F374258

General Info

Members Datasets Scaffolds Average Seq Length
266 201 248 423

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000024|Ga0451576_0000024_283063_284424
Length 453
Sequence MSFAWAKQYEPQSAFTKWIDEKLPLPRLVYNAVGAGYPVPRNLNYMWNFGVLAGFCLVLQIITGVVLAMHYAANAQVAFGTVEHIMRNVNYGWMLRYAHANGASFFFIVIYLHIFRGFFYSSYKAPREMIWLLGVVIFLLMMATAFMGYVLPWGQMSFWGAQVITGLFGAIPLVGEPLQVWLLGGFAPDNAALNRFFSLHFLLPFVIAGVVILHIWALHIPGSSNPTGVEVKQESDTVPFHPYYTSKDGFGLGVFLILFTLMVFFLPNALGHPDNYIEANPLSTPALIVPEWYFYPFYAILRAFTGDLTIPFTGIVLIPAKLLGVIAMFGSILVWFFLPWLDKSPVRSGHYRPLFRKFFWFGLIPTMAALFYLGGAHAEEPYIMLSQIFTAYYFMHFLVILPIISQIEVPKPLPFSITEGVLGKDAAAPASRAGSVDGGGAGSLPDGSLQPAE

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
13 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
14 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
15 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
161 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
174 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
175 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
176 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
190 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
198 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 1.13
Isolates 6.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0.38
Rhizoplane 2.26
Rhizosphere 72.18
Stem 0
Stem Tuber 0.38
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000512 3300001915 Bacteria 11846
2 JGI24741J21665_1002184 3300001915 Bacteria 5193
3 JGI24740J21852_10001317 3300001979 Bacteria 11286
4 JGI24034J26672_10004594 3300002239 Bacteria 1960
5 JGI24751J29686_10000298 3300002459 Bacteria 18735
6 JGI25165J46597_1000082 3300003214 Bacteria 174736
7 Ga0065704_10070413 3300005289 Bacteria 26038
8 Ga0065704_10081238 3300005289 Bacteria 3797
9 Ga0065707_10103924 3300005295 Bacteria 2723
10 Ga0070658_10006263 3300005327 Bacteria 9640
11 Ga0070658_10008451 3300005327 Bacteria 8279
12 Ga0070658_10041999 3300005327 Bacteria 3690
13 Ga0070658_10055706 3300005327 Bacteria 3212
14 Ga0070683_100005508 3300005329 Bacteria 10575
15 Ga0070683_100062665 3300005329 Bacteria 3457
16 Ga0070670_100141190 3300005331 Bacteria 2083
17 Ga0070666_10014390 3300005335 Bacteria 5037
18 Ga0068868_100000076 3300005338 Bacteria 58193
19 Ga0070660_100000090 3300005339 Bacteria 54649
20 Ga0070668_100000927 3300005347 Bacteria 20472
21 Ga0070668_100014098 3300005347 Bacteria 5976
22 Ga0070669_100000052 3300005353 Bacteria 114467
23 Ga0070669_100000776 3300005353 Bacteria 23176
24 Ga0070671_100000005 3300005355 Bacteria 256547
25 Ga0070671_100001129 3300005355 Bacteria 19815
26 Ga0070671_100030211 3300005355 Bacteria 4472
27 Ga0070671_100044194 3300005355 Bacteria 3702
28 Ga0070659_100000122 3300005366 Bacteria 58682
29 Ga0070667_100001140 3300005367 Bacteria 24152
30 Ga0070667_100066282 3300005367 Bacteria 3067
31 Ga0070667_100079443 3300005367 Bacteria 2804
32 Ga0070667_100157680 3300005367 Bacteria 1997
33 Ga0070667_100259709 3300005367 Bacteria 1555
34 Ga0070714_100010860 3300005435 Bacteria 7213
35 Ga0070700_100095853 3300005441 Bacteria 1946
36 Ga0070662_100001553 3300005457 Bacteria 14170
37 Ga0070662_100004883 3300005457 Bacteria 8508
38 Ga0070681_10063149 3300005458 Bacteria 3676
39 Ga0070686_100052075 3300005544 Bacteria 2609
40 Ga0070665_100004654 3300005548 Bacteria 14329
41 Ga0068855_100024940 3300005563 Bacteria 7156
42 Ga0068855_100032263 3300005563 Bacteria 6254
43 Ga0070664_100036127 3300005564 Bacteria 4150
44 Ga0070664_100147381 3300005564 Bacteria 2076
45 Ga0068857_100008402 3300005577 Bacteria 8919
46 Ga0068857_100026507 3300005577 Bacteria 5109
47 Ga0068857_100055221 3300005577 Bacteria 3525
48 Ga0068856_100023390 3300005614 Bacteria 6007
49 Ga0068856_100034050 3300005614 Bacteria 4989
50 Ga0068852_100098252 3300005616 Bacteria 2636
51 Ga0068863_100062255 3300005841 Bacteria 3529
52 Ga0068858_100009646 3300005842 Bacteria 9201
53 Ga0068860_100005489 3300005843 Bacteria 12849
54 Ga0068862_100018803 3300005844 Bacteria 5757
55 Ga0068862_100047463 3300005844 Bacteria 3665
56 Ga0081540_1011531 3300005983 Bacteria 5904
57 Ga0075368_10000040 3300006042 Bacteria 29898
58 Ga0075363_100011388 3300006048 Bacteria 4256
59 Ga0075364_10004029 3300006051 Bacteria 8432
60 Ga0075367_10006087 3300006178 Bacteria 6062
61 Ga0075369_10058610 3300006186 Bacteria 1677
62 Ga0075366_10003946 3300006195 Bacteria 7913
63 Ga0075370_10008567 3300006353 Bacteria 5271
64 Ga0075370_10038914 3300006353 Bacteria 2677
65 Ga0079104_1010607 3300006946 Bacteria 3019
66 Ga0099795_10006457 3300007788 Bacteria 3201
67 Ga0105250_10010083 3300009092 Bacteria 3947
68 Ga0114129_10165644 3300009147 Bacteria 3017
69 Ga0105248_10011493 3300009177 Bacteria 9756
70 Ga0105248_10313387 3300009177 Bacteria 1767
71 Ga0105238_10015264 3300009551 Bacteria 7778
72 Ga0105238_10279614 3300009551 Bacteria 1650
73 Ga0105249_10008139 3300009553 Bacteria 9140
74 Ga0099796_10003114 3300010159 Bacteria 3783
75 Ga0105246_10000160 3300011119 Bacteria 32154
76 Ga0157373_10029763 3300013100 Bacteria 3931
77 Ga0157371_10036127 3300013102 Bacteria 3538
78 Ga0157370_10076948 3300013104 Bacteria 3143
79 Ga0157369_10011355 3300013105 Bacteria 10116
80 Ga0157369_10011875 3300013105 Bacteria 9892
81 Ga0157369_10039817 3300013105 Bacteria 5135
82 Ga0157369_10308236 3300013105 Bacteria 1646
83 Ga0163162_10004031 3300013306 Bacteria 14098
84 Ga0163162_10023960 3300013306 Bacteria 6023
85 Ga0163162_10024374 3300013306 Bacteria 5970
86 Ga0157372_10024359 3300013307 Bacteria 6573
87 Ga0157372_10028966 3300013307 Bacteria 6042
88 Ga0182006_1002611 3300015261 Eukaryota 9736
89 Ga0183363_1002 3300015690 Bacteria 425040
90 Ga0224712_10047490 3300022467 Unclassified 1653
91 Ga0207427_102761 3300025231 Bacteria 4331
92 Ga0209026_1000555 3300025250 Bacteria 25620
93 Ga0209148_1000127 3300025254 Bacteria 181586
94 Ga0209233_1000041 3300025261 Bacteria 515463
95 Ga0209676_1000092 3300025292 Bacteria 250453
96 Ga0209050_1005515 3300025298 Bacteria 7908
97 Ga0207696_1007004 3300025711 Bacteria 4465
98 Ga0207713_1005296 3300025735 Bacteria 8113
99 Ga0207680_10023738 3300025903 Bacteria 3354
100 Ga0207705_10000027 3300025909 Bacteria 248863
101 Ga0207705_10004430 3300025909 Bacteria 10614
102 Ga0207657_10004362 3300025919 Bacteria 14986
103 Ga0207657_10022552 3300025919 Bacteria 5886
104 Ga0207657_10036202 3300025919 Bacteria 4419
105 Ga0207652_10003272 3300025921 Bacteria 13421
106 Ga0207652_10086204 3300025921 Bacteria 2753
107 Ga0207681_10002310 3300025923 Bacteria 12123
108 Ga0207650_10146391 3300025925 Bacteria 1861
109 Ga0207644_10001658 3300025931 Bacteria 14331
110 Ga0207690_10000001 3300025932 Bacteria 807539
111 Ga0207690_10149218 3300025932 Bacteria 1732
112 Ga0207706_10010997 3300025933 Bacteria 8251
113 Ga0207706_10029679 3300025933 Bacteria 4880
114 Ga0207669_10034308 3300025937 Bacteria 2874
115 Ga0207661_10129018 3300025944 Bacteria 2163
116 Ga0207679_10194538 3300025945 Bacteria 1689
117 Ga0207667_10001580 3300025949 Bacteria 28640
118 Ga0207667_10170030 3300025949 Bacteria 2240
119 Ga0207712_10003220 3300025961 Bacteria 10374
120 Ga0207668_10000746 3300025972 Bacteria 19869
121 Ga0207668_10020166 3300025972 Bacteria 4230
122 Ga0207658_10001382 3300025986 Bacteria 18946
123 Ga0207677_10000144 3300026023 Bacteria 58198
124 Ga0207641_10006202 3300026088 Bacteria 10115
125 Ga0207674_10010294 3300026116 Bacteria 10610
126 Ga0207674_10014694 3300026116 Bacteria 8634
127 Ga0207674_10022381 3300026116 Bacteria 6787
128 Ga0207674_10023232 3300026116 Bacteria 6643
129 Ga0207674_10095208 3300026116 Bacteria 2964
130 Ga0209179_1008681 3300027512 Bacteria 1720
131 Ga0209983_1008338 3300027665 Bacteria 2118
132 Ga0209813_10000025 3300027866 Bacteria 72196
133 Ga0209974_10015501 3300027876 Bacteria 2530
134 Ga0209974_10017068 3300027876 Bacteria 2409
135 Ga0268266_10001471 3300028379 Bacteria 27988
136 Ga0268265_10004883 3300028380 Bacteria 9240
137 Ga0268264_10008365 3300028381 Bacteria 8600
138 Ga0265328_10001512 3300031239 Bacteria 10755
139 Ga0307508_10014313 3300031616 Bacteria 7236
140 Ga0307405_10087822 3300031731 Bacteria 2050
141 Ga0307413_10007910 3300031824 Bacteria 4976
142 Ga0307413_10028565 3300031824 Bacteria 3108
143 Ga0307413_10106473 3300031824 Bacteria 1866
144 Ga0307410_10000124 3300031852 Bacteria 27240
145 Ga0307410_10002678 3300031852 Bacteria 8687
146 Ga0307412_10102072 3300031911 Bacteria 2030
147 Ga0307409_100023880 3300031995 Bacteria 4248
148 Ga0307409_100079883 3300031995 Bacteria 2637
149 Ga0307416_100028300 3300032002 Bacteria 4165
150 Ga0307414_10028657 3300032004 Bacteria 3614
151 Ga0307414_10061752 3300032004 Bacteria 2655
152 Ga0307414_10066116 3300032004 Bacteria 2583
153 Ga0307414_10093153 3300032004 Bacteria 2245
154 Ga0307414_10118587 3300032004 Bacteria 2030
155 Ga0307411_10005371 3300032005 Bacteria 6284
156 Ga0307411_10021540 3300032005 Bacteria 3774
157 Ga0307411_10032421 3300032005 Bacteria 3227
158 Ga0307411_10054695 3300032005 Bacteria 2622
159 Ga0316583_10007969 3300032133 Bacteria 3819
160 Ga0373931_0100597 3300035691 Bacteria 1625
161 Ga0316582_0014167 3300036647 Bacteria 4516
162 Ga0395899_0010231 3300037312 Bacteria 7187
163 Ga0395900_0001218 3300037418 Eukaryota 31707
164 Ga0395900_0045132 3300037418 Bacteria 4540
165 Ga0395900_0226749 3300037418 Bacteria 1881
166 Ga0395898_0012025 3300037466 Unclassified 8961
167 Ga0395905_0000092 3300037471 Bacteria 149300
168 Ga0436362_0187290 3300039453 Bacteria 1697
169 Ga0466957_0018148 3300044842 Bacteria 4128
170 Ga0451576_0000024 3300045051 Bacteria 470499
171 Ga0466958_0035149 3300045836 Bacteria 2993
172 Ga0466967_0065965 3300045976 Bacteria 3224
173 Ga0466967_0135528 3300045976 Bacteria 2289
174 Ga0495627_000256 3300046453 Bacteria 54510
175 Ga0495650_0003427 3300046471 Bacteria 11575
176 Ga0495606_0002685 3300046507 Bacteria 20137
177 Ga0495610_0000220 3300046512 Bacteria 61190
178 Ga0495586_0025198 3300046535 Bacteria 3182
179 Ga0495668_0059988 3300046616 Bacteria 2099
180 Ga0495674_0082919 3300047319 Bacteria 2749
181 Ga0495681_0000065 3300047470 Bacteria 97979
182 Ga0495686_0005318 3300047472 Bacteria 10200
183 Ga0496100_0016620 3300048903 Bacteria 4325
184 Ga0496102_0001898 3300048905 Bacteria 18025
185 Ga0496103_0001909 3300048906 Bacteria 13544
186 Ga0496104_0006612 3300048907 Bacteria 10197
187 Ga0496113_0025931 3300048916 Bacteria 4186
188 Ga0496114_0014088 3300048917 Bacteria 6411
189 Ga0496117_0007234 3300048920 Bacteria 10922
190 Ga0496118_0012833 3300048921 Bacteria 7997
191 Ga0496119_0014948 3300048922 Bacteria 6030
192 Ga0496120_0038563 3300048923 Bacteria 2825
193 Ga0496121_0000024 3300048924 Bacteria 462959
194 Ga0496121_0002046 3300048924 Bacteria 31921
195 Ga0496121_0033380 3300048924 Bacteria 4657
196 Ga0496122_0000858 3300048925 Bacteria 57235
197 Ga0496122_0054876 3300048925 Bacteria 2987
198 Ga0496123_0000431 3300048926 Bacteria 75535
199 Ga0496124_0006221 3300048927 Bacteria 13076
200 Ga0496125_0071928 3300048928 Bacteria 2698
201 Ga0496125_0160774 3300048928 Bacteria 1526
202 Ga0496126_0002590 3300048929 Bacteria 24120
203 Ga0495682_0039342 3300049460 Bacteria 1736
204 Ga0501292_000034 3300049515 Bacteria 33996
205 Ga0501335_000399 3300049551 Bacteria 2702
206 Ga0501034_0046045 3300049571 Bacteria 4407
207 Ga0501037_0055584 3300049573 Bacteria 2894
208 Ga0501067_0000593 3300049583 Bacteria 19485
209 Ga0501070_0030803 3300049586 Bacteria 4493
210 Ga0501223_000289 3300049663 Bacteria 12651
211 Ga0501224_000002 3300049664 Bacteria 229331
212 Ga0501233_007702 3300049668 Bacteria 2056
213 Ga0501249_000386 3300049679 Bacteria 11534
214 Ga0501225_0000045 3300049705 Bacteria 41541
215 Ga0501234_000055 3300049707 Bacteria 13099
216 Ga0501081_0020783 3300049743 Bacteria 4379
217 Ga0501279_000016 3300049775 Bacteria 64067
218 Ga0501280_000065 3300049776 Bacteria 30324
219 Ga0501282_000944 3300049778 Bacteria 3288
220 Ga0501226_000026 3300049853 Bacteria 91031
221 nmdc:mga03683_24_c1 3300050489 Bacteria 78974
222 nmdc:mga00v17_1450_c1 3300050491 Bacteria 12406
223 nmdc:mga00v17_57501_c1 3300050491 Bacteria 2380
224 nmdc:mga0k408_115545_c1 3300050493 Bacteria 1588
225 nmdc:mga06z11_5725_c1 3300050494 Bacteria 5006
226 nmdc:mga04h51_104_c1 3300050495 Bacteria 25060
227 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
228 nmdc:mga05p37_282696_c1 3300050507 Bacteria 1978
229 nmdc:mga09592_192300_c1 3300050508 Bacteria 1766
230 nmdc:mga06r32_5616_c1 3300050510 Bacteria 11281
231 nmdc:mga0sz30_1260_c1 3300050516 Bacteria 9047
232 Ga0500643_000005 3300053087 Bacteria 539775
233 Ga0500643_002337 3300053087 Bacteria 9916
234 Ga0500556_0000014 3300053104 Bacteria 232989
235 Ga0500593_065194 3300053117 Bacteria 1593
236 Ga0500607_000070 3300053121 Bacteria 73162
237 Ga0500642_0000001 3300053130 Bacteria 1468402
238 Ga0500559_0000777 3300053136 Bacteria 20905
239 Ga0500564_018847 3300053138 Bacteria 3150
240 Ga0500604_0000035 3300053151 Bacteria 52540
241 Ga0500616_0000635 3300053153 Bacteria 42496
242 Ga0500616_0002669 3300053153 Bacteria 14509
243 Ga0500622_0003841 3300053156 Bacteria 9776
244 Ga0500567_000838 3300053723 Bacteria 11660
245 Ga0500625_000004 3300053729 Bacteria 245905
246 Ga0500645_000727 3300053730 Bacteria 20313
247 Ga0501084_0027161 3300054114 Bacteria 4783
248 Ga0587082_004323 3300059504 Bacteria 1771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0035149 Ga0466958_0035149_18_1136 362
2 3300015261 Ga0182006_1002611 Ga0182006_100261116 365
3 3300037418 Ga0395900_0001218 Ga0395900_0001218_10534_11766 370
4 3300039453 Ga0436362_0187290 Ga0436362_0187290_93_1217 370
5 3300046507 Ga0495606_0002685 Ga0495606_0002685_13676_14917 370
6 3300037466 Ga0395898_0012025 Ga0395898_0012025_5557_6720 386
7 3300005983 Ga0081540_1011531 Ga0081540_10115313 392
8 3300006042 Ga0075368_10000040 Ga0075368_100000408 392
9 3300006048 Ga0075363_100011388 Ga0075363_1000113884 392
10 3300006178 Ga0075367_10006087 Ga0075367_100060874 392
11 3300027866 Ga0209813_10000025 Ga0209813_1000002566 392
12 3300050489 nmdc:mga03683_24_c1 nmdc:mga03683_24_c1_70666_71946 392
13 3300050491 nmdc:mga00v17_57501_c1 nmdc:mga00v17_57501_c1_735_2015 392
14 3300050493 nmdc:mga0k408_115545_c1 nmdc:mga0k408_115545_c1_135_1415 392
15 3300050494 nmdc:mga06z11_5725_c1 nmdc:mga06z11_5725_c1_2872_4152 392
16 3300050495 nmdc:mga04h51_104_c1 nmdc:mga04h51_104_c1_16975_18255 392
17 3300050496 nmdc:mga07m45_9_c1 nmdc:mga07m45_9_c1_26760_28040 392
18 3300022467 Ga0224712_10047490 Ga0224712_100474901 395
19 3300003214 JGI25165J46597_1000082 JGI25165J46597_100008259 403
20 3300013105 Ga0157369_10011355 Ga0157369_100113552 403
21 3300025231 Ga0207427_102761 Ga0207427_1027616 403
22 3300025250 Ga0209026_1000555 Ga0209026_10005554 403
23 3300025261 Ga0209233_1000041 Ga0209233_100004158 403
24 3300025292 Ga0209676_1000092 Ga0209676_1000092140 403
25 3300025298 Ga0209050_1005515 Ga0209050_10055154 403
26 3300037312 Ga0395899_0010231 Ga0395899_0010231_4348_5640 403
27 3300037418 Ga0395900_0045132 Ga0395900_0045132_2255_3547 403
28 3300005327 Ga0070658_10006263 Ga0070658_100062638 404
29 3300025909 Ga0207705_10000027 Ga0207705_10000027179 404
30 3300025254 Ga0209148_1000127 Ga0209148_1000127129 405
31 3300032004 Ga0307414_10066116 Ga0307414_100661162 406
32 3300010159 Ga0099796_10003114 Ga0099796_100031142 407
33 3300035691 Ga0373931_0100597 Ga0373931_0100597_135_1397 409
34 3300047319 Ga0495674_0082919 Ga0495674_0082919_28_1290 409
35 3300005614 Ga0068856_100023390 Ga0068856_1000233906 410
36 3300046535 Ga0495586_0025198 Ga0495586_0025198_1755_3020 410
37 3300049583 Ga0501067_0000593 Ga0501067_0000593_13937_15172 410
38 3300031616 Ga0307508_10014313 Ga0307508_100143135 411
39 3300031824 Ga0307413_10106473 Ga0307413_101064732 411
40 3300032002 Ga0307416_100028300 Ga0307416_1000283002 411
41 3300032005 Ga0307411_10032421 Ga0307411_100324212 411
42 3300050507 nmdc:mga05p37_282696_c1 nmdc:mga05p37_282696_c1_52_1296 411
43 3300006195 Ga0075366_10003946 Ga0075366_100039464 412
44 3300007788 Ga0099795_10006457 Ga0099795_100064574 412
45 3300009147 Ga0114129_10165644 Ga0114129_101656443 412
46 3300027512 Ga0209179_1008681 Ga0209179_10086812 412
47 3300050508 nmdc:mga09592_192300_c1 nmdc:mga09592_192300_c1_415_1662 412
48 3300050510 nmdc:mga06r32_5616_c1 nmdc:mga06r32_5616_c1_8434_9681 412
49 3300002239 JGI24034J26672_10004594 JGI24034J26672_100045942 414
50 3300005289 Ga0065704_10070413 Ga0065704_1007041317 414
51 3300005331 Ga0070670_100141190 Ga0070670_1001411902 414
52 3300005347 Ga0070668_100000927 Ga0070668_10000092712 414
53 3300005353 Ga0070669_100000776 Ga0070669_10000077614 414
54 3300005355 Ga0070671_100001129 Ga0070671_1000011298 414
55 3300005367 Ga0070667_100001140 Ga0070667_10000114014 414
56 3300005548 Ga0070665_100004654 Ga0070665_1000046546 414
57 3300005841 Ga0068863_100062255 Ga0068863_1000622552 414
58 3300005843 Ga0068860_100005489 Ga0068860_1000054895 414
59 3300005844 Ga0068862_100047463 Ga0068862_1000474632 414
60 3300009092 Ga0105250_10010083 Ga0105250_100100833 414
61 3300009177 Ga0105248_10011493 Ga0105248_100114936 414
62 3300009551 Ga0105238_10279614 Ga0105238_102796142 414
63 3300009553 Ga0105249_10008139 Ga0105249_100081395 414
64 3300013104 Ga0157370_10076948 Ga0157370_100769483 414
65 3300013105 Ga0157369_10308236 Ga0157369_103082362 414
66 3300013306 Ga0163162_10004031 Ga0163162_100040318 414
67 3300025711 Ga0207696_1007004 Ga0207696_10070043 414
68 3300025735 Ga0207713_1005296 Ga0207713_10052963 414
69 3300025903 Ga0207680_10023738 Ga0207680_100237382 414
70 3300025923 Ga0207681_10002310 Ga0207681_100023104 414
71 3300025925 Ga0207650_10146391 Ga0207650_101463912 414
72 3300025931 Ga0207644_10001658 Ga0207644_100016586 414
73 3300025961 Ga0207712_10003220 Ga0207712_100032204 414
74 3300025972 Ga0207668_10000746 Ga0207668_100007465 414
75 3300025986 Ga0207658_10001382 Ga0207658_100013823 414
76 3300028379 Ga0268266_10001471 Ga0268266_1000147111 414
77 3300028381 Ga0268264_10008365 Ga0268264_100083657 414
78 3300031239 Ga0265328_10001512 Ga0265328_100015123 414
79 3300048903 Ga0496100_0016620 Ga0496100_0016620_1680_2954 414
80 3300048905 Ga0496102_0001898 Ga0496102_0001898_8874_10148 414
81 3300048906 Ga0496103_0001909 Ga0496103_0001909_8200_9474 414
82 3300048907 Ga0496104_0006612 Ga0496104_0006612_8495_9769 414
83 3300048916 Ga0496113_0025931 Ga0496113_0025931_2092_3366 414
84 3300048920 Ga0496117_0007234 Ga0496117_0007234_1747_3021 414
85 3300048921 Ga0496118_0012833 Ga0496118_0012833_5566_6840 414
86 3300048922 Ga0496119_0014948 Ga0496119_0014948_2397_3671 414
87 3300048923 Ga0496120_0038563 Ga0496120_0038563_693_1967 414
88 3300048924 Ga0496121_0000024 Ga0496121_0000024_454032_455333 414
89 3300048924 Ga0496121_0033380 Ga0496121_0033380_2210_3484 414
90 3300048925 Ga0496122_0054876 Ga0496122_0054876_374_1648 414
91 3300048927 Ga0496124_0006221 Ga0496124_0006221_8063_9337 414
92 3300048928 Ga0496125_0071928 Ga0496125_0071928_1206_2480 414
93 3300048929 Ga0496126_0002590 Ga0496126_0002590_14823_16097 414
94 3300009551 Ga0105238_10015264 Ga0105238_100152647 415
95 3300013105 Ga0157369_10011875 Ga0157369_100118752 415
96 3300032004 Ga0307414_10118587 Ga0307414_101185873 415
97 3300037418 Ga0395900_0226749 Ga0395900_0226749_568_1845 415
98 3300044842 Ga0466957_0018148 Ga0466957_0018148_653_1927 415
99 3300045976 Ga0466967_0135528 Ga0466967_0135528_267_1541 415
100 3300049571 Ga0501034_0046045 Ga0501034_0046045_1814_3067 416
101 3300049573 Ga0501037_0055584 Ga0501037_0055584_519_1772 416
102 3300049586 Ga0501070_0030803 Ga0501070_0030803_2073_3326 416
103 3300053138 Ga0500564_018847 Ga0500564_018847_89_1378 416
104 3300053723 Ga0500567_000838 Ga0500567_000838_1574_2863 416
105 3300053729 Ga0500625_000004 Ga0500625_000004_186821_188110 416
106 3300045976 Ga0466967_0065965 Ga0466967_0065965_1082_2401 417
107 3300013306 Ga0163162_10023960 Ga0163162_100239603 418
108 3300049460 Ga0495682_0039342 Ga0495682_0039342_216_1526 418
109 3300005338 Ga0068868_100000076 Ga0068868_10000007652 420
110 3300005339 Ga0070660_100000090 Ga0070660_1000000902 420
111 3300005366 Ga0070659_100000122 Ga0070659_10000012252 420
112 3300005441 Ga0070700_100095853 Ga0070700_1000958532 420
113 3300005577 Ga0068857_100055221 Ga0068857_1000552213 420
114 3300005844 Ga0068862_100018803 Ga0068862_1000188036 420
115 3300025932 Ga0207690_10000001 Ga0207690_10000001697 420
116 3300026023 Ga0207677_10000144 Ga0207677_100001444 420
117 3300026116 Ga0207674_10014694 Ga0207674_100146946 420
118 3300027665 Ga0209983_1008338 Ga0209983_10083382 420
119 3300027876 Ga0209974_10017068 Ga0209974_100170681 420
120 3300028380 Ga0268265_10004883 Ga0268265_100048835 420
121 iso_pu_bacteria 2738541275 2738713069 420
122 iso_pu_bacteria 2738541301 2738851493 420
123 iso_pu_bacteria 2738541304 2738867223 420
124 iso_pu_bacteria 2738543022 2739299739 420
125 iso_pu_bacteria 2738543033 2739361419 420
126 iso_pu_bacteria 2928100450 2928100456 420
127 iso_pu_bacteria 2928959182 2928963338 420
128 3300049679 Ga0501249_000386 Ga0501249_000386_2165_3430 421
129 3300049743 Ga0501081_0020783 Ga0501081_0020783_2226_3500 422
130 3300054114 Ga0501084_0027161 Ga0501084_0027161_96_1370 422
131 iso_pu_bacteria 2643221541 2643729086 422
132 iso_pu_bacteria 2643221606 2644045099 422
133 iso_pu_bacteria 2643221671 2644391271 422
134 iso_pu_bacteria 2739367664 2739650593 422
135 iso_pu_bacteria 2739367865 2740029066 422
136 iso_pu_bacteria 2885427238 2885427943 422
137 iso_pu_bacteria 2882806704 2882809391 423
138 iso_pu_bacteria 2885429604 2885431900 423
139 iso_pu_bacteria 2896184354 2896186063 423
140 3300006051 Ga0075364_10004029 Ga0075364_100040292 424
141 3300006186 Ga0075369_10058610 Ga0075369_100586102 424
142 3300006353 Ga0075370_10008567 Ga0075370_100085674 424
143 3300006353 Ga0075370_10038914 Ga0075370_100389141 424
144 3300032133 Ga0316583_10007969 Ga0316583_100079693 424
145 3300036647 Ga0316582_0014167 Ga0316582_0014167_1638_2918 424
146 3300050491 nmdc:mga00v17_1450_c1 nmdc:mga00v17_1450_c1_8893_10173 424
147 3300050516 nmdc:mga0sz30_1260_c1 nmdc:mga0sz30_1260_c1_41_1321 424
148 3300053117 Ga0500593_065194 Ga0500593_065194_69_1349 424
149 3300053156 Ga0500622_0003841 Ga0500622_0003841_7574_8857 424
150 iso_pu_bacteria 2895880812 2895881186 424
151 iso_pu_bacteria 3000865235 3000868156 424
152 3300047472 Ga0495686_0005318 Ga0495686_0005318_4870_6156 425
153 3300005335 Ga0070666_10014390 Ga0070666_100143902 426
154 3300005353 Ga0070669_100000052 Ga0070669_10000005239 426
155 3300005355 Ga0070671_100000005 Ga0070671_100000005203 426
156 3300005367 Ga0070667_100066282 Ga0070667_1000662822 426
157 3300005544 Ga0070686_100052075 Ga0070686_1000520752 426
158 3300005563 Ga0068855_100024940 Ga0068855_1000249403 426
159 3300025919 Ga0207657_10036202 Ga0207657_100362021 426
160 3300025937 Ga0207669_10034308 Ga0207669_100343082 426
161 3300026088 Ga0207641_10006202 Ga0207641_1000620210 426
162 3300026116 Ga0207674_10010294 Ga0207674_100102942 426
163 3300053121 Ga0500607_000070 Ga0500607_000070_51521_52804 426
164 3300053136 Ga0500559_0000777 Ga0500559_0000777_781_2064 426
165 3300005367 Ga0070667_100259709 Ga0070667_1002597091 427
166 3300015690 Ga0183363_1002 Ga0183363_1002236 427
167 3300027876 Ga0209974_10015501 Ga0209974_100155012 427
168 3300031731 Ga0307405_10087822 Ga0307405_100878222 427
169 3300031911 Ga0307412_10102072 Ga0307412_101020722 427
170 3300031995 Ga0307409_100079883 Ga0307409_1000798832 427
171 3300032005 Ga0307411_10021540 Ga0307411_100215402 427
172 3300053087 Ga0500643_000005 Ga0500643_000005_431835_433124 427
173 3300053087 Ga0500643_002337 Ga0500643_002337_1835_3142 427
174 3300053153 Ga0500616_0002669 Ga0500616_0002669_3830_5119 427
175 3300005295 Ga0065707_10103924 Ga0065707_101039242 428
176 3300005327 Ga0070658_10055706 Ga0070658_100557063 428
177 3300005329 Ga0070683_100062665 Ga0070683_1000626655 428
178 3300005367 Ga0070667_100079443 Ga0070667_1000794434 428
179 3300005367 Ga0070667_100157680 Ga0070667_1001576801 428
180 3300005457 Ga0070662_100001553 Ga0070662_10000155314 428
181 3300005457 Ga0070662_100004883 Ga0070662_1000048835 428
182 3300005458 Ga0070681_10063149 Ga0070681_100631494 428
183 3300005563 Ga0068855_100032263 Ga0068855_1000322635 428
184 3300005564 Ga0070664_100036127 Ga0070664_1000361275 428
185 3300005564 Ga0070664_100147381 Ga0070664_1001473812 428
186 3300005577 Ga0068857_100026507 Ga0068857_1000265077 428
187 3300005614 Ga0068856_100034050 Ga0068856_1000340503 428
188 3300011119 Ga0105246_10000160 Ga0105246_1000016012 428
189 3300013100 Ga0157373_10029763 Ga0157373_100297633 428
190 3300013102 Ga0157371_10036127 Ga0157371_100361274 428
191 3300013105 Ga0157369_10039817 Ga0157369_100398174 428
192 3300013307 Ga0157372_10028966 Ga0157372_100289664 428
193 3300025909 Ga0207705_10004430 Ga0207705_100044303 428
194 3300025919 Ga0207657_10004362 Ga0207657_100043627 428
195 3300025919 Ga0207657_10022552 Ga0207657_100225525 428
196 3300025921 Ga0207652_10003272 Ga0207652_100032725 428
197 3300025921 Ga0207652_10086204 Ga0207652_100862043 428
198 3300025932 Ga0207690_10149218 Ga0207690_101492182 428
199 3300025933 Ga0207706_10010997 Ga0207706_100109975 428
200 3300025933 Ga0207706_10029679 Ga0207706_100296793 428
201 3300025944 Ga0207661_10129018 Ga0207661_101290182 428
202 3300025945 Ga0207679_10194538 Ga0207679_101945382 428
203 3300025949 Ga0207667_10001580 Ga0207667_100015805 428
204 3300025949 Ga0207667_10170030 Ga0207667_101700302 428
205 3300026116 Ga0207674_10023232 Ga0207674_100232322 428
206 3300026116 Ga0207674_10095208 Ga0207674_100952081 428
207 3300031824 Ga0307413_10007910 Ga0307413_100079103 428
208 3300031824 Ga0307413_10028565 Ga0307413_100285652 428
209 3300031852 Ga0307410_10002678 Ga0307410_100026786 428
210 3300031995 Ga0307409_100023880 Ga0307409_1000238802 428
211 3300032004 Ga0307414_10028657 Ga0307414_100286575 428
212 3300032005 Ga0307411_10005371 Ga0307411_100053716 428
213 3300032005 Ga0307411_10054695 Ga0307411_100546951 428
214 3300046512 Ga0495610_0000220 Ga0495610_0000220_4744_6039 428
215 3300048917 Ga0496114_0014088 Ga0496114_0014088_1302_2618 428
216 3300048924 Ga0496121_0002046 Ga0496121_0002046_8046_9338 428
217 3300049515 Ga0501292_000034 Ga0501292_000034_4563_5858 428
218 3300049551 Ga0501335_000399 Ga0501335_000399_176_1471 428
219 3300049775 Ga0501279_000016 Ga0501279_000016_34757_36052 428
220 3300049776 Ga0501280_000065 Ga0501280_000065_686_1981 428
221 3300049778 Ga0501282_000944 Ga0501282_000944_40_1335 428
222 3300059504 Ga0587082_004323 Ga0587082_004323_442_1737 428
223 3300002459 JGI24751J29686_10000298 JGI24751J29686_1000029814 429
224 3300005289 Ga0065704_10081238 Ga0065704_100812382 429
225 3300005347 Ga0070668_100014098 Ga0070668_1000140984 429
226 3300005435 Ga0070714_100010860 Ga0070714_1000108604 429
227 3300025972 Ga0207668_10020166 Ga0207668_100201664 429
228 3300032004 Ga0307414_10061752 Ga0307414_100617522 429
229 3300045051 Ga0451576_0000024 Ga0451576_0000024_283063_284424 429
230 3300046453 Ga0495627_000256 Ga0495627_000256_3285_4601 429
231 3300046471 Ga0495650_0003427 Ga0495650_0003427_617_1933 429
232 3300046616 Ga0495668_0059988 Ga0495668_0059988_374_1684 429
233 3300047470 Ga0495681_0000065 Ga0495681_0000065_3790_5106 429
234 3300048925 Ga0496122_0000858 Ga0496122_0000858_904_2217 429
235 3300048926 Ga0496123_0000431 Ga0496123_0000431_27112_28425 429
236 3300049663 Ga0501223_000289 Ga0501223_000289_7976_9271 429
237 3300049664 Ga0501224_000002 Ga0501224_000002_102409_103704 429
238 3300049668 Ga0501233_007702 Ga0501233_007702_39_1334 429
239 3300049705 Ga0501225_0000045 Ga0501225_0000045_24394_25689 429
240 3300049707 Ga0501234_000055 Ga0501234_000055_10985_12280 429
241 3300049853 Ga0501226_000026 Ga0501226_000026_78446_79741 429
242 3300053104 Ga0500556_0000014 Ga0500556_0000014_136910_138220 429
243 3300053130 Ga0500642_0000001 Ga0500642_0000001_764798_766108 429
244 3300053730 Ga0500645_000727 Ga0500645_000727_8139_9449 429
245 3300001915 JGI24741J21665_1002184 JGI24741J21665_10021842 430
246 3300001979 JGI24740J21852_10001317 JGI24740J21852_100013178 430
247 3300005327 Ga0070658_10008451 Ga0070658_100084516 430
248 3300005327 Ga0070658_10041999 Ga0070658_100419992 430
249 3300005329 Ga0070683_100005508 Ga0070683_1000055089 430
250 3300005355 Ga0070671_100030211 Ga0070671_1000302113 430
251 3300005355 Ga0070671_100044194 Ga0070671_1000441944 430
252 3300005616 Ga0068852_100098252 Ga0068852_1000982524 430
253 3300005842 Ga0068858_100009646 Ga0068858_1000096469 430
254 3300009177 Ga0105248_10313387 Ga0105248_103133871 430
255 3300013306 Ga0163162_10024374 Ga0163162_100243742 430
256 3300013307 Ga0157372_10024359 Ga0157372_100243592 430
257 3300031852 Ga0307410_10000124 Ga0307410_1000012413 430
258 3300037471 Ga0395905_0000092 Ga0395905_0000092_59156_60487 430
259 3300053151 Ga0500604_0000035 Ga0500604_0000035_42472_43767 430
260 3300053153 Ga0500616_0000635 Ga0500616_0000635_5832_7127 430
261 3300006946 Ga0079104_1010607 Ga0079104_10106072 434
262 3300032004 Ga0307414_10093153 Ga0307414_100931532 435
263 3300001915 JGI24741J21665_1000512 JGI24741J21665_10005129 439
264 3300005577 Ga0068857_100008402 Ga0068857_1000084025 439
265 3300026116 Ga0207674_10022381 Ga0207674_100223816 439
266 3300048928 Ga0496125_0160774 Ga0496125_0160774_146_1486 439

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00033

Cytochrome_B

Cytochrome b/b6/petB

35

222

0.99

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

104

273

0.97

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

278

394

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ybb-assembly1.cif.gz_c fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) 0.9249 38 397
2fyn-assembly1.cif.gz_A crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex 0.9242 7 412
6nin-assembly1.cif.gz_A rhodobacter sphaeroides bc1 with stigmatellin a 0.9236 7 412
1ezv-assembly1.cif.gz_C-1 structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment 0.9213 18 397
5kkz-assembly2.cif.gz_K rhodobacter sphaeroides bc1 with famoxadone 0.9212 7 416
ID Description Score Start End Superfamily
2fynA00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9242 7 412 1.20.810.10
1kyoC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9208 18 397 1.20.810.10
1bgyC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.914 19 397 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9138 9 397 1.20.810.10
af_Q37311_1_385_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8959 21 426 1.20.810.10
ID Description Score Start End GO Terms
AF-C4T8B9-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9726 290 397 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-W8WIB2-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9506 285 397 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-X5H3T1-F1-model_v4 Cytochrome b 0.9428 37 413 GO:0008121
GO:0022904
GO:0045275
GO:0046872
AF-A0A0A1H1B2-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9348 248 397 GO:0005743
GO:0006122
GO:0008121
GO:0046872
AF-A0A2D0WHJ7-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9326 273 397 GO:0005743
GO:0006122
GO:0008121
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.4 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map