F374262

General Info

Members Datasets Scaffolds Average Seq Length
266 166 532 215

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0610594|Ga0451576_0610594_347_991
Length 214
Sequence LSGKVAVVDYGMGNLRSVSQAVLHVAAGSGVEVVVTASADEVMAADRVVLPGQGAIRDCMRELEDSGLKAAVLHAAAHKPLLGVCVGMQMLLEHSEEQDTPALGLMPGRVRRFQLDGRLQADGSRFKVPQMGWNRVRQQPHAMWDGVPDDAWFYFVHSYYAEPSNPRHSMGWTDYGARFTCVLARDNIFATQFHPEKSAEHGLALYRNFLHWRP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
87 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
88 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
92 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
93 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
94 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
95 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
96 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
97 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
98 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
134 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
135 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
140 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
141 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
142 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
150 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
155 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
156 2643221585 Pelomonas sp. Root662 Isolate Unclassified
157 2643221638 Duganella sp. Root336D2 Isolate Unclassified
158 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
159 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
160 2643221656 Pelomonas sp. Root405 Isolate Unclassified
161 2643221658 Variovorax sp. Root411 Isolate Unclassified
162 2738541337 Pelomonas sp. BT06 Isolate Unclassified
163 2831864461 Roseateles noduli HZ7 Isolate Nodule
164 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
165 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
166 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.2
Nodule 0.75
Rhizoplane 0.38
Rhizosphere 53.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0610594 3300045051 Bacteria 1146
2 JGI25158J39367_1001690 3300002739 Bacteria 3788
3 JGI25152J39213_1000311 3300002773 Bacteria 31294
4 JGI25159J45721_1001570 3300002987 Bacteria 9357
5 JGI25159J45721_1001892 3300002987 Bacteria 8366
6 JGI25159J45721_1009878 3300002987 Bacteria 2481
7 JGI25153J46596_10024815 3300003215 Bacteria 2154
8 rootH1_10086690 3300003323 Bacteria 1270
9 JGI25160J50197_1013514 3300003354 Bacteria 2778
10 JGI25161J50226_1005224 3300003374 Bacteria 2562
11 JGI25161J50226_1008288 3300003374 Bacteria 1615
12 Ga0055525_1000031 3300003759 Bacteria 314909
13 Ga0055526_1004387 3300003771 Bacteria 8507
14 Ga0055526_1008377 3300003771 Bacteria 5173
15 Ga0055526_1015027 3300003771 Bacteria 3135
16 Ga0055537_1006072 3300003773 Bacteria 3129
17 Ga0055537_1019311 3300003773 Bacteria 1062
18 Ga0055524_1000403 3300003775 Bacteria 36914
19 Ga0055524_1012144 3300003775 Bacteria 3323
20 Ga0055534_1004167 3300003784 Bacteria 4276
21 Ga0055534_1014673 3300003784 Bacteria 1459
22 Ga0055528_1017637 3300003790 Bacteria 2464
23 Ga0055530_10025681 3300003791 Bacteria 1640
24 Ga0055530_10040932 3300003791 Bacteria 1134
25 Ga0055531_10000105 3300003794 Bacteria 91871
26 Ga0055531_10002316 3300003794 Bacteria 12860
27 Ga0055531_10006578 3300003794 Bacteria 6562
28 Ga0055531_10049995 3300003794 Bacteria 1112
29 Ga0055543_1001677 3300004625 Bacteria 8403
30 Ga0055543_1040864 3300004625 Bacteria 783
31 Ga0065165_1000034 3300005262 Bacteria 214644
32 Ga0065165_1000170 3300005262 Bacteria 115389
33 Ga0065165_1000273 3300005262 Bacteria 87879
34 Ga0065165_1004802 3300005262 Bacteria 8063
35 Ga0070682_100519866 3300005337 Bacteria 926
36 Ga0070668_100190470 3300005347 Bacteria 1680
37 Ga0070662_100001973 3300005457 Bacteria 12604
38 Ga0070706_100039200 3300005467 Bacteria 4374
39 Ga0070672_100133869 3300005543 Bacteria 2040
40 Ga0068852_100556375 3300005616 Bacteria 1148
41 Ga0075366_10129540 3300006195 Bacteria 1522
42 Ga0075370_10010743 3300006353 Bacteria 4798
43 Ga0099823_1000155 3300006944 Bacteria 36540
44 Ga0114129_10085847 3300009147 Bacteria 4366
45 Ga0105243_10035082 3300009148 Bacteria 3888
46 Ga0105243_10269263 3300009148 Bacteria 1529
47 Ga0105248_11415597 3300009177 Bacteria 787
48 Ga0157319_1000003 3300012497 Bacteria 397199
49 Ga0163162_10470427 3300013306 Bacteria 1388
50 Ga0157375_11068061 3300013308 Bacteria 944
51 Ga0213872_10000031 3300021361 Bacteria 139321
52 Ga0213872_10000144 3300021361 Bacteria 64690
53 Ga0213872_10000175 3300021361 Bacteria 57086
54 Ga0213872_10000474 3300021361 Bacteria 32444
55 Ga0213872_10010796 3300021361 Bacteria 4335
56 Ga0213872_10026256 3300021361 Bacteria 2676
57 Ga0213872_10068278 3300021361 Bacteria 1604
58 Ga0209436_102173 3300025208 Bacteria 6125
59 Ga0209563_100044 3300025230 Bacteria 396812
60 Ga0209258_109883 3300025242 Bacteria 1261
61 Ga0207425_1000009 3300025245 Bacteria 593135
62 Ga0207425_1000036 3300025245 Bacteria 225783
63 Ga0209129_1000198 3300025258 Bacteria 78327
64 Ga0209565_1001293 3300025263 Bacteria 11598
65 Ga0209565_1002903 3300025263 Bacteria 5858
66 Ga0209565_1003022 3300025263 Bacteria 5687
67 Ga0209565_1014279 3300025263 Bacteria 1829
68 Ga0209673_1003591 3300025273 Bacteria 9019
69 Ga0209130_1000016 3300025284 Bacteria 395540
70 Ga0209130_1000834 3300025284 Bacteria 25777
71 Ga0209130_1003201 3300025284 Bacteria 7226
72 Ga0209675_1002921 3300025291 Bacteria 8455
73 Ga0209564_1000021 3300025295 Bacteria 571316
74 Ga0209564_1000927 3300025295 Bacteria 38143
75 Ga0209564_1006015 3300025295 Bacteria 6699
76 Ga0209564_1007914 3300025295 Bacteria 5364
77 Ga0209758_1000054 3300025297 Bacteria 337655
78 Ga0209050_1000086 3300025298 Bacteria 262009
79 Ga0209050_1000549 3300025298 Bacteria 62089
80 Ga0209050_1002284 3300025298 Bacteria 16944
81 Ga0209050_1003427 3300025298 Bacteria 11705
82 Ga0209050_1016110 3300025298 Bacteria 3081
83 Ga0209256_1000085 3300025299 Bacteria 219043
84 Ga0209256_1000437 3300025299 Bacteria 64248
85 Ga0209256_1005297 3300025299 Bacteria 7510
86 Ga0209256_1007190 3300025299 Bacteria 5585
87 Ga0207426_1004949 3300025302 Bacteria 6281
88 Ga0209051_1001914 3300025303 Bacteria 16167
89 Ga0209051_1001930 3300025303 Bacteria 16022
90 Ga0209051_1015850 3300025303 Bacteria 3449
91 Ga0209257_1000047 3300025304 Bacteria 460507
92 Ga0209257_1000087 3300025304 Bacteria 282503
93 Ga0209257_1000479 3300025304 Bacteria 72716
94 Ga0209257_1000758 3300025304 Bacteria 48724
95 Ga0209257_1003100 3300025304 Bacteria 14894
96 Ga0209257_1025316 3300025304 Bacteria 2029
97 Ga0209257_1026845 3300025304 Bacteria 1930
98 Ga0207659_10398988 3300025926 Bacteria 1150
99 Ga0207706_10005101 3300025933 Bacteria 12262
100 Ga0207709_10169994 3300025935 Bacteria 1529
101 Ga0207709_10170419 3300025935 Bacteria 1527
102 Ga0207711_10322190 3300025941 Bacteria 1428
103 Ga0207668_10424435 3300025972 Bacteria 1129
104 Ga0207702_10650761 3300026078 Bacteria 1036
105 Ga0207698_10209961 3300026142 Bacteria 1751
106 Ga0207698_10256543 3300026142 Bacteria 1604
107 Ga0207428_10073354 3300027907 Bacteria 2685
108 Ga0268265_11040255 3300028380 Bacteria 810
109 Ga0307515_10000382 3300028794 Bacteria 107907
110 Ga0307515_10001774 3300028794 Bacteria 48109
111 Ga0307515_10001873 3300028794 Bacteria 46808
112 Ga0307515_10041325 3300028794 Bacteria 7253
113 Ga0307515_10057425 3300028794 Bacteria 5632
114 Ga0307515_10060475 3300028794 Bacteria 5400
115 Ga0307515_10094035 3300028794 Bacteria 3708
116 Ga0307512_10171636 3300030522 Bacteria 1242
117 Ga0265331_10001682 3300031250 Bacteria 15989
118 Ga0265327_10000042 3300031251 Bacteria 287487
119 Ga0307513_10009162 3300031456 Bacteria 12537
120 Ga0307509_10018446 3300031507 Bacteria 8000
121 Ga0307509_10028664 3300031507 Bacteria 6187
122 Ga0307509_10055353 3300031507 Bacteria 4216
123 Ga0307509_10200024 3300031507 Bacteria 1836
124 Ga0307408_100000029 3300031548 Bacteria 227806
125 Ga0307408_100017879 3300031548 Bacteria 4751
126 Ga0307408_100034792 3300031548 Bacteria 3531
127 Ga0307408_100088754 3300031548 Bacteria 2329
128 Ga0307408_100360502 3300031548 Bacteria 1236
129 Ga0307408_100411657 3300031548 Bacteria 1163
130 Ga0307408_100869320 3300031548 Bacteria 823
131 Ga0307508_10000053 3300031616 Bacteria 128020
132 Ga0307508_10000109 3300031616 Bacteria 97316
133 Ga0307508_10298504 3300031616 Bacteria 1204
134 Ga0307514_10000954 3300031649 Bacteria 43472
135 Ga0307516_10003615 3300031730 Bacteria 19669
136 Ga0307516_10221675 3300031730 Bacteria 1600
137 Ga0307516_10340964 3300031730 Bacteria 1166
138 Ga0307405_11116559 3300031731 Bacteria 678
139 Ga0307406_10089268 3300031901 Bacteria 2071
140 Ga0307414_10038295 3300032004 Bacteria 3219
141 Ga0307411_10002554 3300032005 Bacteria 8117
142 Ga0307507_10066771 3300033179 Bacteria 3294
143 Ga0307507_10206469 3300033179 Bacteria 1348
144 Ga0307510_10000429 3300033180 Bacteria 40378
145 Ga0307510_10207641 3300033180 Bacteria 1485
146 Ga0373950_0002421 3300034818 Bacteria 2564
147 Ga0373949_0014697 3300035090 Bacteria 1745
148 Ga0373939_0000012 3300035114 Bacteria 67223
149 Ga0373961_0098572 3300035241 Bacteria 943
150 Ga0373962_0130716 3300035242 Bacteria 808
151 Ga0373931_0011591 3300035691 Bacteria 4259
152 Ga0373931_0551149 3300035691 Bacteria 749
153 Ga0395900_0000183 3300037418 Bacteria 100749
154 Ga0395898_0012246 3300037466 Bacteria 8867
155 Ga0395905_0006280 3300037471 Bacteria 11985
156 Ga0395905_0013332 3300037471 Bacteria 7879
157 Ga0395905_0021039 3300037471 Bacteria 6176
158 Ga0395905_0284768 3300037471 Bacteria 1539
159 Ga0436361_0110525 3300039447 Bacteria 45343
160 Ga0436361_0469917 3300039447 Bacteria 4155
161 Ga0436361_0913791 3300039447 Bacteria 99691
162 Ga0436361_0920355 3300039447 Bacteria 16590
163 Ga0436361_0932187 3300039447 Bacteria 1624
164 Ga0436361_0975627 3300039447 Bacteria 3487
165 Ga0436361_1096550 3300039447 Bacteria 54500
166 Ga0436361_1151553 3300039447 Bacteria 66661
167 Ga0439433_0019955 3300041999 Bacteria 1495
168 Ga0439437_013073 3300042000 Bacteria 963
169 Ga0439443_033642 3300042003 Bacteria 854
170 Ga0439449_0096263 3300042007 Bacteria 1094
171 Ga0439455_0037471 3300042012 Bacteria 1230
172 Ga0450917_000077 3300042120 Bacteria 5580
173 Ga0450890_000247 3300042127 Bacteria 8050
174 Ga0450890_000608 3300042127 Bacteria 5230
175 Ga0450891_000161 3300042129 Bacteria 6380
176 Ga0450898_015383 3300042134 Bacteria 1296
177 Ga0450900_017149 3300042136 Bacteria 986
178 Ga0450889_000766 3300042144 Bacteria 3448
179 Ga0439444_0015464 3300042437 Bacteria 1289
180 Ga0450893_0001903 3300042532 Bacteria 3238
181 Ga0451577_0045310 3300042876 Bacteria 3937
182 Ga0451577_0108081 3300042876 Bacteria 2487
183 Ga0466969_0000020 3300044656 Bacteria 101861
184 Ga0466969_0146213 3300044656 Bacteria 1090
185 Ga0466972_0001353 3300044658 Bacteria 11872
186 Ga0466965_0017692 3300044683 Bacteria 3410
187 Ga0466965_0026491 3300044683 Bacteria 2810
188 Ga0466965_0034681 3300044683 Bacteria 2469
189 Ga0466965_0086347 3300044683 Bacteria 1591
190 Ga0466965_0429275 3300044683 Bacteria 733
191 Ga0466966_0015082 3300044684 Bacteria 5111
192 Ga0466961_0005878 3300044693 Bacteria 7772
193 Ga0466961_0010837 3300044693 Bacteria 5821
194 Ga0466961_0100870 3300044693 Bacteria 1818
195 Ga0466963_0022154 3300044694 Bacteria 4021
196 Ga0466964_0041302 3300044706 Bacteria 1865
197 Ga0466964_0174011 3300044706 Bacteria 1016
198 Ga0453684_0139836 3300044712 Bacteria 2893
199 Ga0453684_0447098 3300044712 Bacteria 1439
200 Ga0466971_0073778 3300044719 Bacteria 1551
201 Ga0466971_0128457 3300044719 Bacteria 1175
202 Ga0466968_0168656 3300044735 Bacteria 1013
203 Ga0466970_0149557 3300044765 Bacteria 1289
204 Ga0466959_0072394 3300045049 Bacteria 2495
205 Ga0451576_0111895 3300045051 Bacteria 2841
206 Ga0451576_0232964 3300045051 Bacteria 1923
207 Ga0466958_0050288 3300045836 Bacteria 2523
208 Ga0466967_0164317 3300045976 Bacteria 2085
209 Ga0495590_0012513 3300046457 Bacteria 3148
210 Ga0495585_0018557 3300046492 Bacteria 4011
211 Ga0495666_0105045 3300046526 Bacteria 1329
212 Ga0495621_0023417 3300046539 Bacteria 2053
213 Ga0495621_0155671 3300046539 Bacteria 901
214 Ga0495597_0144875 3300046542 Bacteria 978
215 Ga0495668_0000231 3300046616 Bacteria 79433
216 Ga0495658_0008742 3300046683 Bacteria 5030
217 Ga0495670_0086211 3300046691 Bacteria 1603
218 Ga0495636_0152664 3300047318 Bacteria 1037
219 Ga0495686_0000604 3300047472 Bacteria 49704
220 Ga0496108_0071225 3300048911 Bacteria 2933
221 Ga0496118_0165281 3300048921 Bacteria 1361
222 Ga0496121_0020087 3300048924 Bacteria 6636
223 Ga0496124_0000108 3300048927 Bacteria 167473
224 Ga0496124_0054980 3300048927 Bacteria 3367
225 Ga0496125_0008324 3300048928 Bacteria 10885
226 Ga0495678_098377 3300049459 Bacteria 1017
227 Ga0501292_063866 3300049515 Bacteria 673
228 Ga0501036_1188761 3300049572 Bacteria 622
229 Ga0501071_0341355 3300049587 Bacteria 1139
230 Ga0501201_009457 3300049651 Bacteria 949
231 Ga0501222_025524 3300049662 Bacteria 800
232 Ga0501227_001594 3300049665 Bacteria 5056
233 Ga0501235_041434 3300049669 Bacteria 1053
234 Ga0501258_012600 3300049687 Bacteria 919
235 Ga0501225_0010042 3300049705 Bacteria 2688
236 Ga0501229_000089 3300049706 Bacteria 9401
237 Ga0501245_038483 3300049708 Bacteria 815
238 Ga0501272_002719 3300049769 Bacteria 1762
239 Ga0501283_014981 3300049779 Bacteria 1190
240 Ga0501035_0087426 3300049822 Bacteria 2747
241 nmdc:mga0yw44_14857_c1 3300050492 Bacteria 4150
242 nmdc:mga0k408_63618_c1 3300050493 Bacteria 2146
243 nmdc:mga07m45_1162_c1 3300050496 Bacteria 11830
244 nmdc:mga07m45_5424_c1 3300050496 Bacteria 6347
245 nmdc:mga07m45_7565_c1 3300050496 Bacteria 5555
246 nmdc:mga05p37_320847_c1 3300050507 Bacteria 1833
247 nmdc:mga08y16_68226_c1 3300050511 Bacteria 3708
248 Ga0500593_000047 3300053117 Bacteria 42992
249 Ga0500597_163426 3300053120 Bacteria 951
250 Ga0500652_015172 3300053131 Bacteria 2775
251 Ga0500622_0002547 3300053156 Bacteria 13059
252 Ga0466962_0027384 3300061719 Bacteria 2735
253 Ga0466962_0042303 3300061719 Bacteria 2180
254 2643743625 2643221544 Bacteria 5886209
255 2643792567 2643221554 Bacteria 6603920
256 2643936608 2643221585 Bacteria 5812563
257 2644216917 2643221638 Bacteria 6579467
258 2644222493 2643221639 Bacteria 6649903
259 2644256661 2643221646 Bacteria 6433402
260 2644317964 2643221656 Bacteria 5809961
261 2644324291 2643221658 Bacteria 6064537
262 2739058158 2738541337 Bacteria 6183410
263 2831865188 2831864461 Bacteria 6502356
264 2881103407 2881101125 Bacteria 4590519
265 2886851785 2886848708 Bacteria 5632523
266 2904481553 2904479285 Bacteria 5073931
267 Ga0451576_0610594
268 JGI25158J39367_1001690
269 JGI25152J39213_1000311
270 JGI25159J45721_1001570
271 JGI25159J45721_1001892
272 JGI25159J45721_1009878
273 JGI25153J46596_10024815
274 rootH1_10086690
275 JGI25160J50197_1013514
276 JGI25161J50226_1005224
277 JGI25161J50226_1008288
278 Ga0055525_1000031
279 Ga0055526_1004387
280 Ga0055526_1008377
281 Ga0055526_1015027
282 Ga0055537_1006072
283 Ga0055537_1019311
284 Ga0055524_1000403
285 Ga0055524_1012144
286 Ga0055534_1004167
287 Ga0055534_1014673
288 Ga0055528_1017637
289 Ga0055530_10025681
290 Ga0055530_10040932
291 Ga0055531_10000105
292 Ga0055531_10002316
293 Ga0055531_10006578
294 Ga0055531_10049995
295 Ga0055543_1001677
296 Ga0055543_1040864
297 Ga0065165_1000034
298 Ga0065165_1000170
299 Ga0065165_1000273
300 Ga0065165_1004802
301 Ga0070682_100519866
302 Ga0070668_100190470
303 Ga0070662_100001973
304 Ga0070706_100039200
305 Ga0070672_100133869
306 Ga0068852_100556375
307 Ga0075366_10129540
308 Ga0075370_10010743
309 Ga0099823_1000155
310 Ga0114129_10085847
311 Ga0105243_10035082
312 Ga0105243_10269263
313 Ga0105248_11415597
314 Ga0157319_1000003
315 Ga0163162_10470427
316 Ga0157375_11068061
317 Ga0213872_10000031
318 Ga0213872_10000144
319 Ga0213872_10000175
320 Ga0213872_10000474
321 Ga0213872_10010796
322 Ga0213872_10026256
323 Ga0213872_10068278
324 Ga0209436_102173
325 Ga0209563_100044
326 Ga0209258_109883
327 Ga0207425_1000009
328 Ga0207425_1000036
329 Ga0209129_1000198
330 Ga0209565_1001293
331 Ga0209565_1002903
332 Ga0209565_1003022
333 Ga0209565_1014279
334 Ga0209673_1003591
335 Ga0209130_1000016
336 Ga0209130_1000834
337 Ga0209130_1003201
338 Ga0209675_1002921
339 Ga0209564_1000021
340 Ga0209564_1000927
341 Ga0209564_1006015
342 Ga0209564_1007914
343 Ga0209758_1000054
344 Ga0209050_1000086
345 Ga0209050_1000549
346 Ga0209050_1002284
347 Ga0209050_1003427
348 Ga0209050_1016110
349 Ga0209256_1000085
350 Ga0209256_1000437
351 Ga0209256_1005297
352 Ga0209256_1007190
353 Ga0207426_1004949
354 Ga0209051_1001914
355 Ga0209051_1001930
356 Ga0209051_1015850
357 Ga0209257_1000047
358 Ga0209257_1000087
359 Ga0209257_1000479
360 Ga0209257_1000758
361 Ga0209257_1003100
362 Ga0209257_1025316
363 Ga0209257_1026845
364 Ga0207659_10398988
365 Ga0207706_10005101
366 Ga0207709_10169994
367 Ga0207709_10170419
368 Ga0207711_10322190
369 Ga0207668_10424435
370 Ga0207702_10650761
371 Ga0207698_10209961
372 Ga0207698_10256543
373 Ga0207428_10073354
374 Ga0268265_11040255
375 Ga0307515_10000382
376 Ga0307515_10001774
377 Ga0307515_10001873
378 Ga0307515_10041325
379 Ga0307515_10057425
380 Ga0307515_10060475
381 Ga0307515_10094035
382 Ga0307512_10171636
383 Ga0265331_10001682
384 Ga0265327_10000042
385 Ga0307513_10009162
386 Ga0307509_10018446
387 Ga0307509_10028664
388 Ga0307509_10055353
389 Ga0307509_10200024
390 Ga0307408_100000029
391 Ga0307408_100017879
392 Ga0307408_100034792
393 Ga0307408_100088754
394 Ga0307408_100360502
395 Ga0307408_100411657
396 Ga0307408_100869320
397 Ga0307508_10000053
398 Ga0307508_10000109
399 Ga0307508_10298504
400 Ga0307514_10000954
401 Ga0307516_10003615
402 Ga0307516_10221675
403 Ga0307516_10340964
404 Ga0307405_11116559
405 Ga0307406_10089268
406 Ga0307414_10038295
407 Ga0307411_10002554
408 Ga0307507_10066771
409 Ga0307507_10206469
410 Ga0307510_10000429
411 Ga0307510_10207641
412 Ga0373950_0002421
413 Ga0373949_0014697
414 Ga0373939_0000012
415 Ga0373961_0098572
416 Ga0373962_0130716
417 Ga0373931_0011591
418 Ga0373931_0551149
419 Ga0395900_0000183
420 Ga0395898_0012246
421 Ga0395905_0006280
422 Ga0395905_0013332
423 Ga0395905_0021039
424 Ga0395905_0284768
425 Ga0436361_0110525
426 Ga0436361_0469917
427 Ga0436361_0913791
428 Ga0436361_0920355
429 Ga0436361_0932187
430 Ga0436361_0975627
431 Ga0436361_1096550
432 Ga0436361_1151553
433 Ga0439433_0019955
434 Ga0439437_013073
435 Ga0439443_033642
436 Ga0439449_0096263
437 Ga0439455_0037471
438 Ga0450917_000077
439 Ga0450890_000247
440 Ga0450890_000608
441 Ga0450891_000161
442 Ga0450898_015383
443 Ga0450900_017149
444 Ga0450889_000766
445 Ga0439444_0015464
446 Ga0450893_0001903
447 Ga0451577_0045310
448 Ga0451577_0108081
449 Ga0466969_0000020
450 Ga0466969_0146213
451 Ga0466972_0001353
452 Ga0466965_0017692
453 Ga0466965_0026491
454 Ga0466965_0034681
455 Ga0466965_0086347
456 Ga0466965_0429275
457 Ga0466966_0015082
458 Ga0466961_0005878
459 Ga0466961_0010837
460 Ga0466961_0100870
461 Ga0466963_0022154
462 Ga0466964_0041302
463 Ga0466964_0174011
464 Ga0453684_0139836
465 Ga0453684_0447098
466 Ga0466971_0073778
467 Ga0466971_0128457
468 Ga0466968_0168656
469 Ga0466970_0149557
470 Ga0466959_0072394
471 Ga0451576_0111895
472 Ga0451576_0232964
473 Ga0466958_0050288
474 Ga0466967_0164317
475 Ga0495590_0012513
476 Ga0495585_0018557
477 Ga0495666_0105045
478 Ga0495621_0023417
479 Ga0495621_0155671
480 Ga0495597_0144875
481 Ga0495668_0000231
482 Ga0495658_0008742
483 Ga0495670_0086211
484 Ga0495636_0152664
485 Ga0495686_0000604
486 Ga0496108_0071225
487 Ga0496118_0165281
488 Ga0496121_0020087
489 Ga0496124_0000108
490 Ga0496124_0054980
491 Ga0496125_0008324
492 Ga0495678_098377
493 Ga0501292_063866
494 Ga0501036_1188761
495 Ga0501071_0341355
496 Ga0501201_009457
497 Ga0501222_025524
498 Ga0501227_001594
499 Ga0501235_041434
500 Ga0501258_012600
501 Ga0501225_0010042
502 Ga0501229_000089
503 Ga0501245_038483
504 Ga0501272_002719
505 Ga0501283_014981
506 Ga0501035_0087426
507 nmdc:mga0yw44_14857_c1
508 nmdc:mga0k408_63618_c1
509 nmdc:mga07m45_1162_c1
510 nmdc:mga07m45_5424_c1
511 nmdc:mga07m45_7565_c1
512 nmdc:mga05p37_320847_c1
513 nmdc:mga08y16_68226_c1
514 Ga0500593_000047
515 Ga0500597_163426
516 Ga0500652_015172
517 Ga0500622_0002547
518 Ga0466962_0027384
519 Ga0466962_0042303
520 2643743625
521 2643792567
522 2643936608
523 2644216917
524 2644222493
525 2644256661
526 2644317964
527 2644324291
528 2739058158
529 2831865188
530 2881103407
531 2886851785
532 2904481553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

6

212

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9541 1 209
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9466 4 211
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9328 4 211
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9276 3 210
6ymu-assembly4.cif.gz_D imidazole glycerol phosphate synthase 0.9266 3 210
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9593 4 211 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9497 4 211 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.949 4 210 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9377 4 211 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9281 2 211 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A699Q1T2-F1-model_v4 deleted 0.9947 129 212
AF-A0A6A5L517-F1-model_v4 deleted 0.9938 1 212
AF-A0A351U0H9-F1-model_v4 deleted 0.9895 124 210
AF-A0A853QX37-F1-model_v4 deleted 0.9889 106 213
AF-A0A7X3ZCE6-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 2.4.2.-) 0.9878 125 212 GO:0000105
GO:0000107
GO:0016787
GO:0016829

Map