F374446

General Info

Members Datasets Scaffolds Average Seq Length
266 224 532 442

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025530807|8025535008
Length 500
Sequence CFLRASWAGLKVDQSIPRKLSRRRPVPETELSMTTRIPEPALSEASRPSDPRKMRKIAVASVIGTTVEWYDLFVFGTASALVFDKIFFPQLDGTVGTILAFLTFASAYLARMVGAVVFGHFGDRIGRKSMLLTSLMMMGIATFAIGLVPDYNTIGVAAPFLLLALRVVQGLALGGEWGGAVLMTVEHAPADRRGFFGSTVQIGVPIGTLLANGVFLLVAWQTSSAELHSWGWRIPFLLSAVLVCVGIYIRLNIEETSTFQAVREAGAKARIPFVALMRRYWRQVLLGGIATLSTGSTFTLLITSGVNYGTDELGHSESLMLWAVMAACAIAFVLIPFFGHLSDRFGRKPVIYAGVAAEAFLAFPFFWLLDTGSAPLVFVAYALMAAAFSANYGPIATFLAELFGARVRYSGLSVAYMLSGLLGSAATPVITLWLLSLTGNSSSIAWYILAASAASLIALFLLSETRFGSISEDGGEGEGEGDAASVSASVSVTADAEARV

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
170 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
171 2511231004 Pseudomonas sp. GM102 Isolate Nodule
172 2511231014 Pseudomonas sp. GM48 Isolate Nodule
173 2511231015 Pseudomonas sp. GM49 Isolate Nodule
174 2511231016 Pseudomonas sp. GM50 Isolate Nodule
175 2511231017 Pseudomonas sp. GM55 Isolate Nodule
176 2511231018 Pseudomonas sp. GM60 Isolate Nodule
177 2511231019 Pseudomonas sp. GM67 Isolate Nodule
178 2511231020 Pseudomonas sp. GM74 Isolate Nodule
179 2511231024 Pseudomonas sp. GM84 Isolate Nodule
180 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
181 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
182 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
183 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
184 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
185 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
186 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
187 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
188 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
189 2643221558 Rhizobium sp. Root149 Isolate Unclassified
190 2643221607 Rhizobium sp. Root73 Isolate Unclassified
191 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
192 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
193 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
194 2643221696 Nocardioides sp. Root140 Isolate Unclassified
195 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
196 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
197 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
198 2739367653 Kocuria sp. OV113 Isolate Unclassified
199 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
200 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
201 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
202 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
203 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
204 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
205 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
206 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
207 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
208 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
209 2855730933 Achromobacter sp. HZ28 Isolate Nodule
210 2855767633 Achromobacter sp. HZ34 Isolate Nodule
211 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
212 2857727296 Kocuria sp. R-72562 Isolate Unclassified
213 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
214 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
215 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
216 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
217 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
218 2920879853 Kocuria salina CV6 Isolate Unclassified
219 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
220 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
221 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
222 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
223 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
224 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.57
Metatranscriptomes 0
Isolates 21.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 7.52
Rhizoplane 3.01
Rhizosphere 62.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000030 3300002704 Bacteria 114492
2 JGI25156J39149_1000059 3300002705 Bacteria 86130
3 JGI25154J39366_1000056 3300002738 Bacteria 114494
4 JGI25157J39369_1000123 3300002741 Bacteria 65925
5 Ga0055532_1000059 3300003758 Bacteria 152948
6 Ga0055535_1004336 3300003761 Bacteria 3488
7 Ga0055526_1000444 3300003771 Bacteria 32945
8 Ga0055524_1000031 3300003775 Bacteria 187744
9 Ga0070677_10018354 3300005333 Bacteria 2518
10 Ga0070675_100066601 3300005354 Bacteria 2979
11 Ga0070671_100137141 3300005355 Bacteria 2063
12 Ga0070674_100064403 3300005356 Bacteria 2568
13 Ga0070673_100063684 3300005364 Bacteria 2935
14 Ga0070679_100036691 3300005530 Bacteria 4865
15 Ga0068855_100016481 3300005563 Bacteria 8885
16 Ga0068852_100004286 3300005616 Bacteria 10064
17 Ga0081455_10117463 3300005937 Bacteria 2102
18 Ga0075364_10004656 3300006051 Bacteria 7912
19 Ga0075364_10041343 3300006051 Bacteria 2993
20 Ga0099823_1000047 3300006944 Bacteria 58430
21 Ga0079104_1000193 3300006946 Bacteria 85489
22 Ga0105244_10077484 3300009036 Bacteria 1649
23 Ga0105250_10006070 3300009092 Bacteria 5321
24 Ga0105240_10000344 3300009093 Bacteria 87083
25 Ga0105237_10094953 3300009545 Bacteria 2971
26 Ga0105238_10029843 3300009551 Bacteria 5553
27 Ga0105249_10038139 3300009553 Bacteria 4359
28 Ga0157373_10090839 3300013100 Bacteria 2151
29 Ga0157369_10270228 3300013105 Bacteria 1772
30 Ga0163162_10025174 3300013306 Bacteria 5882
31 Ga0157372_10286195 3300013307 Bacteria 1917
32 Ga0157375_10030689 3300013308 Bacteria 5072
33 Ga0182008_10011185 3300014497 Bacteria 4785
34 Ga0182006_1004018 3300015261 Bacteria 7339
35 Ga0209435_100032 3300025206 Bacteria 153068
36 Ga0209147_100109 3300025229 Bacteria 153068
37 Ga0209437_100261 3300025233 Bacteria 82127
38 Ga0209258_100190 3300025242 Bacteria 126878
39 Ga0209646_1000113 3300025246 Bacteria 153068
40 Ga0209026_1000102 3300025250 Bacteria 153068
41 Ga0209759_1000104 3300025256 Bacteria 153068
42 Ga0209675_1002025 3300025291 Bacteria 10833
43 Ga0209564_1000135 3300025295 Bacteria 188117
44 Ga0209256_1000107 3300025299 Bacteria 186233
45 Ga0207426_1001323 3300025302 Bacteria 21124
46 Ga0207426_1001651 3300025302 Bacteria 17358
47 Ga0207426_1005652 3300025302 Bacteria 5655
48 Ga0209051_1007771 3300025303 Bacteria 5800
49 Ga0207697_10023531 3300025315 Bacteria 2522
50 Ga0207696_1002710 3300025711 Bacteria 8476
51 Ga0207655_1028420 3300025728 Bacteria 2639
52 Ga0207713_1020539 3300025735 Bacteria 3196
53 Ga0207680_10114962 3300025903 Bacteria 1752
54 Ga0207695_10001722 3300025913 Bacteria 34994
55 Ga0207652_10271285 3300025921 Bacteria 1530
56 Ga0207687_10014212 3300025927 Bacteria 5208
57 Ga0207669_10075572 3300025937 Bacteria 2135
58 Ga0207691_10023019 3300025940 Bacteria 5868
59 Ga0207667_10005245 3300025949 Bacteria 15813
60 Ga0207712_10060525 3300025961 Bacteria 2685
61 Ga0207675_100055793 3300026118 Bacteria 3686
62 Ga0207683_10021730 3300026121 Bacteria 5500
63 Ga0207698_10002888 3300026142 Bacteria 10282
64 Ga0209281_1000034 3300027111 Bacteria 382562
65 Ga0209389_1000116 3300027296 Bacteria 71576
66 Ga0307515_10030752 3300028794 Bacteria 8997
67 Ga0307515_10161953 3300028794 Bacteria 2277
68 Ga0265328_10001104 3300031239 Bacteria 12408
69 Ga0265327_10000004 3300031251 Bacteria 803973
70 Ga0307513_10015597 3300031456 Bacteria 9202
71 Ga0307508_10007002 3300031616 Bacteria 10515
72 Ga0307508_10071313 3300031616 Bacteria 3047
73 Ga0307514_10009902 3300031649 Bacteria 7984
74 Ga0307514_10016538 3300031649 Bacteria 6077
75 Ga0307516_10045978 3300031730 Bacteria 4309
76 Ga0307410_10072075 3300031852 Bacteria 2398
77 Ga0307406_10000703 3300031901 Bacteria 18900
78 Ga0307416_100023361 3300032002 Bacteria 4486
79 Ga0307416_100120716 3300032002 Bacteria 2335
80 Ga0307510_10008147 3300033180 Bacteria 12480
81 Ga0395900_0027855 3300037418 Bacteria 5789
82 Ga0395898_0015670 3300037466 Bacteria 7768
83 Ga0395905_0000160 3300037471 Bacteria 111265
84 Ga0395901_0178930 3300038443 Bacteria 2224
85 Ga0436362_0025731 3300039453 Bacteria 5582
86 Ga0436362_0805059 3300039453 Bacteria 2590
87 Ga0466961_0004419 3300044693 Bacteria 8801
88 Ga0466968_0012687 3300044735 Bacteria 3305
89 Ga0466959_0004689 3300045049 Bacteria 9204
90 Ga0466958_0003198 3300045836 Bacteria 8449
91 Ga0495627_000338 3300046453 Bacteria 44224
92 Ga0495591_000016 3300046458 Bacteria 244927
93 Ga0495629_0004461 3300046459 Bacteria 10489
94 Ga0495653_0000074 3300046463 Bacteria 83844
95 Ga0495650_0000950 3300046471 Bacteria 33495
96 Ga0495650_0012484 3300046471 Bacteria 4567
97 Ga0495650_0013491 3300046471 Bacteria 4316
98 Ga0495580_0081353 3300046472 Bacteria 2257
99 Ga0495582_0044831 3300046473 Bacteria 2435
100 Ga0495605_0000244 3300046474 Bacteria 64456
101 Ga0495605_0002546 3300046474 Bacteria 11231
102 Ga0495639_0007212 3300046475 Bacteria 4770
103 Ga0495585_0000469 3300046492 Bacteria 38600
104 Ga0495585_0000792 3300046492 Bacteria 27747
105 Ga0495585_0009370 3300046492 Bacteria 5875
106 Ga0495607_0000031 3300046501 Bacteria 153964
107 Ga0495607_0000448 3300046501 Bacteria 41496
108 Ga0495607_0012898 3300046501 Bacteria 5496
109 Ga0495583_0002279 3300046506 Bacteria 16804
110 Ga0495606_0000191 3300046507 Bacteria 107427
111 Ga0495631_0001821 3300046518 Bacteria 12596
112 Ga0495632_0001006 3300046519 Bacteria 24447
113 Ga0495632_0006935 3300046519 Bacteria 7191
114 Ga0495632_0018115 3300046519 Bacteria 3871
115 Ga0495637_0007230 3300046520 Bacteria 5522
116 Ga0495637_0013946 3300046520 Bacteria 3803
117 Ga0495637_0040323 3300046520 Bacteria 2011
118 Ga0495643_0035514 3300046522 Bacteria 2745
119 Ga0495642_0000842 3300046528 Bacteria 14666
120 Ga0495654_0002091 3300046530 Bacteria 13071
121 Ga0495609_0023821 3300046538 Bacteria 2811
122 Ga0495597_0000128 3300046542 Bacteria 68991
123 Ga0495597_0004805 3300046542 Bacteria 7300
124 Ga0495645_0016329 3300046543 Bacteria 5298
125 Ga0495667_0029571 3300046559 Bacteria 3688
126 Ga0495668_0065596 3300046616 Bacteria 1998
127 Ga0495625_0039607 3300046660 Bacteria 3440
128 Ga0495625_0047020 3300046660 Bacteria 3112
129 Ga0495625_0053597 3300046660 Bacteria 2884
130 Ga0495661_0000013 3300046665 Bacteria 259387
131 Ga0495588_0007749 3300046674 Bacteria 4904
132 Ga0495588_0027464 3300046674 Bacteria 2844
133 Ga0495588_0053978 3300046674 Bacteria 2073
134 Ga0495613_0030993 3300046689 Bacteria 3971
135 Ga0495670_0000794 3300046691 Bacteria 15179
136 Ga0495670_0001356 3300046691 Bacteria 11951
137 Ga0495671_0000780 3300046692 Bacteria 22874
138 Ga0495671_0012913 3300046692 Bacteria 4546
139 Ga0495671_0014162 3300046692 Bacteria 4297
140 Ga0495660_0000088 3300046810 Bacteria 98970
141 Ga0495660_0000566 3300046810 Bacteria 29974
142 Ga0495581_0003252 3300047315 Bacteria 9315
143 Ga0495636_0002823 3300047318 Bacteria 6701
144 Ga0495672_0001094 3300047320 Bacteria 27523
145 Ga0495672_0007941 3300047320 Bacteria 7911
146 Ga0495672_0013842 3300047320 Bacteria 5547
147 Ga0495676_0003012 3300047321 Bacteria 15226
148 Ga0495683_0000110 3300047323 Bacteria 83927
149 Ga0495687_000050 3300047443 Bacteria 200856
150 Ga0495673_0002403 3300047469 Bacteria 13199
151 Ga0495673_0022204 3300047469 Bacteria 3115
152 Ga0495681_0000081 3300047470 Bacteria 83631
153 Ga0495593_0089354 3300047673 Bacteria 1587
154 Ga0496102_0033396 3300048905 Bacteria 4623
155 Ga0496103_0025742 3300048906 Bacteria 3558
156 Ga0496104_0058040 3300048907 Bacteria 3663
157 Ga0496106_0000054 3300048909 Bacteria 93869
158 Ga0496110_0038842 3300048913 Bacteria 4143
159 Ga0496111_0100324 3300048914 Bacteria 2126
160 Ga0496114_0003723 3300048917 Bacteria 11744
161 Ga0496115_0031562 3300048918 Bacteria 4175
162 Ga0496116_0016208 3300048919 Bacteria 5845
163 Ga0496116_0026061 3300048919 Bacteria 4284
164 Ga0496116_0060647 3300048919 Bacteria 2453
165 Ga0496119_0012349 3300048922 Bacteria 6946
166 Ga0496121_0003976 3300048924 Bacteria 20389
167 Ga0496121_0011732 3300048924 Bacteria 9669
168 Ga0496121_0037235 3300048924 Bacteria 4324
169 Ga0496121_0061938 3300048924 Bacteria 3067
170 Ga0496122_0000215 3300048925 Bacteria 128810
171 Ga0496122_0000225 3300048925 Bacteria 126304
172 Ga0496123_0000192 3300048926 Bacteria 124096
173 Ga0496124_0086736 3300048927 Bacteria 2561
174 Ga0496125_0000207 3300048928 Bacteria 122897
175 Ga0496125_0000947 3300048928 Bacteria 45544
176 Ga0496125_0003130 3300048928 Bacteria 20549
177 Ga0495682_0000111 3300049460 Bacteria 71459
178 Ga0495682_0001840 3300049460 Bacteria 10653
179 Ga0501031_0000712 3300049568 Bacteria 19893
180 Ga0501032_0001162 3300049569 Bacteria 21118
181 Ga0501033_0000163 3300049570 Bacteria 63913
182 Ga0501034_0000202 3300049571 Bacteria 112985
183 Ga0501034_0000554 3300049571 Bacteria 59304
184 Ga0501036_0000021 3300049572 Bacteria 114136
185 Ga0501037_0001561 3300049573 Bacteria 16713
186 Ga0501038_0000226 3300049574 Bacteria 47831
187 Ga0501039_0012759 3300049575 Bacteria 6422
188 Ga0501043_0000297 3300049579 Bacteria 44905
189 Ga0501046_0000354 3300049580 Bacteria 46165
190 Ga0501047_0000232 3300049581 Bacteria 66245
191 Ga0501048_0000050 3300049582 Bacteria 57921
192 Ga0501067_0001956 3300049583 Bacteria 11350
193 Ga0501068_0000830 3300049584 Bacteria 16073
194 Ga0501070_0006783 3300049586 Bacteria 9742
195 Ga0501071_0058243 3300049587 Bacteria 2793
196 Ga0501072_0009910 3300049588 Bacteria 7245
197 Ga0501073_0000888 3300049589 Bacteria 21425
198 Ga0501074_0000092 3300049590 Bacteria 43073
199 Ga0501079_0007384 3300049741 Bacteria 8316
200 Ga0501083_0010061 3300049744 Bacteria 6667
201 Ga0501035_0000120 3300049822 Bacteria 94532
202 Ga0501044_0000179 3300049823 Bacteria 78633
203 Ga0501045_0022680 3300049824 Bacteria 4495
204 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
205 Ga0500618_001899 3300053125 Bacteria 8632
206 Ga0500659_0003036 3300053135 Bacteria 9993
207 Ga0500573_0001766 3300053140 Bacteria 10516
208 Ga0500577_0001217 3300053142 Bacteria 6587
209 Ga0501084_0051392 3300054114 Bacteria 3449
210 8025535008 8025530807 Bacteria 8495698
211 2511131483 2510917022 Bacteria 6504556
212 2511258328 2511231004 Bacteria 6669789
213 2511316138 2511231014 Bacteria 6462302
214 2511317849 2511231015 Bacteria 6598026
215 2511329068 2511231016 Bacteria 6704427
216 2511331929 2511231017 Bacteria 6503007
217 2511337871 2511231018 Bacteria 6436256
218 2511347620 2511231019 Bacteria 6520662
219 2511352710 2511231020 Bacteria 6115223
220 2511375232 2511231024 Bacteria 5835885
221 2513590114 2513237087 Bacteria 5817514
222 2537899173 2537561592 Bacteria 4348607
223 2563057896 2562617112 Bacteria 10918404
224 2585166338 2582581283 Bacteria 6030556
225 2585267435 2582581306 Bacteria 6450535
226 2585327163 2582581315 Bacteria 7318924
227 2585386503 2582581865 Bacteria 6644329
228 2585389070 2582581865 Bacteria 6644329
229 2585393246 2582581866 Bacteria 6859583
230 2643772005 2643221550 Bacteria 4619371
231 2643811542 2643221558 Bacteria 5460675
232 2644050529 2643221607 Bacteria 6314006
233 2644205757 2643221636 Bacteria 6583769
234 2644483447 2643221686 Bacteria 6310811
235 2644499658 2643221689 Bacteria 6042950
236 2644530968 2643221696 Bacteria 5431823
237 2713473402 2711768613 Bacteria 11048459
238 2738890216 2738541308 Bacteria 7020677
239 2739258117 2738543015 Bacteria 6750701
240 2739603883 2739367653 Bacteria 2780952
241 2776913913 2775507049 Bacteria 6284736
242 2793280314 2791355253 Bacteria 5171699
243 2817509614 2816332305 Bacteria 2697803
244 2819594858 2818991445 Bacteria 4955017
245 2821127500 2821123053 Bacteria 7836056
246 2838738024 2838736955 Bacteria 5760694
247 2840879869 2840878972 Bacteria 5483153
248 2841841607 2841840854 Bacteria 5761912
249 2842141385 2842140634 Bacteria 5759631
250 2844851526 2844849076 Bacteria 4091819
251 2855732264 2855730933 Bacteria 7047938
252 2855768972 2855767633 Bacteria 7049357
253 2857536487 2857531043 Bacteria 6754041
254 2857729462 2857727296 Bacteria 2745552
255 2866614382 2866612099 Bacteria 7543886
256 2891091905 2891088606 Bacteria 4762464
257 2893685034 2893684298 Bacteria 2897960
258 2899366061 2899359706 Bacteria 10940472
259 2908670483 2908669403 Bacteria 5740494
260 2920883585 2920879853 Bacteria 4216831
261 2945968954 2945968032 Bacteria 4111363
262 2946083357 2946080515 Bacteria 4310960
263 3000021228 3000017691 Bacteria 3772574
264 3007515556 3007511990 Bacteria 6481491
265 643592383 643348564 Bacteria 8839022
266 8018153216 8018150411 Bacteria 5549903
267 JGI25155J39150_1000030
268 JGI25156J39149_1000059
269 JGI25154J39366_1000056
270 JGI25157J39369_1000123
271 Ga0055532_1000059
272 Ga0055535_1004336
273 Ga0055526_1000444
274 Ga0055524_1000031
275 Ga0070677_10018354
276 Ga0070675_100066601
277 Ga0070671_100137141
278 Ga0070674_100064403
279 Ga0070673_100063684
280 Ga0070679_100036691
281 Ga0068855_100016481
282 Ga0068852_100004286
283 Ga0081455_10117463
284 Ga0075364_10004656
285 Ga0075364_10041343
286 Ga0099823_1000047
287 Ga0079104_1000193
288 Ga0105244_10077484
289 Ga0105250_10006070
290 Ga0105240_10000344
291 Ga0105237_10094953
292 Ga0105238_10029843
293 Ga0105249_10038139
294 Ga0157373_10090839
295 Ga0157369_10270228
296 Ga0163162_10025174
297 Ga0157372_10286195
298 Ga0157375_10030689
299 Ga0182008_10011185
300 Ga0182006_1004018
301 Ga0209435_100032
302 Ga0209147_100109
303 Ga0209437_100261
304 Ga0209258_100190
305 Ga0209646_1000113
306 Ga0209026_1000102
307 Ga0209759_1000104
308 Ga0209675_1002025
309 Ga0209564_1000135
310 Ga0209256_1000107
311 Ga0207426_1001323
312 Ga0207426_1001651
313 Ga0207426_1005652
314 Ga0209051_1007771
315 Ga0207697_10023531
316 Ga0207696_1002710
317 Ga0207655_1028420
318 Ga0207713_1020539
319 Ga0207680_10114962
320 Ga0207695_10001722
321 Ga0207652_10271285
322 Ga0207687_10014212
323 Ga0207669_10075572
324 Ga0207691_10023019
325 Ga0207667_10005245
326 Ga0207712_10060525
327 Ga0207675_100055793
328 Ga0207683_10021730
329 Ga0207698_10002888
330 Ga0209281_1000034
331 Ga0209389_1000116
332 Ga0307515_10030752
333 Ga0307515_10161953
334 Ga0265328_10001104
335 Ga0265327_10000004
336 Ga0307513_10015597
337 Ga0307508_10007002
338 Ga0307508_10071313
339 Ga0307514_10009902
340 Ga0307514_10016538
341 Ga0307516_10045978
342 Ga0307410_10072075
343 Ga0307406_10000703
344 Ga0307416_100023361
345 Ga0307416_100120716
346 Ga0307510_10008147
347 Ga0395900_0027855
348 Ga0395898_0015670
349 Ga0395905_0000160
350 Ga0395901_0178930
351 Ga0436362_0025731
352 Ga0436362_0805059
353 Ga0466961_0004419
354 Ga0466968_0012687
355 Ga0466959_0004689
356 Ga0466958_0003198
357 Ga0495627_000338
358 Ga0495591_000016
359 Ga0495629_0004461
360 Ga0495653_0000074
361 Ga0495650_0000950
362 Ga0495650_0012484
363 Ga0495650_0013491
364 Ga0495580_0081353
365 Ga0495582_0044831
366 Ga0495605_0000244
367 Ga0495605_0002546
368 Ga0495639_0007212
369 Ga0495585_0000469
370 Ga0495585_0000792
371 Ga0495585_0009370
372 Ga0495607_0000031
373 Ga0495607_0000448
374 Ga0495607_0012898
375 Ga0495583_0002279
376 Ga0495606_0000191
377 Ga0495631_0001821
378 Ga0495632_0001006
379 Ga0495632_0006935
380 Ga0495632_0018115
381 Ga0495637_0007230
382 Ga0495637_0013946
383 Ga0495637_0040323
384 Ga0495643_0035514
385 Ga0495642_0000842
386 Ga0495654_0002091
387 Ga0495609_0023821
388 Ga0495597_0000128
389 Ga0495597_0004805
390 Ga0495645_0016329
391 Ga0495667_0029571
392 Ga0495668_0065596
393 Ga0495625_0039607
394 Ga0495625_0047020
395 Ga0495625_0053597
396 Ga0495661_0000013
397 Ga0495588_0007749
398 Ga0495588_0027464
399 Ga0495588_0053978
400 Ga0495613_0030993
401 Ga0495670_0000794
402 Ga0495670_0001356
403 Ga0495671_0000780
404 Ga0495671_0012913
405 Ga0495671_0014162
406 Ga0495660_0000088
407 Ga0495660_0000566
408 Ga0495581_0003252
409 Ga0495636_0002823
410 Ga0495672_0001094
411 Ga0495672_0007941
412 Ga0495672_0013842
413 Ga0495676_0003012
414 Ga0495683_0000110
415 Ga0495687_000050
416 Ga0495673_0002403
417 Ga0495673_0022204
418 Ga0495681_0000081
419 Ga0495593_0089354
420 Ga0496102_0033396
421 Ga0496103_0025742
422 Ga0496104_0058040
423 Ga0496106_0000054
424 Ga0496110_0038842
425 Ga0496111_0100324
426 Ga0496114_0003723
427 Ga0496115_0031562
428 Ga0496116_0016208
429 Ga0496116_0026061
430 Ga0496116_0060647
431 Ga0496119_0012349
432 Ga0496121_0003976
433 Ga0496121_0011732
434 Ga0496121_0037235
435 Ga0496121_0061938
436 Ga0496122_0000215
437 Ga0496122_0000225
438 Ga0496123_0000192
439 Ga0496124_0086736
440 Ga0496125_0000207
441 Ga0496125_0000947
442 Ga0496125_0003130
443 Ga0495682_0000111
444 Ga0495682_0001840
445 Ga0501031_0000712
446 Ga0501032_0001162
447 Ga0501033_0000163
448 Ga0501034_0000202
449 Ga0501034_0000554
450 Ga0501036_0000021
451 Ga0501037_0001561
452 Ga0501038_0000226
453 Ga0501039_0012759
454 Ga0501043_0000297
455 Ga0501046_0000354
456 Ga0501047_0000232
457 Ga0501048_0000050
458 Ga0501067_0001956
459 Ga0501068_0000830
460 Ga0501070_0006783
461 Ga0501071_0058243
462 Ga0501072_0009910
463 Ga0501073_0000888
464 Ga0501074_0000092
465 Ga0501079_0007384
466 Ga0501083_0010061
467 Ga0501035_0000120
468 Ga0501044_0000179
469 Ga0501045_0022680
470 nmdc:mga00v17_639_c1
471 Ga0500618_001899
472 Ga0500659_0003036
473 Ga0500573_0001766
474 Ga0500577_0001217
475 Ga0501084_0051392
476 8025535008
477 2511131483
478 2511258328
479 2511316138
480 2511317849
481 2511329068
482 2511331929
483 2511337871
484 2511347620
485 2511352710
486 2511375232
487 2513590114
488 2537899173
489 2563057896
490 2585166338
491 2585267435
492 2585327163
493 2585386503
494 2585389070
495 2585393246
496 2643772005
497 2643811542
498 2644050529
499 2644205757
500 2644483447
501 2644499658
502 2644530968
503 2713473402
504 2738890216
505 2739258117
506 2739603883
507 2776913913
508 2793280314
509 2817509614
510 2819594858
511 2821127500
512 2838738024
513 2840879869
514 2841841607
515 2842141385
516 2844851526
517 2855732264
518 2855768972
519 2857536487
520 2857729462
521 2866614382
522 2891091905
523 2893685034
524 2899366061
525 2908670483
526 2920883585
527 2945968954
528 2946083357
529 3000021228
530 3007515556
531 643592383
532 8018153216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

56

273

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

274

472

0.84

PF07690

MFS_1

Major Facilitator Superfamily

62

426

0.78

PF07690

MFS_1

Major Facilitator Superfamily

289

488

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.8223 23 431
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.7839 17 431
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.7832 56 429
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.7818 21 426
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.7808 23 431
ID Description Score Start End Superfamily
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9758 25 237 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9633 24 232 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9581 25 237 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9457 24 232 1.20.1250.20
af_P76350_250_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9438 250 432 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4R6HJK8-F1-model_v4 deleted 0.9878 21 432
AF-A0A2V3Y2W3-F1-model_v4 deleted 0.9839 21 234
AF-A0A1I5FJ44-F1-model_v4 Metabolite-proton symporter 0.9838 20 430 GO:0005886
GO:0022857
AF-A0A4S3PJV7-F1-model_v4 MFS transporter 0.9831 21 431 GO:0005886
GO:0022857
AF-A0A328X9G5-F1-model_v4 deleted 0.9822 17 430

Map