
| 4 | JGI24034J26672_10004594 | 3300002239 | Bacteria | 1960 |
| 5 | JGI24751J29686_10000298 | 3300002459 | Bacteria | 18735 |
| 6 | JGI25165J46597_1000082 | 3300003214 | Bacteria | 174736 |
| 7 | Ga0065704_10070413 | 3300005289 | Bacteria | 26038 |
| 8 | Ga0065704_10081238 | 3300005289 | Bacteria | 3797 |
| 9 | Ga0065707_10103924 | 3300005295 | Bacteria | 2723 |
| 10 | Ga0070658_10006263 | 3300005327 | Bacteria | 9640 |
| 11 | Ga0070658_10008451 | 3300005327 | Bacteria | 8279 |
| 12 | Ga0070658_10041999 | 3300005327 | Bacteria | 3690 |
| 13 | Ga0070658_10055706 | 3300005327 | Bacteria | 3212 |
| 14 | Ga0070683_100005508 | 3300005329 | Bacteria | 10575 |
| 15 | Ga0070683_100062665 | 3300005329 | Bacteria | 3457 |
| 16 | Ga0070670_100141190 | 3300005331 | Bacteria | 2083 |
| 17 | Ga0070666_10014390 | 3300005335 | Bacteria | 5037 |
| 18 | Ga0068868_100000076 | 3300005338 | Bacteria | 58193 |
| 19 | Ga0070660_100000090 | 3300005339 | Bacteria | 54649 |
| 20 | Ga0070668_100000927 | 3300005347 | Bacteria | 20472 |
| 21 | Ga0070668_100014098 | 3300005347 | Bacteria | 5976 |
| 22 | Ga0070669_100000052 | 3300005353 | Bacteria | 114467 |
| 23 | Ga0070669_100000776 | 3300005353 | Bacteria | 23176 |
| 24 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 25 | Ga0070671_100001129 | 3300005355 | Bacteria | 19815 |
| 26 | Ga0070671_100030211 | 3300005355 | Bacteria | 4472 |
| 27 | Ga0070671_100044194 | 3300005355 | Bacteria | 3702 |
| 28 | Ga0070659_100000122 | 3300005366 | Bacteria | 58682 |
| 29 | Ga0070667_100001140 | 3300005367 | Bacteria | 24152 |
| 30 | Ga0070667_100066282 | 3300005367 | Bacteria | 3067 |
| 31 | Ga0070667_100079443 | 3300005367 | Bacteria | 2804 |
| 32 | Ga0070667_100157680 | 3300005367 | Bacteria | 1997 |
| 33 | Ga0070667_100259709 | 3300005367 | Bacteria | 1555 |
| 34 | Ga0070714_100010860 | 3300005435 | Bacteria | 7213 |
| 35 | Ga0070700_100095853 | 3300005441 | Bacteria | 1946 |
| 36 | Ga0070662_100001553 | 3300005457 | Bacteria | 14170 |
| 37 | Ga0070662_100004883 | 3300005457 | Bacteria | 8508 |
| 38 | Ga0070681_10063149 | 3300005458 | Bacteria | 3676 |
| 39 | Ga0070686_100052075 | 3300005544 | Bacteria | 2609 |
| 40 | Ga0070665_100004654 | 3300005548 | Bacteria | 14329 |
| 41 | Ga0068855_100024940 | 3300005563 | Bacteria | 7156 |
| 42 | Ga0068855_100032263 | 3300005563 | Bacteria | 6254 |
| 43 | Ga0070664_100036127 | 3300005564 | Bacteria | 4150 |
| 44 | Ga0070664_100147381 | 3300005564 | Bacteria | 2076 |
| 45 | Ga0068857_100008402 | 3300005577 | Bacteria | 8919 |
| 46 | Ga0068857_100026507 | 3300005577 | Bacteria | 5109 |
| 47 | Ga0068857_100055221 | 3300005577 | Bacteria | 3525 |
| 48 | Ga0068856_100023390 | 3300005614 | Bacteria | 6007 |
| 49 | Ga0068856_100034050 | 3300005614 | Bacteria | 4989 |
| 50 | Ga0068852_100098252 | 3300005616 | Bacteria | 2636 |
| 51 | Ga0068863_100062255 | 3300005841 | Bacteria | 3529 |
| 52 | Ga0068858_100009646 | 3300005842 | Bacteria | 9201 |
| 53 | Ga0068860_100005489 | 3300005843 | Bacteria | 12849 |
| 54 | Ga0068862_100018803 | 3300005844 | Bacteria | 5757 |
| 55 | Ga0068862_100047463 | 3300005844 | Bacteria | 3665 |
| 56 | Ga0081540_1011531 | 3300005983 | Bacteria | 5904 |
| 57 | Ga0075368_10000040 | 3300006042 | Bacteria | 29898 |
| 58 | Ga0075363_100011388 | 3300006048 | Bacteria | 4256 |
| 59 | Ga0075364_10004029 | 3300006051 | Bacteria | 8432 |
| 60 | Ga0075367_10006087 | 3300006178 | Bacteria | 6062 |
| 61 | Ga0075369_10058610 | 3300006186 | Bacteria | 1677 |
| 62 | Ga0075366_10003946 | 3300006195 | Bacteria | 7913 |
| 63 | Ga0075370_10008567 | 3300006353 | Bacteria | 5271 |
| 64 | Ga0075370_10038914 | 3300006353 | Bacteria | 2677 |
| 65 | Ga0079104_1010607 | 3300006946 | Bacteria | 3019 |
| 66 | Ga0099795_10006457 | 3300007788 | Bacteria | 3201 |
| 67 | Ga0105250_10010083 | 3300009092 | Bacteria | 3947 |
| 68 | Ga0114129_10165644 | 3300009147 | Bacteria | 3017 |
| 69 | Ga0105248_10011493 | 3300009177 | Bacteria | 9756 |
| 70 | Ga0105248_10313387 | 3300009177 | Bacteria | 1767 |
| 71 | Ga0105238_10015264 | 3300009551 | Bacteria | 7778 |
| 72 | Ga0105238_10279614 | 3300009551 | Bacteria | 1650 |
| 73 | Ga0105249_10008139 | 3300009553 | Bacteria | 9140 |
| 74 | Ga0099796_10003114 | 3300010159 | Bacteria | 3783 |
| 75 | Ga0105246_10000160 | 3300011119 | Bacteria | 32154 |
| 76 | Ga0157373_10029763 | 3300013100 | Bacteria | 3931 |
| 77 | Ga0157371_10036127 | 3300013102 | Bacteria | 3538 |
| 78 | Ga0157370_10076948 | 3300013104 | Bacteria | 3143 |
| 79 | Ga0157369_10011355 | 3300013105 | Bacteria | 10116 |
| 80 | Ga0157369_10011875 | 3300013105 | Bacteria | 9892 |
| 81 | Ga0157369_10039817 | 3300013105 | Bacteria | 5135 |
| 82 | Ga0157369_10308236 | 3300013105 | Bacteria | 1646 |
| 83 | Ga0163162_10004031 | 3300013306 | Bacteria | 14098 |
| 84 | Ga0163162_10023960 | 3300013306 | Bacteria | 6023 |
| 85 | Ga0163162_10024374 | 3300013306 | Bacteria | 5970 |
| 86 | Ga0157372_10024359 | 3300013307 | Bacteria | 6573 |
| 87 | Ga0157372_10028966 | 3300013307 | Bacteria | 6042 |
| 88 | Ga0182006_1002611 | 3300015261 | Eukaryota | 9736 |
| 89 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 90 | Ga0224712_10047490 | 3300022467 | Unclassified | 1653 |
| 91 | Ga0207427_102761 | 3300025231 | Bacteria | 4331 |
| 92 | Ga0209026_1000555 | 3300025250 | Bacteria | 25620 |
| 93 | Ga0209148_1000127 | 3300025254 | Bacteria | 181586 |
| 94 | Ga0209233_1000041 | 3300025261 | Bacteria | 515463 |
| 95 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 96 | Ga0209050_1005515 | 3300025298 | Bacteria | 7908 |
| 97 | Ga0207696_1007004 | 3300025711 | Bacteria | 4465 |
| 98 | Ga0207713_1005296 | 3300025735 | Bacteria | 8113 |
| 99 | Ga0207680_10023738 | 3300025903 | Bacteria | 3354 |
| 100 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 101 | Ga0207705_10004430 | 3300025909 | Bacteria | 10614 |
| 102 | Ga0207657_10004362 | 3300025919 | Bacteria | 14986 |
| 103 | Ga0207657_10022552 | 3300025919 | Bacteria | 5886 |
| 104 | Ga0207657_10036202 | 3300025919 | Bacteria | 4419 |
| 105 | Ga0207652_10003272 | 3300025921 | Bacteria | 13421 |
| 106 | Ga0207652_10086204 | 3300025921 | Bacteria | 2753 |
| 107 | Ga0207681_10002310 | 3300025923 | Bacteria | 12123 |
| 108 | Ga0207650_10146391 | 3300025925 | Bacteria | 1861 |
| 109 | Ga0207644_10001658 | 3300025931 | Bacteria | 14331 |
| 110 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 111 | Ga0207690_10149218 | 3300025932 | Bacteria | 1732 |
| 112 | Ga0207706_10010997 | 3300025933 | Bacteria | 8251 |
| 113 | Ga0207706_10029679 | 3300025933 | Bacteria | 4880 |
| 114 | Ga0207669_10034308 | 3300025937 | Bacteria | 2874 |
| 115 | Ga0207661_10129018 | 3300025944 | Bacteria | 2163 |
| 116 | Ga0207679_10194538 | 3300025945 | Bacteria | 1689 |
| 117 | Ga0207667_10001580 | 3300025949 | Bacteria | 28640 |
| 118 | Ga0207667_10170030 | 3300025949 | Bacteria | 2240 |
| 119 | Ga0207712_10003220 | 3300025961 | Bacteria | 10374 |
| 120 | Ga0207668_10000746 | 3300025972 | Bacteria | 19869 |
| 121 | Ga0207668_10020166 | 3300025972 | Bacteria | 4230 |
| 122 | Ga0207658_10001382 | 3300025986 | Bacteria | 18946 |
| 123 | Ga0207677_10000144 | 3300026023 | Bacteria | 58198 |
| 124 | Ga0207641_10006202 | 3300026088 | Bacteria | 10115 |
| 125 | Ga0207674_10010294 | 3300026116 | Bacteria | 10610 |
| 126 | Ga0207674_10014694 | 3300026116 | Bacteria | 8634 |
| 127 | Ga0207674_10022381 | 3300026116 | Bacteria | 6787 |
| 128 | Ga0207674_10023232 | 3300026116 | Bacteria | 6643 |
| 129 | Ga0207674_10095208 | 3300026116 | Bacteria | 2964 |
| 130 | Ga0209179_1008681 | 3300027512 | Bacteria | 1720 |
| 131 | Ga0209983_1008338 | 3300027665 | Bacteria | 2118 |
| 132 | Ga0209813_10000025 | 3300027866 | Bacteria | 72196 |
| 133 | Ga0209974_10015501 | 3300027876 | Bacteria | 2530 |
| 134 | Ga0209974_10017068 | 3300027876 | Bacteria | 2409 |
| 135 | Ga0268266_10001471 | 3300028379 | Bacteria | 27988 |
| 136 | Ga0268265_10004883 | 3300028380 | Bacteria | 9240 |
| 137 | Ga0268264_10008365 | 3300028381 | Bacteria | 8600 |
| 138 | Ga0265328_10001512 | 3300031239 | Bacteria | 10755 |
| 139 | Ga0307508_10014313 | 3300031616 | Bacteria | 7236 |
| 140 | Ga0307405_10087822 | 3300031731 | Bacteria | 2050 |
| 141 | Ga0307413_10007910 | 3300031824 | Bacteria | 4976 |
| 142 | Ga0307413_10028565 | 3300031824 | Bacteria | 3108 |
| 143 | Ga0307413_10106473 | 3300031824 | Bacteria | 1866 |
| 144 | Ga0307410_10000124 | 3300031852 | Bacteria | 27240 |
| 145 | Ga0307410_10002678 | 3300031852 | Bacteria | 8687 |
| 146 | Ga0307412_10102072 | 3300031911 | Bacteria | 2030 |
| 147 | Ga0307409_100023880 | 3300031995 | Bacteria | 4248 |
| 148 | Ga0307409_100079883 | 3300031995 | Bacteria | 2637 |
| 149 | Ga0307416_100028300 | 3300032002 | Bacteria | 4165 |
| 150 | Ga0307414_10028657 | 3300032004 | Bacteria | 3614 |
| 151 | Ga0307414_10061752 | 3300032004 | Bacteria | 2655 |
| 152 | Ga0307414_10066116 | 3300032004 | Bacteria | 2583 |
| 153 | Ga0307414_10093153 | 3300032004 | Bacteria | 2245 |
| 154 | Ga0307414_10118587 | 3300032004 | Bacteria | 2030 |
| 155 | Ga0307411_10005371 | 3300032005 | Bacteria | 6284 |
| 156 | Ga0307411_10021540 | 3300032005 | Bacteria | 3774 |
| 157 | Ga0307411_10032421 | 3300032005 | Bacteria | 3227 |
| 158 | Ga0307411_10054695 | 3300032005 | Bacteria | 2622 |
| 159 | Ga0316583_10007969 | 3300032133 | Bacteria | 3819 |
| 160 | Ga0373931_0100597 | 3300035691 | Bacteria | 1625 |
| 161 | Ga0316582_0014167 | 3300036647 | Bacteria | 4516 |
| 162 | Ga0395899_0010231 | 3300037312 | Bacteria | 7187 |
| 163 | Ga0395900_0001218 | 3300037418 | Eukaryota | 31707 |
| 164 | Ga0395900_0045132 | 3300037418 | Bacteria | 4540 |
| 165 | Ga0395900_0226749 | 3300037418 | Bacteria | 1881 |
| 166 | Ga0395898_0012025 | 3300037466 | Unclassified | 8961 |
| 167 | Ga0395905_0000092 | 3300037471 | Bacteria | 149300 |
| 168 | Ga0436362_0187290 | 3300039453 | Bacteria | 1697 |
| 169 | Ga0466957_0018148 | 3300044842 | Bacteria | 4128 |
| 170 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 171 | Ga0466958_0035149 | 3300045836 | Bacteria | 2993 |
| 172 | Ga0466967_0065965 | 3300045976 | Bacteria | 3224 |
| 173 | Ga0466967_0135528 | 3300045976 | Bacteria | 2289 |
| 174 | Ga0495627_000256 | 3300046453 | Bacteria | 54510 |
| 175 | Ga0495650_0003427 | 3300046471 | Bacteria | 11575 |
| 176 | Ga0495606_0002685 | 3300046507 | Bacteria | 20137 |
| 177 | Ga0495610_0000220 | 3300046512 | Bacteria | 61190 |
| 178 | Ga0495586_0025198 | 3300046535 | Bacteria | 3182 |
| 179 | Ga0495668_0059988 | 3300046616 | Bacteria | 2099 |
| 180 | Ga0495674_0082919 | 3300047319 | Bacteria | 2749 |
| 181 | Ga0495681_0000065 | 3300047470 | Bacteria | 97979 |
| 182 | Ga0495686_0005318 | 3300047472 | Bacteria | 10200 |
| 183 | Ga0496100_0016620 | 3300048903 | Bacteria | 4325 |
| 184 | Ga0496102_0001898 | 3300048905 | Bacteria | 18025 |
| 185 | Ga0496103_0001909 | 3300048906 | Bacteria | 13544 |
| 186 | Ga0496104_0006612 | 3300048907 | Bacteria | 10197 |
| 187 | Ga0496113_0025931 | 3300048916 | Bacteria | 4186 |
| 188 | Ga0496114_0014088 | 3300048917 | Bacteria | 6411 |
| 189 | Ga0496117_0007234 | 3300048920 | Bacteria | 10922 |
| 190 | Ga0496118_0012833 | 3300048921 | Bacteria | 7997 |
| 191 | Ga0496119_0014948 | 3300048922 | Bacteria | 6030 |
| 192 | Ga0496120_0038563 | 3300048923 | Bacteria | 2825 |
| 193 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 194 | Ga0496121_0002046 | 3300048924 | Bacteria | 31921 |
| 195 | Ga0496121_0033380 | 3300048924 | Bacteria | 4657 |
| 196 | Ga0496122_0000858 | 3300048925 | Bacteria | 57235 |
| 197 | Ga0496122_0054876 | 3300048925 | Bacteria | 2987 |
| 198 | Ga0496123_0000431 | 3300048926 | Bacteria | 75535 |
| 199 | Ga0496124_0006221 | 3300048927 | Bacteria | 13076 |
| 200 | Ga0496125_0071928 | 3300048928 | Bacteria | 2698 |
| 201 | Ga0496125_0160774 | 3300048928 | Bacteria | 1526 |
| 202 | Ga0496126_0002590 | 3300048929 | Bacteria | 24120 |
| 203 | Ga0495682_0039342 | 3300049460 | Bacteria | 1736 |
| 204 | Ga0501292_000034 | 3300049515 | Bacteria | 33996 |
| 205 | Ga0501335_000399 | 3300049551 | Bacteria | 2702 |
| 206 | Ga0501034_0046045 | 3300049571 | Bacteria | 4407 |
| 207 | Ga0501037_0055584 | 3300049573 | Bacteria | 2894 |
| 208 | Ga0501067_0000593 | 3300049583 | Bacteria | 19485 |
| 209 | Ga0501070_0030803 | 3300049586 | Bacteria | 4493 |
| 210 | Ga0501223_000289 | 3300049663 | Bacteria | 12651 |
| 211 | Ga0501224_000002 | 3300049664 | Bacteria | 229331 |
| 212 | Ga0501233_007702 | 3300049668 | Bacteria | 2056 |
| 213 | Ga0501249_000386 | 3300049679 | Bacteria | 11534 |
| 214 | Ga0501225_0000045 | 3300049705 | Bacteria | 41541 |
| 215 | Ga0501234_000055 | 3300049707 | Bacteria | 13099 |
| 216 | Ga0501081_0020783 | 3300049743 | Bacteria | 4379 |
| 217 | Ga0501279_000016 | 3300049775 | Bacteria | 64067 |
| 218 | Ga0501280_000065 | 3300049776 | Bacteria | 30324 |
| 219 | Ga0501282_000944 | 3300049778 | Bacteria | 3288 |
| 220 | Ga0501226_000026 | 3300049853 | Bacteria | 91031 |
| 221 | nmdc:mga03683_24_c1 | 3300050489 | Bacteria | 78974 |
| 222 | nmdc:mga00v17_1450_c1 | 3300050491 | Bacteria | 12406 |
| 223 | nmdc:mga00v17_57501_c1 | 3300050491 | Bacteria | 2380 |
| 224 | nmdc:mga0k408_115545_c1 | 3300050493 | Bacteria | 1588 |
| 225 | nmdc:mga06z11_5725_c1 | 3300050494 | Bacteria | 5006 |
| 226 | nmdc:mga04h51_104_c1 | 3300050495 | Bacteria | 25060 |
| 227 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 228 | nmdc:mga05p37_282696_c1 | 3300050507 | Bacteria | 1978 |
| 229 | nmdc:mga09592_192300_c1 | 3300050508 | Bacteria | 1766 |
| 230 | nmdc:mga06r32_5616_c1 | 3300050510 | Bacteria | 11281 |
| 231 | nmdc:mga0sz30_1260_c1 | 3300050516 | Bacteria | 9047 |
| 232 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 233 | Ga0500643_002337 | 3300053087 | Bacteria | 9916 |
| 234 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 235 | Ga0500593_065194 | 3300053117 | Bacteria | 1593 |
| 236 | Ga0500607_000070 | 3300053121 | Bacteria | 73162 |
| 237 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 238 | Ga0500559_0000777 | 3300053136 | Bacteria | 20905 |
| 239 | Ga0500564_018847 | 3300053138 | Bacteria | 3150 |
| 240 | Ga0500604_0000035 | 3300053151 | Bacteria | 52540 |
| 241 | Ga0500616_0000635 | 3300053153 | Bacteria | 42496 |
| 242 | Ga0500616_0002669 | 3300053153 | Bacteria | 14509 |
| 243 | Ga0500622_0003841 | 3300053156 | Bacteria | 9776 |
| 244 | Ga0500567_000838 | 3300053723 | Bacteria | 11660 |
| 245 | Ga0500625_000004 | 3300053729 | Bacteria | 245905 |
| 246 | Ga0500645_000727 | 3300053730 | Bacteria | 20313 |
| 247 | Ga0501084_0027161 | 3300054114 | Bacteria | 4783 |
| 248 | Ga0587082_004323 | 3300059504 | Bacteria | 1771 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0035149 | Ga0466958_0035149_18_1136 | 362 |
| 2 | 3300015261 | Ga0182006_1002611 | Ga0182006_100261116 | 365 |
| 3 | 3300037418 | Ga0395900_0001218 | Ga0395900_0001218_10534_11766 | 370 |
| 4 | 3300039453 | Ga0436362_0187290 | Ga0436362_0187290_93_1217 | 370 |
| 5 | 3300046507 | Ga0495606_0002685 | Ga0495606_0002685_13676_14917 | 370 |
| 6 | 3300037466 | Ga0395898_0012025 | Ga0395898_0012025_5557_6720 | 386 |
| 7 | 3300005983 | Ga0081540_1011531 | Ga0081540_10115313 | 392 |
| 8 | 3300006042 | Ga0075368_10000040 | Ga0075368_100000408 | 392 |
| 9 | 3300006048 | Ga0075363_100011388 | Ga0075363_1000113884 | 392 |
| 10 | 3300006178 | Ga0075367_10006087 | Ga0075367_100060874 | 392 |
| 11 | 3300027866 | Ga0209813_10000025 | Ga0209813_1000002566 | 392 |
| 12 | 3300050489 | nmdc:mga03683_24_c1 | nmdc:mga03683_24_c1_70666_71946 | 392 |
| 13 | 3300050491 | nmdc:mga00v17_57501_c1 | nmdc:mga00v17_57501_c1_735_2015 | 392 |
| 14 | 3300050493 | nmdc:mga0k408_115545_c1 | nmdc:mga0k408_115545_c1_135_1415 | 392 |
| 15 | 3300050494 | nmdc:mga06z11_5725_c1 | nmdc:mga06z11_5725_c1_2872_4152 | 392 |
| 16 | 3300050495 | nmdc:mga04h51_104_c1 | nmdc:mga04h51_104_c1_16975_18255 | 392 |
| 17 | 3300050496 | nmdc:mga07m45_9_c1 | nmdc:mga07m45_9_c1_26760_28040 | 392 |
| 18 | 3300022467 | Ga0224712_10047490 | Ga0224712_100474901 | 395 |
| 19 | 3300003214 | JGI25165J46597_1000082 | JGI25165J46597_100008259 | 403 |
| 20 | 3300013105 | Ga0157369_10011355 | Ga0157369_100113552 | 403 |
| 21 | 3300025231 | Ga0207427_102761 | Ga0207427_1027616 | 403 |
| 22 | 3300025250 | Ga0209026_1000555 | Ga0209026_10005554 | 403 |
| 23 | 3300025261 | Ga0209233_1000041 | Ga0209233_100004158 | 403 |
| 24 | 3300025292 | Ga0209676_1000092 | Ga0209676_1000092140 | 403 |
| 25 | 3300025298 | Ga0209050_1005515 | Ga0209050_10055154 | 403 |
| 26 | 3300037312 | Ga0395899_0010231 | Ga0395899_0010231_4348_5640 | 403 |
| 27 | 3300037418 | Ga0395900_0045132 | Ga0395900_0045132_2255_3547 | 403 |
| 28 | 3300005327 | Ga0070658_10006263 | Ga0070658_100062638 | 404 |
| 29 | 3300025909 | Ga0207705_10000027 | Ga0207705_10000027179 | 404 |
| 30 | 3300025254 | Ga0209148_1000127 | Ga0209148_1000127129 | 405 |
| 31 | 3300032004 | Ga0307414_10066116 | Ga0307414_100661162 | 406 |
| 32 | 3300010159 | Ga0099796_10003114 | Ga0099796_100031142 | 407 |
| 33 | 3300035691 | Ga0373931_0100597 | Ga0373931_0100597_135_1397 | 409 |
| 34 | 3300047319 | Ga0495674_0082919 | Ga0495674_0082919_28_1290 | 409 |
| 35 | 3300005614 | Ga0068856_100023390 | Ga0068856_1000233906 | 410 |
| 36 | 3300046535 | Ga0495586_0025198 | Ga0495586_0025198_1755_3020 | 410 |
| 37 | 3300049583 | Ga0501067_0000593 | Ga0501067_0000593_13937_15172 | 410 |
| 38 | 3300031616 | Ga0307508_10014313 | Ga0307508_100143135 | 411 |
| 39 | 3300031824 | Ga0307413_10106473 | Ga0307413_101064732 | 411 |
| 40 | 3300032002 | Ga0307416_100028300 | Ga0307416_1000283002 | 411 |
| 41 | 3300032005 | Ga0307411_10032421 | Ga0307411_100324212 | 411 |
| 42 | 3300050507 | nmdc:mga05p37_282696_c1 | nmdc:mga05p37_282696_c1_52_1296 | 411 |
| 43 | 3300006195 | Ga0075366_10003946 | Ga0075366_100039464 | 412 |
| 44 | 3300007788 | Ga0099795_10006457 | Ga0099795_100064574 | 412 |
| 45 | 3300009147 | Ga0114129_10165644 | Ga0114129_101656443 | 412 |
| 46 | 3300027512 | Ga0209179_1008681 | Ga0209179_10086812 | 412 |
| 47 | 3300050508 | nmdc:mga09592_192300_c1 | nmdc:mga09592_192300_c1_415_1662 | 412 |
| 48 | 3300050510 | nmdc:mga06r32_5616_c1 | nmdc:mga06r32_5616_c1_8434_9681 | 412 |
| 49 | 3300002239 | JGI24034J26672_10004594 | JGI24034J26672_100045942 | 414 |
| 50 | 3300005289 | Ga0065704_10070413 | Ga0065704_1007041317 | 414 |
| 51 | 3300005331 | Ga0070670_100141190 | Ga0070670_1001411902 | 414 |
| 52 | 3300005347 | Ga0070668_100000927 | Ga0070668_10000092712 | 414 |
| 53 | 3300005353 | Ga0070669_100000776 | Ga0070669_10000077614 | 414 |
| 54 | 3300005355 | Ga0070671_100001129 | Ga0070671_1000011298 | 414 |
| 55 | 3300005367 | Ga0070667_100001140 | Ga0070667_10000114014 | 414 |
| 56 | 3300005548 | Ga0070665_100004654 | Ga0070665_1000046546 | 414 |
| 57 | 3300005841 | Ga0068863_100062255 | Ga0068863_1000622552 | 414 |
| 58 | 3300005843 | Ga0068860_100005489 | Ga0068860_1000054895 | 414 |
| 59 | 3300005844 | Ga0068862_100047463 | Ga0068862_1000474632 | 414 |
| 60 | 3300009092 | Ga0105250_10010083 | Ga0105250_100100833 | 414 |
| 61 | 3300009177 | Ga0105248_10011493 | Ga0105248_100114936 | 414 |
| 62 | 3300009551 | Ga0105238_10279614 | Ga0105238_102796142 | 414 |
| 63 | 3300009553 | Ga0105249_10008139 | Ga0105249_100081395 | 414 |
| 64 | 3300013104 | Ga0157370_10076948 | Ga0157370_100769483 | 414 |
| 65 | 3300013105 | Ga0157369_10308236 | Ga0157369_103082362 | 414 |
| 66 | 3300013306 | Ga0163162_10004031 | Ga0163162_100040318 | 414 |
| 67 | 3300025711 | Ga0207696_1007004 | Ga0207696_10070043 | 414 |
| 68 | 3300025735 | Ga0207713_1005296 | Ga0207713_10052963 | 414 |
| 69 | 3300025903 | Ga0207680_10023738 | Ga0207680_100237382 | 414 |
| 70 | 3300025923 | Ga0207681_10002310 | Ga0207681_100023104 | 414 |
| 71 | 3300025925 | Ga0207650_10146391 | Ga0207650_101463912 | 414 |
| 72 | 3300025931 | Ga0207644_10001658 | Ga0207644_100016586 | 414 |
| 73 | 3300025961 | Ga0207712_10003220 | Ga0207712_100032204 | 414 |
| 74 | 3300025972 | Ga0207668_10000746 | Ga0207668_100007465 | 414 |
| 75 | 3300025986 | Ga0207658_10001382 | Ga0207658_100013823 | 414 |
| 76 | 3300028379 | Ga0268266_10001471 | Ga0268266_1000147111 | 414 |
| 77 | 3300028381 | Ga0268264_10008365 | Ga0268264_100083657 | 414 |
| 78 | 3300031239 | Ga0265328_10001512 | Ga0265328_100015123 | 414 |
| 79 | 3300048903 | Ga0496100_0016620 | Ga0496100_0016620_1680_2954 | 414 |
| 80 | 3300048905 | Ga0496102_0001898 | Ga0496102_0001898_8874_10148 | 414 |
| 81 | 3300048906 | Ga0496103_0001909 | Ga0496103_0001909_8200_9474 | 414 |
| 82 | 3300048907 | Ga0496104_0006612 | Ga0496104_0006612_8495_9769 | 414 |
| 83 | 3300048916 | Ga0496113_0025931 | Ga0496113_0025931_2092_3366 | 414 |
| 84 | 3300048920 | Ga0496117_0007234 | Ga0496117_0007234_1747_3021 | 414 |
| 85 | 3300048921 | Ga0496118_0012833 | Ga0496118_0012833_5566_6840 | 414 |
| 86 | 3300048922 | Ga0496119_0014948 | Ga0496119_0014948_2397_3671 | 414 |
| 87 | 3300048923 | Ga0496120_0038563 | Ga0496120_0038563_693_1967 | 414 |
| 88 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_454032_455333 | 414 |
| 89 | 3300048924 | Ga0496121_0033380 | Ga0496121_0033380_2210_3484 | 414 |
| 90 | 3300048925 | Ga0496122_0054876 | Ga0496122_0054876_374_1648 | 414 |
| 91 | 3300048927 | Ga0496124_0006221 | Ga0496124_0006221_8063_9337 | 414 |
| 92 | 3300048928 | Ga0496125_0071928 | Ga0496125_0071928_1206_2480 | 414 |
| 93 | 3300048929 | Ga0496126_0002590 | Ga0496126_0002590_14823_16097 | 414 |
| 94 | 3300009551 | Ga0105238_10015264 | Ga0105238_100152647 | 415 |
| 95 | 3300013105 | Ga0157369_10011875 | Ga0157369_100118752 | 415 |
| 96 | 3300032004 | Ga0307414_10118587 | Ga0307414_101185873 | 415 |
| 97 | 3300037418 | Ga0395900_0226749 | Ga0395900_0226749_568_1845 | 415 |
| 98 | 3300044842 | Ga0466957_0018148 | Ga0466957_0018148_653_1927 | 415 |
| 99 | 3300045976 | Ga0466967_0135528 | Ga0466967_0135528_267_1541 | 415 |
| 100 | 3300049571 | Ga0501034_0046045 | Ga0501034_0046045_1814_3067 | 416 |
| 101 | 3300049573 | Ga0501037_0055584 | Ga0501037_0055584_519_1772 | 416 |
| 102 | 3300049586 | Ga0501070_0030803 | Ga0501070_0030803_2073_3326 | 416 |
| 103 | 3300053138 | Ga0500564_018847 | Ga0500564_018847_89_1378 | 416 |
| 104 | 3300053723 | Ga0500567_000838 | Ga0500567_000838_1574_2863 | 416 |
| 105 | 3300053729 | Ga0500625_000004 | Ga0500625_000004_186821_188110 | 416 |
| 106 | 3300045976 | Ga0466967_0065965 | Ga0466967_0065965_1082_2401 | 417 |
| 107 | 3300013306 | Ga0163162_10023960 | Ga0163162_100239603 | 418 |
| 108 | 3300049460 | Ga0495682_0039342 | Ga0495682_0039342_216_1526 | 418 |
| 109 | 3300005338 | Ga0068868_100000076 | Ga0068868_10000007652 | 420 |
| 110 | 3300005339 | Ga0070660_100000090 | Ga0070660_1000000902 | 420 |
| 111 | 3300005366 | Ga0070659_100000122 | Ga0070659_10000012252 | 420 |
| 112 | 3300005441 | Ga0070700_100095853 | Ga0070700_1000958532 | 420 |
| 113 | 3300005577 | Ga0068857_100055221 | Ga0068857_1000552213 | 420 |
| 114 | 3300005844 | Ga0068862_100018803 | Ga0068862_1000188036 | 420 |
| 115 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001697 | 420 |
| 116 | 3300026023 | Ga0207677_10000144 | Ga0207677_100001444 | 420 |
| 117 | 3300026116 | Ga0207674_10014694 | Ga0207674_100146946 | 420 |
| 118 | 3300027665 | Ga0209983_1008338 | Ga0209983_10083382 | 420 |
| 119 | 3300027876 | Ga0209974_10017068 | Ga0209974_100170681 | 420 |
| 120 | 3300028380 | Ga0268265_10004883 | Ga0268265_100048835 | 420 |
| 121 | iso_pu_bacteria | 2738541275 | 2738713069 | 420 |
| 122 | iso_pu_bacteria | 2738541301 | 2738851493 | 420 |
| 123 | iso_pu_bacteria | 2738541304 | 2738867223 | 420 |
| 124 | iso_pu_bacteria | 2738543022 | 2739299739 | 420 |
| 125 | iso_pu_bacteria | 2738543033 | 2739361419 | 420 |
| 126 | iso_pu_bacteria | 2928100450 | 2928100456 | 420 |
| 127 | iso_pu_bacteria | 2928959182 | 2928963338 | 420 |
| 128 | 3300049679 | Ga0501249_000386 | Ga0501249_000386_2165_3430 | 421 |
| 129 | 3300049743 | Ga0501081_0020783 | Ga0501081_0020783_2226_3500 | 422 |
| 130 | 3300054114 | Ga0501084_0027161 | Ga0501084_0027161_96_1370 | 422 |
| 131 | iso_pu_bacteria | 2643221541 | 2643729086 | 422 |
| 132 | iso_pu_bacteria | 2643221606 | 2644045099 | 422 |
| 133 | iso_pu_bacteria | 2643221671 | 2644391271 | 422 |
| 134 | iso_pu_bacteria | 2739367664 | 2739650593 | 422 |
| 135 | iso_pu_bacteria | 2739367865 | 2740029066 | 422 |
| 136 | iso_pu_bacteria | 2885427238 | 2885427943 | 422 |
| 137 | iso_pu_bacteria | 2882806704 | 2882809391 | 423 |
| 138 | iso_pu_bacteria | 2885429604 | 2885431900 | 423 |
| 139 | iso_pu_bacteria | 2896184354 | 2896186063 | 423 |
| 140 | 3300006051 | Ga0075364_10004029 | Ga0075364_100040292 | 424 |
| 141 | 3300006186 | Ga0075369_10058610 | Ga0075369_100586102 | 424 |
| 142 | 3300006353 | Ga0075370_10008567 | Ga0075370_100085674 | 424 |
| 143 | 3300006353 | Ga0075370_10038914 | Ga0075370_100389141 | 424 |
| 144 | 3300032133 | Ga0316583_10007969 | Ga0316583_100079693 | 424 |
| 145 | 3300036647 | Ga0316582_0014167 | Ga0316582_0014167_1638_2918 | 424 |
| 146 | 3300050491 | nmdc:mga00v17_1450_c1 | nmdc:mga00v17_1450_c1_8893_10173 | 424 |
| 147 | 3300050516 | nmdc:mga0sz30_1260_c1 | nmdc:mga0sz30_1260_c1_41_1321 | 424 |
| 148 | 3300053117 | Ga0500593_065194 | Ga0500593_065194_69_1349 | 424 |
| 149 | 3300053156 | Ga0500622_0003841 | Ga0500622_0003841_7574_8857 | 424 |
| 150 | iso_pu_bacteria | 2895880812 | 2895881186 | 424 |
| 151 | iso_pu_bacteria | 3000865235 | 3000868156 | 424 |
| 152 | 3300047472 | Ga0495686_0005318 | Ga0495686_0005318_4870_6156 | 425 |
| 153 | 3300005335 | Ga0070666_10014390 | Ga0070666_100143902 | 426 |
| 154 | 3300005353 | Ga0070669_100000052 | Ga0070669_10000005239 | 426 |
| 155 | 3300005355 | Ga0070671_100000005 | Ga0070671_100000005203 | 426 |
| 156 | 3300005367 | Ga0070667_100066282 | Ga0070667_1000662822 | 426 |
| 157 | 3300005544 | Ga0070686_100052075 | Ga0070686_1000520752 | 426 |
| 158 | 3300005563 | Ga0068855_100024940 | Ga0068855_1000249403 | 426 |
| 159 | 3300025919 | Ga0207657_10036202 | Ga0207657_100362021 | 426 |
| 160 | 3300025937 | Ga0207669_10034308 | Ga0207669_100343082 | 426 |
| 161 | 3300026088 | Ga0207641_10006202 | Ga0207641_1000620210 | 426 |
| 162 | 3300026116 | Ga0207674_10010294 | Ga0207674_100102942 | 426 |
| 163 | 3300053121 | Ga0500607_000070 | Ga0500607_000070_51521_52804 | 426 |
| 164 | 3300053136 | Ga0500559_0000777 | Ga0500559_0000777_781_2064 | 426 |
| 165 | 3300005367 | Ga0070667_100259709 | Ga0070667_1002597091 | 427 |
| 166 | 3300015690 | Ga0183363_1002 | Ga0183363_1002236 | 427 |
| 167 | 3300027876 | Ga0209974_10015501 | Ga0209974_100155012 | 427 |
| 168 | 3300031731 | Ga0307405_10087822 | Ga0307405_100878222 | 427 |
| 169 | 3300031911 | Ga0307412_10102072 | Ga0307412_101020722 | 427 |
| 170 | 3300031995 | Ga0307409_100079883 | Ga0307409_1000798832 | 427 |
| 171 | 3300032005 | Ga0307411_10021540 | Ga0307411_100215402 | 427 |
| 172 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_431835_433124 | 427 |
| 173 | 3300053087 | Ga0500643_002337 | Ga0500643_002337_1835_3142 | 427 |
| 174 | 3300053153 | Ga0500616_0002669 | Ga0500616_0002669_3830_5119 | 427 |
| 175 | 3300005295 | Ga0065707_10103924 | Ga0065707_101039242 | 428 |
| 176 | 3300005327 | Ga0070658_10055706 | Ga0070658_100557063 | 428 |
| 177 | 3300005329 | Ga0070683_100062665 | Ga0070683_1000626655 | 428 |
| 178 | 3300005367 | Ga0070667_100079443 | Ga0070667_1000794434 | 428 |
| 179 | 3300005367 | Ga0070667_100157680 | Ga0070667_1001576801 | 428 |
| 180 | 3300005457 | Ga0070662_100001553 | Ga0070662_10000155314 | 428 |
| 181 | 3300005457 | Ga0070662_100004883 | Ga0070662_1000048835 | 428 |
| 182 | 3300005458 | Ga0070681_10063149 | Ga0070681_100631494 | 428 |
| 183 | 3300005563 | Ga0068855_100032263 | Ga0068855_1000322635 | 428 |
| 184 | 3300005564 | Ga0070664_100036127 | Ga0070664_1000361275 | 428 |
| 185 | 3300005564 | Ga0070664_100147381 | Ga0070664_1001473812 | 428 |
| 186 | 3300005577 | Ga0068857_100026507 | Ga0068857_1000265077 | 428 |
| 187 | 3300005614 | Ga0068856_100034050 | Ga0068856_1000340503 | 428 |
| 188 | 3300011119 | Ga0105246_10000160 | Ga0105246_1000016012 | 428 |
| 189 | 3300013100 | Ga0157373_10029763 | Ga0157373_100297633 | 428 |
| 190 | 3300013102 | Ga0157371_10036127 | Ga0157371_100361274 | 428 |
| 191 | 3300013105 | Ga0157369_10039817 | Ga0157369_100398174 | 428 |
| 192 | 3300013307 | Ga0157372_10028966 | Ga0157372_100289664 | 428 |
| 193 | 3300025909 | Ga0207705_10004430 | Ga0207705_100044303 | 428 |
| 194 | 3300025919 | Ga0207657_10004362 | Ga0207657_100043627 | 428 |
| 195 | 3300025919 | Ga0207657_10022552 | Ga0207657_100225525 | 428 |
| 196 | 3300025921 | Ga0207652_10003272 | Ga0207652_100032725 | 428 |
| 197 | 3300025921 | Ga0207652_10086204 | Ga0207652_100862043 | 428 |
| 198 | 3300025932 | Ga0207690_10149218 | Ga0207690_101492182 | 428 |
| 199 | 3300025933 | Ga0207706_10010997 | Ga0207706_100109975 | 428 |
| 200 | 3300025933 | Ga0207706_10029679 | Ga0207706_100296793 | 428 |
| 201 | 3300025944 | Ga0207661_10129018 | Ga0207661_101290182 | 428 |
| 202 | 3300025945 | Ga0207679_10194538 | Ga0207679_101945382 | 428 |
| 203 | 3300025949 | Ga0207667_10001580 | Ga0207667_100015805 | 428 |
| 204 | 3300025949 | Ga0207667_10170030 | Ga0207667_101700302 | 428 |
| 205 | 3300026116 | Ga0207674_10023232 | Ga0207674_100232322 | 428 |
| 206 | 3300026116 | Ga0207674_10095208 | Ga0207674_100952081 | 428 |
| 207 | 3300031824 | Ga0307413_10007910 | Ga0307413_100079103 | 428 |
| 208 | 3300031824 | Ga0307413_10028565 | Ga0307413_100285652 | 428 |
| 209 | 3300031852 | Ga0307410_10002678 | Ga0307410_100026786 | 428 |
| 210 | 3300031995 | Ga0307409_100023880 | Ga0307409_1000238802 | 428 |
| 211 | 3300032004 | Ga0307414_10028657 | Ga0307414_100286575 | 428 |
| 212 | 3300032005 | Ga0307411_10005371 | Ga0307411_100053716 | 428 |
| 213 | 3300032005 | Ga0307411_10054695 | Ga0307411_100546951 | 428 |
| 214 | 3300046512 | Ga0495610_0000220 | Ga0495610_0000220_4744_6039 | 428 |
| 215 | 3300048917 | Ga0496114_0014088 | Ga0496114_0014088_1302_2618 | 428 |
| 216 | 3300048924 | Ga0496121_0002046 | Ga0496121_0002046_8046_9338 | 428 |
| 217 | 3300049515 | Ga0501292_000034 | Ga0501292_000034_4563_5858 | 428 |
| 218 | 3300049551 | Ga0501335_000399 | Ga0501335_000399_176_1471 | 428 |
| 219 | 3300049775 | Ga0501279_000016 | Ga0501279_000016_34757_36052 | 428 |
| 220 | 3300049776 | Ga0501280_000065 | Ga0501280_000065_686_1981 | 428 |
| 221 | 3300049778 | Ga0501282_000944 | Ga0501282_000944_40_1335 | 428 |
| 222 | 3300059504 | Ga0587082_004323 | Ga0587082_004323_442_1737 | 428 |
| 223 | 3300002459 | JGI24751J29686_10000298 | JGI24751J29686_1000029814 | 429 |
| 224 | 3300005289 | Ga0065704_10081238 | Ga0065704_100812382 | 429 |
| 225 | 3300005347 | Ga0070668_100014098 | Ga0070668_1000140984 | 429 |
| 226 | 3300005435 | Ga0070714_100010860 | Ga0070714_1000108604 | 429 |
| 227 | 3300025972 | Ga0207668_10020166 | Ga0207668_100201664 | 429 |
| 228 | 3300032004 | Ga0307414_10061752 | Ga0307414_100617522 | 429 |
| 229 | 3300045051 | Ga0451576_0000024 | Ga0451576_0000024_283063_284424 | 429 |
| 230 | 3300046453 | Ga0495627_000256 | Ga0495627_000256_3285_4601 | 429 |
| 231 | 3300046471 | Ga0495650_0003427 | Ga0495650_0003427_617_1933 | 429 |
| 232 | 3300046616 | Ga0495668_0059988 | Ga0495668_0059988_374_1684 | 429 |
| 233 | 3300047470 | Ga0495681_0000065 | Ga0495681_0000065_3790_5106 | 429 |
| 234 | 3300048925 | Ga0496122_0000858 | Ga0496122_0000858_904_2217 | 429 |
| 235 | 3300048926 | Ga0496123_0000431 | Ga0496123_0000431_27112_28425 | 429 |
| 236 | 3300049663 | Ga0501223_000289 | Ga0501223_000289_7976_9271 | 429 |
| 237 | 3300049664 | Ga0501224_000002 | Ga0501224_000002_102409_103704 | 429 |
| 238 | 3300049668 | Ga0501233_007702 | Ga0501233_007702_39_1334 | 429 |
| 239 | 3300049705 | Ga0501225_0000045 | Ga0501225_0000045_24394_25689 | 429 |
| 240 | 3300049707 | Ga0501234_000055 | Ga0501234_000055_10985_12280 | 429 |
| 241 | 3300049853 | Ga0501226_000026 | Ga0501226_000026_78446_79741 | 429 |
| 242 | 3300053104 | Ga0500556_0000014 | Ga0500556_0000014_136910_138220 | 429 |
| 243 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_764798_766108 | 429 |
| 244 | 3300053730 | Ga0500645_000727 | Ga0500645_000727_8139_9449 | 429 |
| 245 | 3300001915 | JGI24741J21665_1002184 | JGI24741J21665_10021842 | 430 |
| 246 | 3300001979 | JGI24740J21852_10001317 | JGI24740J21852_100013178 | 430 |
| 247 | 3300005327 | Ga0070658_10008451 | Ga0070658_100084516 | 430 |
| 248 | 3300005327 | Ga0070658_10041999 | Ga0070658_100419992 | 430 |
| 249 | 3300005329 | Ga0070683_100005508 | Ga0070683_1000055089 | 430 |
| 250 | 3300005355 | Ga0070671_100030211 | Ga0070671_1000302113 | 430 |
| 251 | 3300005355 | Ga0070671_100044194 | Ga0070671_1000441944 | 430 |
| 252 | 3300005616 | Ga0068852_100098252 | Ga0068852_1000982524 | 430 |
| 253 | 3300005842 | Ga0068858_100009646 | Ga0068858_1000096469 | 430 |
| 254 | 3300009177 | Ga0105248_10313387 | Ga0105248_103133871 | 430 |
| 255 | 3300013306 | Ga0163162_10024374 | Ga0163162_100243742 | 430 |
| 256 | 3300013307 | Ga0157372_10024359 | Ga0157372_100243592 | 430 |
| 257 | 3300031852 | Ga0307410_10000124 | Ga0307410_1000012413 | 430 |
| 258 | 3300037471 | Ga0395905_0000092 | Ga0395905_0000092_59156_60487 | 430 |
| 259 | 3300053151 | Ga0500604_0000035 | Ga0500604_0000035_42472_43767 | 430 |
| 260 | 3300053153 | Ga0500616_0000635 | Ga0500616_0000635_5832_7127 | 430 |
| 261 | 3300006946 | Ga0079104_1010607 | Ga0079104_10106072 | 434 |
| 262 | 3300032004 | Ga0307414_10093153 | Ga0307414_100931532 | 435 |
| 263 | 3300001915 | JGI24741J21665_1000512 | JGI24741J21665_10005129 | 439 |
| 264 | 3300005577 | Ga0068857_100008402 | Ga0068857_1000084025 | 439 |
| 265 | 3300026116 | Ga0207674_10022381 | Ga0207674_100223816 | 439 |
| 266 | 3300048928 | Ga0496125_0160774 | Ga0496125_0160774_146_1486 | 439 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ybb-assembly1.cif.gz_c | fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) | 0.9249 | 38 | 397 |
| 2fyn-assembly1.cif.gz_A | crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex | 0.9242 | 7 | 412 |
| 6nin-assembly1.cif.gz_A | rhodobacter sphaeroides bc1 with stigmatellin a | 0.9236 | 7 | 412 |
| 1ezv-assembly1.cif.gz_C-1 | structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment | 0.9213 | 18 | 397 |
| 5kkz-assembly2.cif.gz_K | rhodobacter sphaeroides bc1 with famoxadone | 0.9212 | 7 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fynA00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9242 | 7 | 412 | 1.20.810.10 |
| 1kyoC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9208 | 18 | 397 | 1.20.810.10 |
| 1bgyC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.914 | 19 | 397 | 1.20.810.10 |
| 3cwbC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9138 | 9 | 397 | 1.20.810.10 |
| af_Q37311_1_385_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8959 | 21 | 426 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4T8B9-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9726 | 290 | 397 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-W8WIB2-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9506 | 285 | 397 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-X5H3T1-F1-model_v4 | Cytochrome b | 0.9428 | 37 | 413 |
GO:0008121
GO:0022904 GO:0045275 GO:0046872 |
| AF-A0A0A1H1B2-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9348 | 248 | 397 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
| AF-A0A2D0WHJ7-F1-model_v4 | Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) | 0.9326 | 273 | 397 |
GO:0005743
GO:0006122 GO:0008121 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar