F374486

General Info

Members Datasets Scaffolds Average Seq Length
267 214 264 134

Family's Representative Sequence

Representative Sequence 3300003759|Ga0055525_1000038|Ga0055525_1000038146
Length 136
Sequence MTNKQILQPPGWAAPKGYANGIAARGTQVFVAGQIGWNARSEFESDDLVDQVRQALTNVKAVLAAAGAEPRHIVRMTWYLLDKREYVMRGREIGMAYREVLGREFGIAMSAVQVVGLVEDRAKVEIEVTAVVDTED

Samples

Sample ID Description Type Environment
1 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
2 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
3 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
178 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
198 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 0
Rhizoplane 1.5
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004922 3300003215 Bacteria 7098
2 Ga0055525_1000038 3300003759 Bacteria 297540
3 Ga0070658_11584100 3300005327 Bacteria 568
4 Ga0070676_10515327 3300005328 Bacteria 851
5 Ga0070690_100033093 3300005330 Bacteria 3233
6 Ga0070690_100931904 3300005330 Bacteria 681
7 Ga0068869_100939152 3300005334 Bacteria 750
8 Ga0068868_100172883 3300005338 Bacteria 1789
9 Ga0070689_100091024 3300005340 Bacteria 2404
10 Ga0070687_100154621 3300005343 Bacteria 1350
11 Ga0070668_100850474 3300005347 Bacteria 813
12 Ga0070669_100021002 3300005353 Bacteria 4665
13 Ga0070671_100011175 3300005355 Bacteria 7210
14 Ga0070671_101182001 3300005355 Bacteria 673
15 Ga0070673_101022201 3300005364 Bacteria 770
16 Ga0070688_100259327 3300005365 Bacteria 1241
17 Ga0070688_100269153 3300005365 Bacteria 1220
18 Ga0070688_100625265 3300005365 Bacteria 827
19 Ga0070667_100006270 3300005367 Bacteria 9886
20 Ga0070667_100587101 3300005367 Bacteria 1026
21 Ga0070710_10027930 3300005437 Bacteria 3014
22 Ga0070694_101335443 3300005444 Bacteria 604
23 Ga0070681_11610543 3300005458 Bacteria 575
24 Ga0068867_100798165 3300005459 Bacteria 841
25 Ga0070685_10675258 3300005466 Bacteria 751
26 Ga0070706_101089411 3300005467 Bacteria 735
27 Ga0070706_101292942 3300005467 Bacteria 669
28 Ga0070698_100048340 3300005471 Bacteria 4346
29 Ga0070698_100497547 3300005471 Bacteria 1157
30 Ga0070699_100099205 3300005518 Bacteria 2552
31 Ga0070699_100359309 3300005518 Bacteria 1313
32 Ga0070699_100864684 3300005518 Bacteria 828
33 Ga0070699_100908062 3300005518 Bacteria 807
34 Ga0070684_100753424 3300005535 Bacteria 909
35 Ga0070697_100237852 3300005536 Bacteria 1555
36 Ga0070686_100513181 3300005544 Bacteria 932
37 Ga0070695_101479296 3300005545 Bacteria 565
38 Ga0070696_100100731 3300005546 Bacteria 2070
39 Ga0070696_101072285 3300005546 Bacteria 676
40 Ga0070665_100822080 3300005548 Bacteria 942
41 Ga0068857_101022090 3300005577 Bacteria 796
42 Ga0068854_101593660 3300005578 Bacteria 595
43 Ga0068854_102130212 3300005578 Bacteria 518
44 Ga0068861_100422798 3300005719 Bacteria 1188
45 Ga0068861_100599576 3300005719 Bacteria 1011
46 Ga0068851_10431288 3300005834 Bacteria 780
47 Ga0068860_101437750 3300005843 Bacteria 711
48 Ga0068862_100010005 3300005844 Bacteria 7835
49 Ga0081540_1000040 3300005983 Bacteria 136968
50 Ga0075365_10004553 3300006038 Bacteria 7365
51 Ga0075363_100007871 3300006048 Bacteria 4932
52 Ga0075364_10000914 3300006051 Bacteria 15591
53 Ga0070716_100660510 3300006173 Bacteria 794
54 Ga0075362_10226449 3300006177 Bacteria 915
55 Ga0075367_10011009 3300006178 Bacteria 4770
56 Ga0075367_10015575 3300006178 Bacteria 4138
57 Ga0097621_100392389 3300006237 Bacteria 1241
58 Ga0068871_100002872 3300006358 Bacteria 11810
59 Ga0075428_100306614 3300006844 Bacteria 1707
60 Ga0075430_100676357 3300006846 Bacteria 851
61 Ga0075433_10159428 3300006852 Bacteria 2008
62 Ga0075433_11120669 3300006852 Bacteria 684
63 Ga0075434_100010010 3300006871 Bacteria 8875
64 Ga0075434_100509292 3300006871 Bacteria 1224
65 Ga0075434_100858979 3300006871 Bacteria 923
66 Ga0075429_101000063 3300006880 Bacteria 731
67 Ga0068865_100002842 3300006881 Bacteria 10313
68 Ga0075436_100030535 3300006914 Bacteria 3709
69 Ga0097620_101381634 3300006931 Bacteria 777
70 Ga0105245_11761583 3300009098 Bacteria 672
71 Ga0114129_10019848 3300009147 Bacteria 9565
72 Ga0114129_10027101 3300009147 Bacteria 8113
73 Ga0114129_10032311 3300009147 Bacteria 7397
74 Ga0114129_10111182 3300009147 Bacteria 3781
75 Ga0105241_12488619 3300009174 Bacteria 518
76 Ga0105242_10012513 3300009176 Bacteria 6532
77 Ga0105242_12052130 3300009176 Bacteria 615
78 Ga0105242_12444797 3300009176 Bacteria 570
79 Ga0105248_10019014 3300009177 Bacteria 7597
80 Ga0105248_11845000 3300009177 Bacteria 686
81 Ga0163162_10077980 3300013306 Bacteria 3378
82 Ga0157375_11574270 3300013308 Bacteria 777
83 Ga0163163_10124202 3300014325 Bacteria 2617
84 Ga0157380_10862047 3300014326 Unclassified 928
85 Ga0157379_10055016 3300014968 Bacteria 3556
86 Ga0157376_10035153 3300014969 Bacteria 4052
87 Ga0157376_11124684 3300014969 Bacteria 812
88 Ga0213872_10000183 3300021361 Bacteria 56352
89 Ga0213874_10036260 3300021377 Bacteria 1453
90 Ga0213875_10410472 3300021388 Bacteria 646
91 Ga0209563_100005 3300025230 Bacteria 1774893
92 Ga0209758_1000193 3300025297 Bacteria 134744
93 Ga0207688_10284783 3300025901 Bacteria 1007
94 Ga0207680_10041660 3300025903 Bacteria 2681
95 Ga0207680_10896359 3300025903 Unclassified 636
96 Ga0207684_11084878 3300025910 Bacteria 667
97 Ga0207707_11433420 3300025912 Bacteria 550
98 Ga0207662_10040337 3300025918 Bacteria 2744
99 Ga0207681_10356645 3300025923 Bacteria 1172
100 Ga0207650_10098252 3300025925 Bacteria 2249
101 Ga0207687_10074998 3300025927 Bacteria 2426
102 Ga0207687_11144800 3300025927 Bacteria 668
103 Ga0207644_10077762 3300025931 Bacteria 2444
104 Ga0207686_10048988 3300025934 Bacteria 2620
105 Ga0207670_10048582 3300025936 Bacteria 2833
106 Ga0207670_10474030 3300025936 Bacteria 1013
107 Ga0207704_10032920 3300025938 Bacteria 2941
108 Ga0207704_11126230 3300025938 Bacteria 667
109 Ga0207665_10599625 3300025939 Bacteria 860
110 Ga0207691_10066011 3300025940 Bacteria 3274
111 Ga0207711_10390658 3300025941 Bacteria 1292
112 Ga0207689_10833947 3300025942 Bacteria 778
113 Ga0207679_10496410 3300025945 Bacteria 1088
114 Ga0207651_10753147 3300025960 Bacteria 861
115 Ga0207651_11683124 3300025960 Unclassified 571
116 Ga0207668_10043135 3300025972 Bacteria 3059
117 Ga0207640_11517355 3300025981 Bacteria 602
118 Ga0207658_10678289 3300025986 Bacteria 930
119 Ga0207708_10203554 3300026075 Bacteria 1580
120 Ga0207648_10103151 3300026089 Bacteria 2501
121 Ga0207676_11692621 3300026095 Bacteria 631
122 Ga0207674_11486262 3300026116 Bacteria 647
123 Ga0207675_100326202 3300026118 Bacteria 1500
124 Ga0207683_10657536 3300026121 Bacteria 971
125 Ga0209813_10009505 3300027866 Bacteria 2489
126 Ga0209813_10011972 3300027866 Bacteria 2280
127 Ga0207428_10172550 3300027907 Bacteria 1637
128 Ga0207428_10488920 3300027907 Bacteria 895
129 Ga0268266_10171169 3300028379 Bacteria 1971
130 Ga0268266_11808951 3300028379 Bacteria 585
131 Ga0268265_10026128 3300028380 Bacteria 4151
132 Ga0268265_11102504 3300028380 Bacteria 788
133 Ga0268264_10136490 3300028381 Bacteria 2181
134 Ga0265326_10149772 3300028558 Bacteria 666
135 Ga0307515_10000525 3300028794 Bacteria 91297
136 Ga0265328_10043928 3300031239 Bacteria 1644
137 Ga0265320_10031920 3300031240 Bacteria 2702
138 Ga0265331_10002642 3300031250 Bacteria 12012
139 Ga0265327_10000028 3300031251 Bacteria 361066
140 Ga0307408_100243149 3300031548 Bacteria 1480
141 Ga0307408_101537875 3300031548 Bacteria 630
142 Ga0307405_10189020 3300031731 Bacteria 1486
143 Ga0307405_10948504 3300031731 Bacteria 731
144 Ga0307413_10467360 3300031824 Bacteria 1005
145 Ga0307410_10047398 3300031852 Bacteria 2872
146 Ga0307406_10350070 3300031901 Bacteria 1154
147 Ga0307406_10788079 3300031901 Bacteria 801
148 Ga0307416_100349770 3300032002 Bacteria 1495
149 Ga0307416_100497811 3300032002 Bacteria 1282
150 Ga0307415_100941482 3300032126 Bacteria 799
151 Ga0373926_0023976 3300035083 Bacteria 2122
152 Ga0373934_0084471 3300035086 Bacteria 1277
153 Ga0373952_0094991 3300035092 Bacteria 779
154 Ga0373936_0009841 3300035113 Bacteria 3609
155 Ga0373939_0083058 3300035114 Bacteria 1068
156 Ga0373941_0026506 3300035115 Bacteria 1684
157 Ga0373956_0103993 3300035119 Bacteria 1319
158 Ga0373943_0027606 3300035170 Bacteria 2668
159 Ga0373946_0278312 3300035171 Bacteria 822
160 Ga0373955_0045662 3300035172 Bacteria 2365
161 Ga0373942_0045404 3300035207 Bacteria 1214
162 Ga0373962_0031063 3300035242 Bacteria 1464
163 Ga0373935_0028848 3300035692 Bacteria 3430
164 Ga0373927_0375425 3300035695 Bacteria 937
165 Ga0373927_0722625 3300035695 Bacteria 658
166 Ga0373947_0213132 3300035725 Bacteria 1267
167 Ga0373937_0013814 3300036401 Bacteria 7115
168 Ga0373925_0020931 3300037068 Bacteria 4766
169 Ga0395898_0003564 3300037466 Bacteria 17354
170 Ga0436364_0370365 3300037853 Bacteria 1566
171 Ga0436364_0690950 3300037853 Bacteria 707
172 Ga0436360_0454481 3300039438 Bacteria 1797
173 Ga0436361_0324913 3300039447 Bacteria 5533
174 Ga0436361_0446152 3300039447 Bacteria 899
175 Ga0436363_1718678 3300039450 Bacteria 1066
176 Ga0439435_0004528 3300042436 Bacteria 3002
177 Ga0466966_0037065 3300044684 Bacteria 3146
178 Ga0466966_0145148 3300044684 Bacteria 1449
179 Ga0466961_0867985 3300044693 Bacteria 538
180 Ga0466963_0124270 3300044694 Bacteria 1778
181 Ga0466964_0767490 3300044706 Bacteria 542
182 Ga0466957_0406026 3300044842 Bacteria 932
183 Ga0466959_0052285 3300045049 Bacteria 2993
184 Ga0495651_0153863 3300046462 Bacteria 1654
185 Ga0495653_0034859 3300046463 Bacteria 3975
186 Ga0495580_0026414 3300046472 Bacteria 4233
187 Ga0495580_0167388 3300046472 Bacteria 1520
188 Ga0495582_0052595 3300046473 Bacteria 2245
189 Ga0495639_0036725 3300046475 Bacteria 2195
190 Ga0495662_0025026 3300046476 Bacteria 2882
191 Ga0495584_0022640 3300046491 Bacteria 3187
192 Ga0495594_0049243 3300046499 Bacteria 2316
193 Ga0495630_0043140 3300046517 Bacteria 3369
194 Ga0495666_0024710 3300046526 Bacteria 2968
195 Ga0495640_0259809 3300046533 Bacteria 1085
196 Ga0495586_0050966 3300046535 Bacteria 2240
197 Ga0495667_0058804 3300046559 Bacteria 2524
198 Ga0495668_0102806 3300046616 Bacteria 1563
199 Ga0495634_0337047 3300046642 Bacteria 905
200 Ga0495635_0029301 3300046663 Bacteria 3826
201 Ga0495635_0308909 3300046663 Bacteria 1060
202 Ga0495647_0028663 3300046681 Bacteria 2054
203 Ga0495658_0110747 3300046683 Bacteria 1650
204 Ga0495669_0195451 3300046684 Bacteria 966
205 Ga0495624_0220572 3300046690 Bacteria 1150
206 Ga0495581_0000957 3300047315 Bacteria 15517
207 Ga0495680_0044321 3300047322 Bacteria 3518
208 Ga0495684_0012536 3300047471 Bacteria 6534
209 Ga0495593_0082713 3300047673 Bacteria 1659
210 Ga0495614_0010133 3300048089 Bacteria 4160
211 Ga0496102_0562765 3300048905 Bacteria 1063
212 Ga0496109_0714498 3300048912 Bacteria 940
213 Ga0496110_0131892 3300048913 Bacteria 2257
214 Ga0496114_0235174 3300048917 Bacteria 1610
215 Ga0501292_073963 3300049515 Bacteria 638
216 Ga0501298_042468 3300049521 Bacteria 925
217 Ga0501300_039003 3300049523 Bacteria 713
218 Ga0501301_004714 3300049524 Bacteria 977
219 Ga0501031_0041032 3300049568 Bacteria 3022
220 Ga0501033_0492929 3300049570 Unclassified 848
221 Ga0501039_0045205 3300049575 Bacteria 3402
222 Ga0501039_0068059 3300049575 Bacteria 2765
223 Ga0501041_0131911 3300049577 Bacteria 1556
224 Ga0501042_0027429 3300049578 Bacteria 4005
225 Ga0501042_0328235 3300049578 Bacteria 1106
226 Ga0501046_0331321 3300049580 Unclassified 1108
227 Ga0501069_0551478 3300049585 Bacteria 690
228 Ga0501071_0625729 3300049587 Unclassified 828
229 Ga0501072_0090569 3300049588 Bacteria 2428
230 Ga0501073_0147960 3300049589 Bacteria 1628
231 Ga0501074_0200620 3300049590 Bacteria 1422
232 Ga0501075_0042448 3300049591 Bacteria 3410
233 Ga0501076_0020224 3300049592 Bacteria 5094
234 Ga0501076_0070490 3300049592 Bacteria 2795
235 Ga0501257_099966 3300049686 Bacteria 761
236 Ga0501079_0393276 3300049741 Bacteria 1087
237 Ga0501080_0811127 3300049742 Unclassified 820
238 Ga0501081_0649104 3300049743 Unclassified 791
239 Ga0501083_0002755 3300049744 Bacteria 12142
240 Ga0501265_000482 3300049762 Bacteria 4212
241 Ga0501281_02720 3300049777 Bacteria 1279
242 Ga0501045_0031172 3300049824 Bacteria 3861
243 nmdc:mga03n38_4048_c1 3300050490 Bacteria 4799
244 nmdc:mga00v17_182855_c1 3300050491 Bacteria 1353
245 nmdc:mga0yw44_12219_c1 3300050492 Bacteria 4467
246 nmdc:mga06z11_2481_c1 3300050494 Bacteria 7056
247 nmdc:mga06z11_325693_c1 3300050494 Bacteria 917
248 nmdc:mga06z11_4760_c1 3300050494 Bacteria 5368
249 nmdc:mga04h51_1298_c1 3300050495 Bacteria 5768
250 nmdc:mga04h51_41675_c1 3300050495 Bacteria 1502
251 nmdc:mga07m45_41646_c3 3300050496 Bacteria 1163
252 nmdc:mga05p37_164808_c1 3300050507 Bacteria 2705
253 nmdc:mga05p37_241653_c1 3300050507 Bacteria 2171
254 nmdc:mga05p37_446789_c1 3300050507 Bacteria 1498
255 nmdc:mga05p37_90485_c1 3300050507 Bacteria 3771
256 nmdc:mga09592_928558_c1 3300050508 Bacteria 730
257 nmdc:mga0n895_25224_c1 3300050512 Bacteria 5615
258 nmdc:mga0n895_379345_c1 3300050512 Bacteria 1431
259 nmdc:mga0rr50_754195_c1 3300050513 Bacteria 831
260 nmdc:mga0a205_180079_c1 3300050515 Bacteria 2008
261 Ga0495619_0016619 3300053085 Bacteria 4658
262 Ga0501084_0212745 3300054114 Bacteria 1631
263 Ga0501082_0463780 3300060353 Unclassified 1107
264 Ga0530510_0108020 3300061734 Bacteria 2037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221592 2643968088 127
2 iso_pu_bacteria 2643221625 2644142556 127
3 iso_pu_bacteria 2643221648 2644276945 127
4 3300005458 Ga0070681_11610543 Ga0070681_116105431 129
5 3300021361 Ga0213872_10000183 Ga0213872_100001838 129
6 3300025912 Ga0207707_11433420 Ga0207707_114334201 129
7 3300025945 Ga0207679_10496410 Ga0207679_104964102 129
8 3300028794 Ga0307515_10000525 Ga0307515_1000052589 129
9 3300037466 Ga0395898_0003564 Ga0395898_0003564_2454_2855 129
10 3300039447 Ga0436361_0324913 Ga0436361_0324913_1955_2353 129
11 3300044684 Ga0466966_0145148 Ga0466966_0145148_134_535 129
12 3300044693 Ga0466961_0867985 Ga0466961_0867985_60_461 129
13 3300005444 Ga0070694_101335443 Ga0070694_1013354431 130
14 3300005545 Ga0070695_101479296 Ga0070695_1014792961 130
15 3300005577 Ga0068857_101022090 Ga0068857_1010220902 130
16 3300005578 Ga0068854_101593660 Ga0068854_1015936601 130
17 3300006173 Ga0070716_100660510 Ga0070716_1006605102 130
18 3300006880 Ga0075429_101000063 Ga0075429_1010000632 130
19 3300013308 Ga0157375_11574270 Ga0157375_115742701 130
20 3300021377 Ga0213874_10036260 Ga0213874_100362602 130
21 3300021388 Ga0213875_10410472 Ga0213875_104104722 130
22 3300025939 Ga0207665_10599625 Ga0207665_105996252 130
23 3300028558 Ga0265326_10149772 Ga0265326_101497722 130
24 3300031239 Ga0265328_10043928 Ga0265328_100439282 130
25 3300031240 Ga0265320_10031920 Ga0265320_100319203 130
26 3300031250 Ga0265331_10002642 Ga0265331_100026423 130
27 3300031251 Ga0265327_10000028 Ga0265327_1000002859 130
28 3300031548 Ga0307408_100243149 Ga0307408_1002431492 130
29 3300031731 Ga0307405_10189020 Ga0307405_101890202 130
30 3300031824 Ga0307413_10467360 Ga0307413_104673602 130
31 3300031852 Ga0307410_10047398 Ga0307410_100473982 130
32 3300031901 Ga0307406_10350070 Ga0307406_103500702 130
33 3300032002 Ga0307416_100349770 Ga0307416_1003497702 130
34 3300032126 Ga0307415_100941482 Ga0307415_1009414822 130
35 3300037853 Ga0436364_0370365 Ga0436364_0370365_239_634 130
36 3300037853 Ga0436364_0690950 Ga0436364_0690950_134_529 130
37 3300039438 Ga0436360_0454481 Ga0436360_0454481_843_1238 130
38 3300039447 Ga0436361_0446152 Ga0436361_0446152_113_517 130
39 3300039450 Ga0436363_1718678 Ga0436363_1718678_219_614 130
40 3300042436 Ga0439435_0004528 Ga0439435_0004528_2117_2524 130
41 3300044684 Ga0466966_0037065 Ga0466966_0037065_2337_2732 130
42 3300044694 Ga0466963_0124270 Ga0466963_0124270_678_1073 130
43 3300044706 Ga0466964_0767490 Ga0466964_0767490_96_491 130
44 3300044842 Ga0466957_0406026 Ga0466957_0406026_310_705 130
45 3300045049 Ga0466959_0052285 Ga0466959_0052285_1835_2230 130
46 3300049568 Ga0501031_0041032 Ga0501031_0041032_508_915 130
47 3300049570 Ga0501033_0492929 Ga0501033_0492929_270_677 130
48 3300049575 Ga0501039_0045205 Ga0501039_0045205_2034_2441 130
49 3300049575 Ga0501039_0068059 Ga0501039_0068059_83_490 130
50 3300049577 Ga0501041_0131911 Ga0501041_0131911_127_534 130
51 3300049578 Ga0501042_0027429 Ga0501042_0027429_133_540 130
52 3300049580 Ga0501046_0331321 Ga0501046_0331321_504_911 130
53 3300049587 Ga0501071_0625729 Ga0501071_0625729_362_769 130
54 3300049588 Ga0501072_0090569 Ga0501072_0090569_1565_1972 130
55 3300049589 Ga0501073_0147960 Ga0501073_0147960_1121_1528 130
56 3300049590 Ga0501074_0200620 Ga0501074_0200620_287_694 130
57 3300049591 Ga0501075_0042448 Ga0501075_0042448_1948_2355 130
58 3300049592 Ga0501076_0020224 Ga0501076_0020224_2724_3131 130
59 3300049741 Ga0501079_0393276 Ga0501079_0393276_479_886 130
60 3300049742 Ga0501080_0811127 Ga0501080_0811127_377_784 130
61 3300049743 Ga0501081_0649104 Ga0501081_0649104_275_682 130
62 3300049744 Ga0501083_0002755 Ga0501083_0002755_55_462 130
63 3300049824 Ga0501045_0031172 Ga0501045_0031172_2834_3241 130
64 3300054114 Ga0501084_0212745 Ga0501084_0212745_662_1069 130
65 3300060353 Ga0501082_0463780 Ga0501082_0463780_155_562 130
66 3300061734 Ga0530510_0108020 Ga0530510_0108020_126_533 130
67 3300003215 JGI25153J46596_10004922 JGI25153J46596_100049224 131
68 3300003759 Ga0055525_1000038 Ga0055525_1000038146 131
69 3300005327 Ga0070658_11584100 Ga0070658_115841001 131
70 3300005328 Ga0070676_10515327 Ga0070676_105153272 131
71 3300005330 Ga0070690_100033093 Ga0070690_1000330931 131
72 3300005330 Ga0070690_100931904 Ga0070690_1009319042 131
73 3300005334 Ga0068869_100939152 Ga0068869_1009391521 131
74 3300005338 Ga0068868_100172883 Ga0068868_1001728832 131
75 3300005340 Ga0070689_100091024 Ga0070689_1000910242 131
76 3300005343 Ga0070687_100154621 Ga0070687_1001546212 131
77 3300005347 Ga0070668_100850474 Ga0070668_1008504742 131
78 3300005353 Ga0070669_100021002 Ga0070669_1000210024 131
79 3300005355 Ga0070671_100011175 Ga0070671_1000111752 131
80 3300005355 Ga0070671_101182001 Ga0070671_1011820011 131
81 3300005364 Ga0070673_101022201 Ga0070673_1010222012 131
82 3300005365 Ga0070688_100259327 Ga0070688_1002593272 131
83 3300005365 Ga0070688_100269153 Ga0070688_1002691532 131
84 3300005365 Ga0070688_100625265 Ga0070688_1006252651 131
85 3300005367 Ga0070667_100006270 Ga0070667_1000062702 131
86 3300005367 Ga0070667_100587101 Ga0070667_1005871012 131
87 3300005437 Ga0070710_10027930 Ga0070710_100279302 131
88 3300005459 Ga0068867_100798165 Ga0068867_1007981652 131
89 3300005466 Ga0070685_10675258 Ga0070685_106752581 131
90 3300005467 Ga0070706_101089411 Ga0070706_1010894112 131
91 3300005467 Ga0070706_101292942 Ga0070706_1012929421 131
92 3300005471 Ga0070698_100048340 Ga0070698_1000483403 131
93 3300005471 Ga0070698_100497547 Ga0070698_1004975472 131
94 3300005518 Ga0070699_100099205 Ga0070699_1000992052 131
95 3300005518 Ga0070699_100359309 Ga0070699_1003593092 131
96 3300005518 Ga0070699_100864684 Ga0070699_1008646842 131
97 3300005518 Ga0070699_100908062 Ga0070699_1009080621 131
98 3300005535 Ga0070684_100753424 Ga0070684_1007534242 131
99 3300005536 Ga0070697_100237852 Ga0070697_1002378522 131
100 3300005544 Ga0070686_100513181 Ga0070686_1005131812 131
101 3300005546 Ga0070696_100100731 Ga0070696_1001007312 131
102 3300005546 Ga0070696_101072285 Ga0070696_1010722852 131
103 3300005548 Ga0070665_100822080 Ga0070665_1008220802 131
104 3300005578 Ga0068854_102130212 Ga0068854_1021302121 131
105 3300005719 Ga0068861_100422798 Ga0068861_1004227982 131
106 3300005719 Ga0068861_100599576 Ga0068861_1005995762 131
107 3300005834 Ga0068851_10431288 Ga0068851_104312882 131
108 3300005843 Ga0068860_101437750 Ga0068860_1014377502 131
109 3300005844 Ga0068862_100010005 Ga0068862_1000100055 131
110 3300005983 Ga0081540_1000040 Ga0081540_100004062 131
111 3300006038 Ga0075365_10004553 Ga0075365_100045532 131
112 3300006048 Ga0075363_100007871 Ga0075363_1000078715 131
113 3300006051 Ga0075364_10000914 Ga0075364_100009147 131
114 3300006177 Ga0075362_10226449 Ga0075362_102264492 131
115 3300006178 Ga0075367_10011009 Ga0075367_100110095 131
116 3300006178 Ga0075367_10015575 Ga0075367_100155752 131
117 3300006237 Ga0097621_100392389 Ga0097621_1003923892 131
118 3300006358 Ga0068871_100002872 Ga0068871_1000028726 131
119 3300006844 Ga0075428_100306614 Ga0075428_1003066142 131
120 3300006846 Ga0075430_100676357 Ga0075430_1006763572 131
121 3300006852 Ga0075433_10159428 Ga0075433_101594283 131
122 3300006852 Ga0075433_11120669 Ga0075433_111206691 131
123 3300006871 Ga0075434_100010010 Ga0075434_1000100101 131
124 3300006871 Ga0075434_100509292 Ga0075434_1005092921 131
125 3300006871 Ga0075434_100858979 Ga0075434_1008589792 131
126 3300006881 Ga0068865_100002842 Ga0068865_1000028427 131
127 3300006914 Ga0075436_100030535 Ga0075436_1000305353 131
128 3300006931 Ga0097620_101381634 Ga0097620_1013816342 131
129 3300009098 Ga0105245_11761583 Ga0105245_117615832 131
130 3300009147 Ga0114129_10019848 Ga0114129_100198487 131
131 3300009147 Ga0114129_10027101 Ga0114129_100271014 131
132 3300009147 Ga0114129_10032311 Ga0114129_100323111 131
133 3300009147 Ga0114129_10111182 Ga0114129_101111822 131
134 3300009174 Ga0105241_12488619 Ga0105241_124886192 131
135 3300009176 Ga0105242_10012513 Ga0105242_100125134 131
136 3300009176 Ga0105242_12052130 Ga0105242_120521301 131
137 3300009176 Ga0105242_12444797 Ga0105242_124447971 131
138 3300009177 Ga0105248_10019014 Ga0105248_100190148 131
139 3300009177 Ga0105248_11845000 Ga0105248_118450002 131
140 3300013306 Ga0163162_10077980 Ga0163162_100779803 131
141 3300014325 Ga0163163_10124202 Ga0163163_101242024 131
142 3300014326 Ga0157380_10862047 Ga0157380_108620471 131
143 3300014968 Ga0157379_10055016 Ga0157379_100550162 131
144 3300014969 Ga0157376_10035153 Ga0157376_100351534 131
145 3300014969 Ga0157376_11124684 Ga0157376_111246842 131
146 3300025230 Ga0209563_100005 Ga0209563_1000051125 131
147 3300025297 Ga0209758_1000193 Ga0209758_100019326 131
148 3300025901 Ga0207688_10284783 Ga0207688_102847832 131
149 3300025903 Ga0207680_10041660 Ga0207680_100416602 131
150 3300025903 Ga0207680_10896359 Ga0207680_108963591 131
151 3300025910 Ga0207684_11084878 Ga0207684_110848782 131
152 3300025918 Ga0207662_10040337 Ga0207662_100403373 131
153 3300025923 Ga0207681_10356645 Ga0207681_103566452 131
154 3300025925 Ga0207650_10098252 Ga0207650_100982521 131
155 3300025927 Ga0207687_10074998 Ga0207687_100749982 131
156 3300025927 Ga0207687_11144800 Ga0207687_111448001 131
157 3300025931 Ga0207644_10077762 Ga0207644_100777622 131
158 3300025934 Ga0207686_10048988 Ga0207686_100489883 131
159 3300025936 Ga0207670_10048582 Ga0207670_100485822 131
160 3300025936 Ga0207670_10474030 Ga0207670_104740302 131
161 3300025938 Ga0207704_10032920 Ga0207704_100329202 131
162 3300025938 Ga0207704_11126230 Ga0207704_111262301 131
163 3300025940 Ga0207691_10066011 Ga0207691_100660113 131
164 3300025941 Ga0207711_10390658 Ga0207711_103906582 131
165 3300025942 Ga0207689_10833947 Ga0207689_108339471 131
166 3300025960 Ga0207651_10753147 Ga0207651_107531472 131
167 3300025960 Ga0207651_11683124 Ga0207651_116831241 131
168 3300025972 Ga0207668_10043135 Ga0207668_100431351 131
169 3300025981 Ga0207640_11517355 Ga0207640_115173551 131
170 3300025986 Ga0207658_10678289 Ga0207658_106782891 131
171 3300026075 Ga0207708_10203554 Ga0207708_102035542 131
172 3300026089 Ga0207648_10103151 Ga0207648_101031514 131
173 3300026095 Ga0207676_11692621 Ga0207676_116926212 131
174 3300026116 Ga0207674_11486262 Ga0207674_114862621 131
175 3300026118 Ga0207675_100326202 Ga0207675_1003262022 131
176 3300026121 Ga0207683_10657536 Ga0207683_106575361 131
177 3300027866 Ga0209813_10009505 Ga0209813_100095052 131
178 3300027866 Ga0209813_10011972 Ga0209813_100119722 131
179 3300027907 Ga0207428_10172550 Ga0207428_101725502 131
180 3300027907 Ga0207428_10488920 Ga0207428_104889202 131
181 3300028379 Ga0268266_10171169 Ga0268266_101711693 131
182 3300028379 Ga0268266_11808951 Ga0268266_118089512 131
183 3300028380 Ga0268265_10026128 Ga0268265_100261282 131
184 3300028380 Ga0268265_11102504 Ga0268265_111025042 131
185 3300028381 Ga0268264_10136490 Ga0268264_101364901 131
186 3300031548 Ga0307408_101537875 Ga0307408_1015378751 131
187 3300031731 Ga0307405_10948504 Ga0307405_109485042 131
188 3300031901 Ga0307406_10788079 Ga0307406_107880792 131
189 3300032002 Ga0307416_100497811 Ga0307416_1004978111 131
190 3300035083 Ga0373926_0023976 Ga0373926_0023976_491_889 131
191 3300035086 Ga0373934_0084471 Ga0373934_0084471_230_628 131
192 3300035092 Ga0373952_0094991 Ga0373952_0094991_235_642 131
193 3300035113 Ga0373936_0009841 Ga0373936_0009841_650_1048 131
194 3300035114 Ga0373939_0083058 Ga0373939_0083058_620_1027 131
195 3300035115 Ga0373941_0026506 Ga0373941_0026506_665_1072 131
196 3300035119 Ga0373956_0103993 Ga0373956_0103993_266_664 131
197 3300035170 Ga0373943_0027606 Ga0373943_0027606_1175_1573 131
198 3300035171 Ga0373946_0278312 Ga0373946_0278312_60_458 131
199 3300035172 Ga0373955_0045662 Ga0373955_0045662_985_1383 131
200 3300035207 Ga0373942_0045404 Ga0373942_0045404_750_1151 131
201 3300035242 Ga0373962_0031063 Ga0373962_0031063_69_476 131
202 3300035692 Ga0373935_0028848 Ga0373935_0028848_889_1287 131
203 3300035695 Ga0373927_0375425 Ga0373927_0375425_38_436 131
204 3300035695 Ga0373927_0722625 Ga0373927_0722625_53_463 131
205 3300035725 Ga0373947_0213132 Ga0373947_0213132_149_547 131
206 3300036401 Ga0373937_0013814 Ga0373937_0013814_1126_1524 131
207 3300037068 Ga0373925_0020931 Ga0373925_0020931_1324_1722 131
208 3300046462 Ga0495651_0153863 Ga0495651_0153863_883_1281 131
209 3300046463 Ga0495653_0034859 Ga0495653_0034859_639_1037 131
210 3300046472 Ga0495580_0026414 Ga0495580_0026414_2125_2523 131
211 3300046472 Ga0495580_0167388 Ga0495580_0167388_851_1249 131
212 3300046473 Ga0495582_0052595 Ga0495582_0052595_616_1014 131
213 3300046475 Ga0495639_0036725 Ga0495639_0036725_1213_1611 131
214 3300046476 Ga0495662_0025026 Ga0495662_0025026_140_538 131
215 3300046491 Ga0495584_0022640 Ga0495584_0022640_2727_3125 131
216 3300046499 Ga0495594_0049243 Ga0495594_0049243_721_1119 131
217 3300046517 Ga0495630_0043140 Ga0495630_0043140_615_1013 131
218 3300046526 Ga0495666_0024710 Ga0495666_0024710_1811_2209 131
219 3300046533 Ga0495640_0259809 Ga0495640_0259809_341_739 131
220 3300046535 Ga0495586_0050966 Ga0495586_0050966_1741_2139 131
221 3300046559 Ga0495667_0058804 Ga0495667_0058804_1969_2367 131
222 3300046616 Ga0495668_0102806 Ga0495668_0102806_320_742 131
223 3300046642 Ga0495634_0337047 Ga0495634_0337047_471_869 131
224 3300046663 Ga0495635_0029301 Ga0495635_0029301_28_426 131
225 3300046663 Ga0495635_0308909 Ga0495635_0308909_578_988 131
226 3300046681 Ga0495647_0028663 Ga0495647_0028663_1618_2016 131
227 3300046683 Ga0495658_0110747 Ga0495658_0110747_589_987 131
228 3300046684 Ga0495669_0195451 Ga0495669_0195451_485_886 131
229 3300046690 Ga0495624_0220572 Ga0495624_0220572_38_436 131
230 3300047315 Ga0495581_0000957 Ga0495581_0000957_2382_2780 131
231 3300047322 Ga0495680_0044321 Ga0495680_0044321_38_436 131
232 3300047471 Ga0495684_0012536 Ga0495684_0012536_2238_2636 131
233 3300047673 Ga0495593_0082713 Ga0495593_0082713_1017_1415 131
234 3300048089 Ga0495614_0010133 Ga0495614_0010133_1078_1476 131
235 3300048905 Ga0496102_0562765 Ga0496102_0562765_64_471 131
236 3300048912 Ga0496109_0714498 Ga0496109_0714498_373_780 131
237 3300048913 Ga0496110_0131892 Ga0496110_0131892_1240_1641 131
238 3300048917 Ga0496114_0235174 Ga0496114_0235174_1181_1579 131
239 3300049515 Ga0501292_073963 Ga0501292_073963_88_486 131
240 3300049521 Ga0501298_042468 Ga0501298_042468_427_825 131
241 3300049523 Ga0501300_039003 Ga0501300_039003_267_665 131
242 3300049524 Ga0501301_004714 Ga0501301_004714_457_855 131
243 3300049578 Ga0501042_0328235 Ga0501042_0328235_670_1089 131
244 3300049585 Ga0501069_0551478 Ga0501069_0551478_211_618 131
245 3300049592 Ga0501076_0070490 Ga0501076_0070490_1824_2243 131
246 3300049686 Ga0501257_099966 Ga0501257_099966_314_712 131
247 3300049762 Ga0501265_000482 Ga0501265_000482_917_1315 131
248 3300049777 Ga0501281_02720 Ga0501281_02720_56_454 131
249 3300050490 nmdc:mga03n38_4048_c1 nmdc:mga03n38_4048_c1_3901_4323 131
250 3300050491 nmdc:mga00v17_182855_c1 nmdc:mga00v17_182855_c1_192_614 131
251 3300050492 nmdc:mga0yw44_12219_c1 nmdc:mga0yw44_12219_c1_846_1268 131
252 3300050494 nmdc:mga06z11_2481_c1 nmdc:mga06z11_2481_c1_5256_5678 131
253 3300050494 nmdc:mga06z11_325693_c1 nmdc:mga06z11_325693_c1_281_700 131
254 3300050494 nmdc:mga06z11_4760_c1 nmdc:mga06z11_4760_c1_2045_2443 131
255 3300050495 nmdc:mga04h51_1298_c1 nmdc:mga04h51_1298_c1_363_761 131
256 3300050495 nmdc:mga04h51_41675_c1 nmdc:mga04h51_41675_c1_44_466 131
257 3300050496 nmdc:mga07m45_41646_c3 nmdc:mga07m45_41646_c3_171_593 131
258 3300050507 nmdc:mga05p37_164808_c1 nmdc:mga05p37_164808_c1_289_684 131
259 3300050507 nmdc:mga05p37_241653_c1 nmdc:mga05p37_241653_c1_1667_2098 131
260 3300050507 nmdc:mga05p37_446789_c1 nmdc:mga05p37_446789_c1_698_1096 131
261 3300050507 nmdc:mga05p37_90485_c1 nmdc:mga05p37_90485_c1_2513_2923 131
262 3300050508 nmdc:mga09592_928558_c1 nmdc:mga09592_928558_c1_271_669 131
263 3300050512 nmdc:mga0n895_25224_c1 nmdc:mga0n895_25224_c1_174_599 131
264 3300050512 nmdc:mga0n895_379345_c1 nmdc:mga0n895_379345_c1_741_1142 131
265 3300050513 nmdc:mga0rr50_754195_c1 nmdc:mga0rr50_754195_c1_63_488 131
266 3300050515 nmdc:mga0a205_180079_c1 nmdc:mga0a205_180079_c1_1286_1687 131
267 3300053085 Ga0495619_0016619 Ga0495619_0016619_2688_3086 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

11

132

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.8549 15 129
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8506 16 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8433 16 128
2b33-assembly1.cif.gz_A crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution 0.8384 15 130
6tcd-assembly2.cif.gz_E crystal structure of salmo salar rida-2 0.8366 15 130
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8441 16 128 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8386 15 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8369 16 128 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8358 15 128 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8242 14 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7W5RBE7-F1-model_v4 deleted 0.9939 2 130
AF-A0A431JUH4-F1-model_v4 RidA family protein 0.9919 2 129
AF-G6YFA9-F1-model_v4 Endoribonuclease L-PSP 0.9907 2 130
AF-A0A527W0G0-F1-model_v4 RidA family protein 0.9897 23 130 GO:0005829
GO:0019239
AF-A0A4R9VQN0-F1-model_v4 RidA family protein 0.9896 2 130

Feature Viewer

pLDDT pTM Quality
95.63 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map