F374753

General Info

Members Datasets Scaffolds Average Seq Length
267 196 534 93

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10069448|Ga0105246_100694483
Length 109
Sequence MPALISPQTNSQGEMHMVYLQITLRITDANRAAAAGVYQKYKAPFLDTIKGAKSKELLVRDEDVQVLHGFDSQENATAYLQSDLFTADVVAGLKPLLDAAPDVRVYQVA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
98 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
173 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
183 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
184 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
185 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
186 2643221672 Variovorax sp. Root434 Isolate Unclassified
187 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
188 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
189 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
190 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
191 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
192 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
193 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
194 2928163908 Burkholderia sp. 567 Isolate Unclassified
195 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
196 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 0
Isolates 5.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.98
Nodule 1.5
Rhizoplane 6.74
Rhizosphere 63.3
Stem 0
Stem Tuber 0
Unclassified 7.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10069448 3300011119 Bacteria 2474
2 2214953260 2209111006 Bacteria 536
3 JGI24736J21556_1035272 3300001904 Bacteria 772
4 JGI24740J21852_10071105 3300001979 Bacteria 932
5 JGI24739J22299_10028223 3300001989 Bacteria 1958
6 JGI24735J21928_10034126 3300002067 Bacteria 1501
7 JGI25159J45721_1002749 3300002987 Bacteria 6520
8 rootH1_10072073 3300003323 Bacteria 9846
9 JGI25160J50197_1003912 3300003354 Bacteria 6520
10 JGI25161J50226_1001117 3300003374 Bacteria 9013
11 Ga0055533_1000532 3300003756 Bacteria 13629
12 Ga0055526_1001902 3300003771 Bacteria 14469
13 Ga0055526_1007658 3300003771 Bacteria 5566
14 Ga0055537_1000139 3300003773 Bacteria 54248
15 Ga0055537_1002834 3300003773 Bacteria 5566
16 Ga0055524_1005622 3300003775 Bacteria 5566
17 Ga0055524_1048333 3300003775 Bacteria 993
18 Ga0055536_1001442 3300003781 Bacteria 14354
19 Ga0055534_1000942 3300003784 Bacteria 12974
20 Ga0055534_1002890 3300003784 Bacteria 5699
21 Ga0055528_1000703 3300003790 Bacteria 23724
22 Ga0055530_10001743 3300003791 Bacteria 15241
23 Ga0055530_10002965 3300003791 Bacteria 10219
24 Ga0055540_1000395 3300003792 Bacteria 35841
25 Ga0055531_10000392 3300003794 Bacteria 42357
26 Ga0055531_10001502 3300003794 Bacteria 17132
27 Ga0055543_1001838 3300004625 Bacteria 7763
28 Ga0065165_1005600 3300005262 Bacteria 6962
29 Ga0065704_10070608 3300005289 Bacteria 19206
30 Ga0065707_10127469 3300005295 Bacteria 1983
31 Ga0065707_10343753 3300005295 Unclassified 929
32 Ga0070658_10383658 3300005327 Bacteria 1206
33 Ga0068868_102077275 3300005338 Bacteria 540
34 Ga0070689_100000001 3300005340 Bacteria 1334580
35 Ga0070661_100839777 3300005344 Bacteria 755
36 Ga0070671_100308705 3300005355 Bacteria 1347
37 Ga0070673_100128468 3300005364 Bacteria 2123
38 Ga0070667_100666801 3300005367 Bacteria 961
39 Ga0070667_101373188 3300005367 Bacteria 662
40 Ga0070678_100944064 3300005456 Bacteria 790
41 Ga0070706_101049881 3300005467 Bacteria 751
42 Ga0070684_100533884 3300005535 Bacteria 1088
43 Ga0070672_100603036 3300005543 Bacteria 956
44 Ga0070664_101104098 3300005564 Bacteria 747
45 Ga0068857_101170373 3300005577 Bacteria 744
46 Ga0068854_101687461 3300005578 Bacteria 579
47 Ga0068852_100242599 3300005616 Bacteria 1723
48 Ga0068859_100078898 3300005617 Bacteria 3333
49 Ga0068859_100616257 3300005617 Bacteria 1178
50 Ga0068864_100402959 3300005618 Unclassified 1300
51 Ga0068863_100053469 3300005841 Bacteria 3828
52 Ga0068858_101542079 3300005842 Bacteria 655
53 Ga0068858_102344925 3300005842 Bacteria 527
54 Ga0068860_100373472 3300005843 Bacteria 1407
55 Ga0068871_100231918 3300006358 Bacteria 1602
56 Ga0075430_100240256 3300006846 Bacteria 1501
57 Ga0075431_100379578 3300006847 Bacteria 1418
58 Ga0097620_100078895 3300006931 Bacteria 3333
59 Ga0097620_100616195 3300006931 Bacteria 1178
60 Ga0079104_1084371 3300006946 Bacteria 650
61 Ga0105250_10038460 3300009092 Bacteria 1919
62 Ga0105240_12372552 3300009093 Bacteria 549
63 Ga0105241_10811253 3300009174 Bacteria 863
64 Ga0105248_10014059 3300009177 Bacteria 8809
65 Ga0105248_10262034 3300009177 Bacteria 1946
66 Ga0105248_12284842 3300009177 Bacteria 616
67 Ga0105237_10028476 3300009545 Bacteria 5690
68 Ga0105238_10116965 3300009551 Bacteria 2646
69 Ga0105249_11048092 3300009553 Bacteria 885
70 Ga0105239_10008860 3300010375 Bacteria 11389
71 Ga0157373_10241579 3300013100 Bacteria 1277
72 Ga0157369_10262236 3300013105 Bacteria 1802
73 Ga0157369_11633900 3300013105 Bacteria 655
74 Ga0157369_11865476 3300013105 Bacteria 610
75 Ga0157372_10194920 3300013307 Bacteria 2347
76 Ga0157372_10415967 3300013307 Bacteria 1567
77 Ga0157376_10833271 3300014969 Bacteria 937
78 Ga0182006_1027023 3300015261 Bacteria 2346
79 Ga0182006_1031419 3300015261 Bacteria 2140
80 Ga0182006_1033033 3300015261 Bacteria 2075
81 Ga0182005_1002607 3300015265 Bacteria 6372
82 Ga0209436_101581 3300025208 Bacteria 7680
83 Ga0209674_100062 3300025226 Bacteria 276316
84 Ga0207427_106352 3300025231 Bacteria 1508
85 Ga0209565_1000055 3300025263 Bacteria 201184
86 Ga0209565_1000716 3300025263 Bacteria 20121
87 Ga0209565_1000789 3300025263 Bacteria 18339
88 Ga0209673_1000040 3300025273 Bacteria 312633
89 Ga0209673_1069281 3300025273 Bacteria 847
90 Ga0209130_1001630 3300025284 Bacteria 13816
91 Ga0209675_1000052 3300025291 Bacteria 201332
92 Ga0209675_1004969 3300025291 Bacteria 5727
93 Ga0209676_1001283 3300025292 Bacteria 25966
94 Ga0209564_1000121 3300025295 Bacteria 204081
95 Ga0209564_1001843 3300025295 Bacteria 19371
96 Ga0209050_1000261 3300025298 Bacteria 112823
97 Ga0209050_1000704 3300025298 Bacteria 49577
98 Ga0209050_1001038 3300025298 Bacteria 34415
99 Ga0209256_1000100 3300025299 Bacteria 201246
100 Ga0209256_1000754 3300025299 Bacteria 42096
101 Ga0207426_1003828 3300025302 Bacteria 7777
102 Ga0207426_1037905 3300025302 Bacteria 1521
103 Ga0209051_1000186 3300025303 Bacteria 109900
104 Ga0209051_1035612 3300025303 Bacteria 1849
105 Ga0209257_1000293 3300025304 Bacteria 110422
106 Ga0209257_1000663 3300025304 Bacteria 54142
107 Ga0209257_1148333 3300025304 Bacteria 519
108 Ga0207696_1006501 3300025711 Bacteria 4704
109 Ga0207696_1055439 3300025711 Bacteria 1124
110 Ga0207647_10005994 3300025904 Bacteria 8854
111 Ga0207654_11380068 3300025911 Bacteria 514
112 Ga0207694_10096907 3300025924 Bacteria 2333
113 Ga0207644_10329039 3300025931 Bacteria 1237
114 Ga0207670_10000036 3300025936 Bacteria 106829
115 Ga0207691_10919815 3300025940 Bacteria 732
116 Ga0207711_10004166 3300025941 Bacteria 12380
117 Ga0207711_10256471 3300025941 Bacteria 1607
118 Ga0207711_10582553 3300025941 Bacteria 1044
119 Ga0207689_10434768 3300025942 Bacteria 1096
120 Ga0207651_10690939 3300025960 Bacteria 898
121 Ga0207668_11865776 3300025972 Bacteria 542
122 Ga0207658_10048034 3300025986 Bacteria 3127
123 Ga0207677_10222144 3300026023 Unclassified 1516
124 Ga0207703_11636854 3300026035 Bacteria 619
125 Ga0207641_10262922 3300026088 Bacteria 1616
126 Ga0207676_11562575 3300026095 Bacteria 657
127 Ga0207674_10177660 3300026116 Bacteria 2081
128 Ga0207683_11779977 3300026121 Bacteria 565
129 Ga0207698_10158264 3300026142 Bacteria 1977
130 Ga0209281_1000984 3300027111 Bacteria 22723
131 Ga0209281_1027368 3300027111 Bacteria 1045
132 Ga0210000_1015286 3300027462 Bacteria 1155
133 Ga0209995_1078281 3300027471 Bacteria 567
134 Ga0209968_1015135 3300027526 Bacteria 1219
135 Ga0268264_10085956 3300028381 Bacteria 2701
136 Ga0307408_100004805 3300031548 Bacteria 9102
137 Ga0307408_101911462 3300031548 Bacteria 569
138 Ga0307405_11013471 3300031731 Unclassified 709
139 Ga0307410_11267611 3300031852 Bacteria 644
140 Ga0307407_10915311 3300031903 Bacteria 674
141 Ga0307409_101446554 3300031995 Bacteria 714
142 Ga0307416_100077302 3300032002 Bacteria 2795
143 Ga0307411_10529906 3300032005 Bacteria 1001
144 Ga0373941_0216816 3300035115 Bacteria 734
145 Ga0373961_0439330 3300035241 Bacteria 507
146 Ga0395900_0002827 3300037418 Bacteria 18949
147 Ga0395898_0001286 3300037466 Bacteria 36883
148 Ga0395905_0993250 3300037471 Bacteria 742
149 Ga0395901_0000129 3300038443 Bacteria 97842
150 Ga0237819_03604 3300038705 Bacteria 2710
151 Ga0436361_0314390 3300039447 Bacteria 1684
152 Ga0439438_160263 3300041405 Unclassified 536
153 Ga0439453_0155053 3300041408 Bacteria 546
154 Ga0451791_1466832 3300041451 Bacteria 697
155 Ga0439441_153577 3300042001 Unclassified 543
156 Ga0439451_002161 3300042009 Bacteria 3952
157 Ga0450906_077020 3300042145 Bacteria 600
158 Ga0439435_0304375 3300042436 Bacteria 547
159 Ga0450893_0024821 3300042532 Bacteria 1048
160 Ga0466972_0000018 3300044658 Bacteria 199161
161 Ga0466972_0311985 3300044658 Bacteria 735
162 Ga0466965_0484883 3300044683 Bacteria 692
163 Ga0466966_0073281 3300044684 Bacteria 2142
164 Ga0466963_0106785 3300044694 Bacteria 1920
165 Ga0495674_0018835 3300047319 Bacteria 6420
166 Ga0495676_0816146 3300047321 Bacteria 600
167 Ga0496100_0030267 3300048903 Bacteria 3357
168 Ga0496100_0035508 3300048903 Bacteria 3136
169 Ga0496100_0390713 3300048903 Bacteria 1058
170 Ga0496101_0176541 3300048904 Bacteria 1643
171 Ga0496101_0333670 3300048904 Bacteria 1190
172 Ga0496104_0053751 3300048907 Bacteria 3806
173 Ga0496105_0340104 3300048908 Bacteria 1200
174 Ga0496105_0380378 3300048908 Bacteria 1123
175 Ga0496106_0272247 3300048909 Bacteria 1356
176 Ga0496111_0306288 3300048914 Bacteria 1178
177 Ga0496112_0094651 3300048915 Bacteria 2958
178 Ga0496112_0244517 3300048915 Bacteria 1746
179 Ga0496112_0683782 3300048915 Bacteria 954
180 Ga0496113_0107970 3300048916 Bacteria 2163
181 Ga0496114_0063854 3300048917 Bacteria 3083
182 Ga0496115_0000170 3300048918 Bacteria 60309
183 Ga0496116_0116644 3300048919 Bacteria 1555
184 Ga0496116_0257781 3300048919 Bacteria 862
185 Ga0496117_0000010 3300048920 Bacteria 611954
186 Ga0496117_0005876 3300048920 Bacteria 12687
187 Ga0496118_0000009 3300048921 Bacteria 611954
188 Ga0496118_0070316 3300048921 Bacteria 2527
189 Ga0496119_0182714 3300048922 Bacteria 1098
190 Ga0496121_0001572 3300048924 Bacteria 38031
191 Ga0496121_0008846 3300048924 Bacteria 11727
192 Ga0496122_0132796 3300048925 Bacteria 1577
193 Ga0496123_0158022 3300048926 Bacteria 1212
194 Ga0496124_0048289 3300048927 Bacteria 3638
195 Ga0496124_0064316 3300048927 Bacteria 3063
196 Ga0496124_0124082 3300048927 Bacteria 2060
197 Ga0496124_0531114 3300048927 Bacteria 781
198 Ga0496125_0068477 3300048928 Bacteria 2792
199 Ga0501031_0276693 3300049568 Bacteria 1089
200 Ga0501031_0902897 3300049568 Unclassified 565
201 Ga0501033_0899764 3300049570 Bacteria 595
202 Ga0501036_0056567 3300049572 Bacteria 3323
203 Ga0501038_0044373 3300049574 Bacteria 3863
204 Ga0501039_0320051 3300049575 Unclassified 1219
205 Ga0501039_0847635 3300049575 Unclassified 712
206 Ga0501040_0090428 3300049576 Bacteria 2127
207 Ga0501040_0286967 3300049576 Bacteria 1176
208 Ga0501041_0149768 3300049577 Bacteria 1456
209 Ga0501041_1031799 3300049577 Unclassified 529
210 Ga0501042_0076731 3300049578 Unclassified 2392
211 Ga0501043_0086896 3300049579 Unclassified 2457
212 Ga0501043_0883426 3300049579 Bacteria 642
213 Ga0501046_0164264 3300049580 Bacteria 1668
214 Ga0501068_0429572 3300049584 Unclassified 853
215 Ga0501071_0185885 3300049587 Bacteria 1557
216 Ga0501072_0104838 3300049588 Bacteria 2248
217 Ga0501072_0306026 3300049588 Bacteria 1263
218 Ga0501073_0083558 3300049589 Bacteria 2222
219 Ga0501074_0059597 3300049590 Unclassified 2750
220 Ga0501075_0013129 3300049591 Bacteria 5906
221 Ga0501075_0025067 3300049591 Bacteria 4380
222 Ga0501076_0008972 3300049592 Bacteria 7359
223 Ga0501076_0630590 3300049592 Bacteria 884
224 Ga0501243_115298 3300049675 Bacteria 553
225 Ga0501079_0095435 3300049741 Bacteria 2304
226 Ga0501079_0192516 3300049741 Bacteria 1592
227 Ga0501079_0818219 3300049741 Unclassified 733
228 Ga0501080_0150479 3300049742 Bacteria 2151
229 Ga0501080_0957497 3300049742 Bacteria 744
230 Ga0501081_0007605 3300049743 Bacteria 7025
231 Ga0501081_0064793 3300049743 Bacteria 2539
232 Ga0501081_0450723 3300049743 Bacteria 956
233 Ga0501081_0713404 3300049743 Bacteria 753
234 Ga0501083_0022767 3300049744 Bacteria 4348
235 Ga0501263_072845 3300049760 Bacteria 557
236 Ga0501280_088890 3300049776 Bacteria 579
237 Ga0501035_0794269 3300049822 Unclassified 756
238 nmdc:mga00v17_1010657_c1 3300050491 Bacteria 523
239 nmdc:mga0qj67_229932_c1 3300050509 Bacteria 1505
240 nmdc:mga06r32_291909_c1 3300050510 Unclassified 1617
241 nmdc:mga06r32_35584_c1 3300050510 Bacteria 4698
242 Ga0501084_0067847 3300054114 Unclassified 2986
243 Ga0501084_0323939 3300054114 Bacteria 1301
244 Ga0501082_0013255 3300060353 Bacteria 7089
245 Ga0501082_0900124 3300060353 Bacteria 774
246 Ga0501082_1477569 3300060353 Unclassified 593
247 Ga0466962_0113476 3300061719 Bacteria 1305
248 Ga0530510_0016618 3300061734 Bacteria 5211
249 Ga0530510_0054345 3300061734 Bacteria 2893
250 Ga0530510_0161781 3300061734 Bacteria 1656
251 Ga0530510_0623287 3300061734 Unclassified 821
252 2501084648 2501025502 Bacteria 9641094
253 2511092488 2510917013 Bacteria 9951648
254 2516022569 2515154189 Bacteria 9629850
255 2599905067 2599185292 Bacteria 6290804
256 2644400986 2643221672 Bacteria 6322190
257 2753571852 2751185846 Bacteria 7242164
258 2765589303 2765235842 Bacteria 4799256
259 2792840310 2791355137 Bacteria 9654227
260 2838060576 2838054893 Bacteria 7451788
261 2858698614 2858688981 Bacteria 8184122
262 2904620357 2904615490 Bacteria 10047340
263 2904622027 2904615490 Bacteria 10047340
264 2928162386 2928157003 Bacteria 7522202
265 2928166158 2928163908 Bacteria 7561269
266 2939611085 2939607340 Bacteria 4719256
267 2981996507 2981990288 Bacteria 7590678
268 Ga0105246_10069448
269 2214953260
270 JGI24736J21556_1035272
271 JGI24740J21852_10071105
272 JGI24739J22299_10028223
273 JGI24735J21928_10034126
274 JGI25159J45721_1002749
275 rootH1_10072073
276 JGI25160J50197_1003912
277 JGI25161J50226_1001117
278 Ga0055533_1000532
279 Ga0055526_1001902
280 Ga0055526_1007658
281 Ga0055537_1000139
282 Ga0055537_1002834
283 Ga0055524_1005622
284 Ga0055524_1048333
285 Ga0055536_1001442
286 Ga0055534_1000942
287 Ga0055534_1002890
288 Ga0055528_1000703
289 Ga0055530_10001743
290 Ga0055530_10002965
291 Ga0055540_1000395
292 Ga0055531_10000392
293 Ga0055531_10001502
294 Ga0055543_1001838
295 Ga0065165_1005600
296 Ga0065704_10070608
297 Ga0065707_10127469
298 Ga0065707_10343753
299 Ga0070658_10383658
300 Ga0068868_102077275
301 Ga0070689_100000001
302 Ga0070661_100839777
303 Ga0070671_100308705
304 Ga0070673_100128468
305 Ga0070667_100666801
306 Ga0070667_101373188
307 Ga0070678_100944064
308 Ga0070706_101049881
309 Ga0070684_100533884
310 Ga0070672_100603036
311 Ga0070664_101104098
312 Ga0068857_101170373
313 Ga0068854_101687461
314 Ga0068852_100242599
315 Ga0068859_100078898
316 Ga0068859_100616257
317 Ga0068864_100402959
318 Ga0068863_100053469
319 Ga0068858_101542079
320 Ga0068858_102344925
321 Ga0068860_100373472
322 Ga0068871_100231918
323 Ga0075430_100240256
324 Ga0075431_100379578
325 Ga0097620_100078895
326 Ga0097620_100616195
327 Ga0079104_1084371
328 Ga0105250_10038460
329 Ga0105240_12372552
330 Ga0105241_10811253
331 Ga0105248_10014059
332 Ga0105248_10262034
333 Ga0105248_12284842
334 Ga0105237_10028476
335 Ga0105238_10116965
336 Ga0105249_11048092
337 Ga0105239_10008860
338 Ga0157373_10241579
339 Ga0157369_10262236
340 Ga0157369_11633900
341 Ga0157369_11865476
342 Ga0157372_10194920
343 Ga0157372_10415967
344 Ga0157376_10833271
345 Ga0182006_1027023
346 Ga0182006_1031419
347 Ga0182006_1033033
348 Ga0182005_1002607
349 Ga0209436_101581
350 Ga0209674_100062
351 Ga0207427_106352
352 Ga0209565_1000055
353 Ga0209565_1000716
354 Ga0209565_1000789
355 Ga0209673_1000040
356 Ga0209673_1069281
357 Ga0209130_1001630
358 Ga0209675_1000052
359 Ga0209675_1004969
360 Ga0209676_1001283
361 Ga0209564_1000121
362 Ga0209564_1001843
363 Ga0209050_1000261
364 Ga0209050_1000704
365 Ga0209050_1001038
366 Ga0209256_1000100
367 Ga0209256_1000754
368 Ga0207426_1003828
369 Ga0207426_1037905
370 Ga0209051_1000186
371 Ga0209051_1035612
372 Ga0209257_1000293
373 Ga0209257_1000663
374 Ga0209257_1148333
375 Ga0207696_1006501
376 Ga0207696_1055439
377 Ga0207647_10005994
378 Ga0207654_11380068
379 Ga0207694_10096907
380 Ga0207644_10329039
381 Ga0207670_10000036
382 Ga0207691_10919815
383 Ga0207711_10004166
384 Ga0207711_10256471
385 Ga0207711_10582553
386 Ga0207689_10434768
387 Ga0207651_10690939
388 Ga0207668_11865776
389 Ga0207658_10048034
390 Ga0207677_10222144
391 Ga0207703_11636854
392 Ga0207641_10262922
393 Ga0207676_11562575
394 Ga0207674_10177660
395 Ga0207683_11779977
396 Ga0207698_10158264
397 Ga0209281_1000984
398 Ga0209281_1027368
399 Ga0210000_1015286
400 Ga0209995_1078281
401 Ga0209968_1015135
402 Ga0268264_10085956
403 Ga0307408_100004805
404 Ga0307408_101911462
405 Ga0307405_11013471
406 Ga0307410_11267611
407 Ga0307407_10915311
408 Ga0307409_101446554
409 Ga0307416_100077302
410 Ga0307411_10529906
411 Ga0373941_0216816
412 Ga0373961_0439330
413 Ga0395900_0002827
414 Ga0395898_0001286
415 Ga0395905_0993250
416 Ga0395901_0000129
417 Ga0237819_03604
418 Ga0436361_0314390
419 Ga0439438_160263
420 Ga0439453_0155053
421 Ga0451791_1466832
422 Ga0439441_153577
423 Ga0439451_002161
424 Ga0450906_077020
425 Ga0439435_0304375
426 Ga0450893_0024821
427 Ga0466972_0000018
428 Ga0466972_0311985
429 Ga0466965_0484883
430 Ga0466966_0073281
431 Ga0466963_0106785
432 Ga0495674_0018835
433 Ga0495676_0816146
434 Ga0496100_0030267
435 Ga0496100_0035508
436 Ga0496100_0390713
437 Ga0496101_0176541
438 Ga0496101_0333670
439 Ga0496104_0053751
440 Ga0496105_0340104
441 Ga0496105_0380378
442 Ga0496106_0272247
443 Ga0496111_0306288
444 Ga0496112_0094651
445 Ga0496112_0244517
446 Ga0496112_0683782
447 Ga0496113_0107970
448 Ga0496114_0063854
449 Ga0496115_0000170
450 Ga0496116_0116644
451 Ga0496116_0257781
452 Ga0496117_0000010
453 Ga0496117_0005876
454 Ga0496118_0000009
455 Ga0496118_0070316
456 Ga0496119_0182714
457 Ga0496121_0001572
458 Ga0496121_0008846
459 Ga0496122_0132796
460 Ga0496123_0158022
461 Ga0496124_0048289
462 Ga0496124_0064316
463 Ga0496124_0124082
464 Ga0496124_0531114
465 Ga0496125_0068477
466 Ga0501031_0276693
467 Ga0501031_0902897
468 Ga0501033_0899764
469 Ga0501036_0056567
470 Ga0501038_0044373
471 Ga0501039_0320051
472 Ga0501039_0847635
473 Ga0501040_0090428
474 Ga0501040_0286967
475 Ga0501041_0149768
476 Ga0501041_1031799
477 Ga0501042_0076731
478 Ga0501043_0086896
479 Ga0501043_0883426
480 Ga0501046_0164264
481 Ga0501068_0429572
482 Ga0501071_0185885
483 Ga0501072_0104838
484 Ga0501072_0306026
485 Ga0501073_0083558
486 Ga0501074_0059597
487 Ga0501075_0013129
488 Ga0501075_0025067
489 Ga0501076_0008972
490 Ga0501076_0630590
491 Ga0501243_115298
492 Ga0501079_0095435
493 Ga0501079_0192516
494 Ga0501079_0818219
495 Ga0501080_0150479
496 Ga0501080_0957497
497 Ga0501081_0007605
498 Ga0501081_0064793
499 Ga0501081_0450723
500 Ga0501081_0713404
501 Ga0501083_0022767
502 Ga0501263_072845
503 Ga0501280_088890
504 Ga0501035_0794269
505 nmdc:mga00v17_1010657_c1
506 nmdc:mga0qj67_229932_c1
507 nmdc:mga06r32_291909_c1
508 nmdc:mga06r32_35584_c1
509 Ga0501084_0067847
510 Ga0501084_0323939
511 Ga0501082_0013255
512 Ga0501082_0900124
513 Ga0501082_1477569
514 Ga0466962_0113476
515 Ga0530510_0016618
516 Ga0530510_0054345
517 Ga0530510_0161781
518 Ga0530510_0623287
519 2501084648
520 2511092488
521 2516022569
522 2599905067
523 2644400986
524 2753571852
525 2765589303
526 2792840310
527 2838060576
528 2858698614
529 2904620357
530 2904622027
531 2928162386
532 2928166158
533 2939611085
534 2981996507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.8742 2 94
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.8573 2 94
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.8514 2 94
8ecp-assembly1.cif.gz_B r16a pa0709 with bme modifications 0.8473 3 94
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8449 2 93
ID Description Score Start End Superfamily
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8739 6 66 3.10.450.240
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8533 1 94 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8452 1 94 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8448 1 94 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8382 2 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2S9H0B0-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.004 2 94
AF-A0A5F2E4P0-F1-model_v4 deleted 1.002 2 94
AF-A0A402XGU4-F1-model_v4 DUF1330 domain-containing protein 1 3 94
AF-A0A363NWX4-F1-model_v4 ABM domain-containing protein 0.9991 3 94
AF-A0A2D6APH1-F1-model_v4 DUF1330 domain-containing protein 0.9985 2 94

Map