F374840

General Info

Members Datasets Scaffolds Average Seq Length
267 177 534 249

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10000376|Ga0207677_1000037610
Length 268
Sequence MTRKAATTSPPAPLPSPAMSEGMRYERVGAAAVLTIDRPERRNAVDRAAAEGFRAGLREFEADDGARVLILTGAGGAAFCAGADLKAMDLEVDHPDGPMGPTRLTPSKPAIAAVDGWCLAGGVELALWCDLRIATPQSTFGLFERRWGVPLVDGGTQRLPRIVGMGRALELILLGRPVGAEEAHRIGLVNELVEPGKHLDRALELAERIASFPQETMLADRQAAIEGFGLPLKDGIALEHELGRQTLHVALEGAQRFSSGEGRHGEGV

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 13.11
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10000376 3300026023 Bacteria 30827
2 JGI24746J21847_1000405 3300001977 Bacteria 6405
3 Ga0070683_100095010 3300005329 Bacteria 2802
4 Ga0070683_100315910 3300005329 Bacteria 1486
5 Ga0070677_10000048 3300005333 Bacteria 37331
6 Ga0070682_100000029 3300005337 Bacteria 183516
7 Ga0068868_100000451 3300005338 Bacteria 27446
8 Ga0068868_100002935 3300005338 Bacteria 11829
9 Ga0070691_10028085 3300005341 Bacteria 2627
10 Ga0070668_100065734 3300005347 Bacteria 2813
11 Ga0070671_100504379 3300005355 Bacteria 1041
12 Ga0070674_100000033 3300005356 Bacteria 63982
13 Ga0070674_100010008 3300005356 Bacteria 5709
14 Ga0070674_100510603 3300005356 Bacteria 1002
15 Ga0070673_100032178 3300005364 Bacteria 3945
16 Ga0070688_100295989 3300005365 Bacteria 1168
17 Ga0070659_100033215 3300005366 Bacteria 4006
18 Ga0070659_100117967 3300005366 Bacteria 2146
19 Ga0070713_100415897 3300005436 Bacteria 1258
20 Ga0070710_10077192 3300005437 Bacteria 1935
21 Ga0070711_100008682 3300005439 Bacteria 6232
22 Ga0070700_100003681 3300005441 Bacteria 7925
23 Ga0070663_100017122 3300005455 Bacteria 4723
24 Ga0070678_100018900 3300005456 Bacteria 4477
25 Ga0070662_100000008 3300005457 Bacteria 168754
26 Ga0070662_100379388 3300005457 Bacteria 1163
27 Ga0070681_10003882 3300005458 Bacteria 14072
28 Ga0068867_100000179 3300005459 Bacteria 41694
29 Ga0070679_100000823 3300005530 Bacteria 26958
30 Ga0070684_100047241 3300005535 Bacteria 3730
31 Ga0068853_100001640 3300005539 Bacteria 16358
32 Ga0070672_100254761 3300005543 Bacteria 1479
33 Ga0070693_100000793 3300005547 Bacteria 13960
34 Ga0070665_100000120 3300005548 Bacteria 148340
35 Ga0070665_100555088 3300005548 Bacteria 1161
36 Ga0068855_100748687 3300005563 Bacteria 1042
37 Ga0070664_100015666 3300005564 Bacteria 6204
38 Ga0070664_100129393 3300005564 Bacteria 2217
39 Ga0068857_100363955 3300005577 Bacteria 1341
40 Ga0068854_100005952 3300005578 Bacteria 7726
41 Ga0068854_100361487 3300005578 Bacteria 1191
42 Ga0068856_100040534 3300005614 Bacteria 4575
43 Ga0068864_100009102 3300005618 Bacteria 8185
44 Ga0068866_10000002 3300005718 Bacteria 394090
45 Ga0068866_10041459 3300005718 Bacteria 2284
46 Ga0068863_100009454 3300005841 Bacteria 9511
47 Ga0068858_100000035 3300005842 Bacteria 140466
48 Ga0068858_100000042 3300005842 Bacteria 132482
49 Ga0068860_100005398 3300005843 Bacteria 12971
50 Ga0081455_10187878 3300005937 Bacteria 1559
51 Ga0081455_10300493 3300005937 Bacteria 1152
52 Ga0075365_10196912 3300006038 Bacteria 1411
53 Ga0070715_10000015 3300006163 Bacteria 152816
54 Ga0070716_100039172 3300006173 Bacteria 2629
55 Ga0075435_100115174 3300007076 Bacteria 2238
56 Ga0105245_10000150 3300009098 Bacteria 66121
57 Ga0105245_10000327 3300009098 Bacteria 44888
58 Ga0105245_10002476 3300009098 Bacteria 16694
59 Ga0105243_10119891 3300009148 Bacteria 2216
60 Ga0105242_10087004 3300009176 Bacteria 2623
61 Ga0105237_10610377 3300009545 Bacteria 1098
62 Ga0105238_10000240 3300009551 Bacteria 61138
63 Ga0105249_10000095 3300009553 Bacteria 121300
64 Ga0105249_10127652 3300009553 Bacteria 2424
65 Ga0105249_10195794 3300009553 Bacteria 1975
66 Ga0105239_10060695 3300010375 Bacteria 4150
67 Ga0105239_10925431 3300010375 Bacteria 1001
68 Ga0105246_10038448 3300011119 Bacteria 3217
69 Ga0157370_10008336 3300013104 Bacteria 11178
70 Ga0157369_10357250 3300013105 Bacteria 1517
71 Ga0157374_10000668 3300013296 Bacteria 30198
72 Ga0157374_10004683 3300013296 Bacteria 11486
73 Ga0157375_10000723 3300013308 Bacteria 29095
74 Ga0163163_10519208 3300014325 Unclassified 1253
75 Ga0157377_10000518 3300014745 Bacteria 16361
76 Ga0157379_10104017 3300014968 Bacteria 2548
77 Ga0163161_10000058 3300017792 Bacteria 114035
78 Ga0207682_10000168 3300025893 Bacteria 30073
79 Ga0207642_10000001 3300025899 Bacteria 714030
80 Ga0207642_10000003 3300025899 Bacteria 650651
81 Ga0207642_10079024 3300025899 Bacteria 1592
82 Ga0207688_10009044 3300025901 Bacteria 5422
83 Ga0207685_10000001 3300025905 Bacteria 604473
84 Ga0207693_10089626 3300025915 Bacteria 2411
85 Ga0207663_10018381 3300025916 Bacteria 3917
86 Ga0207652_10001431 3300025921 Bacteria 21145
87 Ga0207694_10000067 3300025924 Bacteria 128108
88 Ga0207694_10148790 3300025924 Bacteria 1886
89 Ga0207687_10000021 3300025927 Bacteria 226396
90 Ga0207687_10000099 3300025927 Bacteria 63345
91 Ga0207687_10043591 3300025927 Bacteria 3092
92 Ga0207664_10077791 3300025929 Bacteria 2689
93 Ga0207644_10062622 3300025931 Bacteria 2699
94 Ga0207690_10030092 3300025932 Bacteria 3459
95 Ga0207690_10072941 3300025932 Bacteria 2372
96 Ga0207706_10000016 3300025933 Bacteria 170697
97 Ga0207706_10018493 3300025933 Bacteria 6271
98 Ga0207686_10217284 3300025934 Bacteria 1378
99 Ga0207709_10051031 3300025935 Bacteria 2533
100 Ga0207709_10106379 3300025935 Bacteria 1866
101 Ga0207669_10000137 3300025937 Bacteria 35016
102 Ga0207669_10024582 3300025937 Bacteria 3240
103 Ga0207669_10095366 3300025937 Bacteria 1950
104 Ga0207704_10024261 3300025938 Bacteria 3285
105 Ga0207665_10050900 3300025939 Bacteria 2787
106 Ga0207691_10290712 3300025940 Bacteria 1405
107 Ga0207661_10024131 3300025944 Bacteria 4605
108 Ga0207661_10584604 3300025944 Bacteria 1024
109 Ga0207679_10040059 3300025945 Bacteria 3351
110 Ga0207679_10104879 3300025945 Bacteria 2219
111 Ga0207667_10217920 3300025949 Bacteria 1956
112 Ga0207667_10591072 3300025949 Bacteria 1120
113 Ga0207651_10020827 3300025960 Bacteria 3968
114 Ga0207712_10000003 3300025961 Bacteria 615314
115 Ga0207712_10071656 3300025961 Bacteria 2493
116 Ga0207668_10030731 3300025972 Bacteria 3532
117 Ga0207640_10004089 3300025981 Bacteria 7880
118 Ga0207703_10000060 3300026035 Bacteria 134334
119 Ga0207703_10000067 3300026035 Bacteria 125623
120 Ga0207703_10625514 3300026035 Bacteria 1020
121 Ga0207639_10001333 3300026041 Bacteria 16674
122 Ga0207678_10275051 3300026067 Bacteria 1445
123 Ga0207708_10007741 3300026075 Bacteria 7957
124 Ga0207702_10186057 3300026078 Bacteria 1915
125 Ga0207641_10003078 3300026088 Bacteria 15029
126 Ga0207648_10000228 3300026089 Bacteria 60032
127 Ga0207683_10019636 3300026121 Bacteria 5775
128 Ga0207683_10035762 3300026121 Bacteria 4320
129 Ga0268266_10000023 3300028379 Bacteria 501899
130 Ga0268265_10563723 3300028380 Bacteria 1083
131 Ga0268264_10005149 3300028381 Bacteria 11080
132 Ga0265337_1000013 3300028556 Bacteria 82926
133 Ga0265326_10000012 3300028558 Bacteria 175352
134 Ga0265322_10000003 3300028654 Bacteria 468671
135 Ga0265336_10002736 3300028666 Bacteria 7131
136 Ga0265328_10000700 3300031239 Bacteria 15518
137 Ga0265320_10000001 3300031240 Bacteria 847191
138 Ga0265329_10001196 3300031242 Bacteria 12724
139 Ga0265339_10004334 3300031249 Bacteria 9691
140 Ga0265331_10001257 3300031250 Bacteria 19008
141 Ga0265327_10000003 3300031251 Bacteria 852750
142 Ga0265314_10000044 3300031711 Bacteria 207337
143 Ga0373937_0010103 3300036401 Bacteria 8231
144 Ga0373937_0021054 3300036401 Bacteria 5851
145 Ga0373937_0644576 3300036401 Bacteria 1005
146 Ga0395898_0450440 3300037466 Bacteria 1226
147 Ga0395901_0220444 3300038443 Bacteria 1983
148 Ga0451853_0441842 3300041512 Bacteria 822
149 Ga0451853_0632861 3300041512 Bacteria 2150
150 Ga0466963_0000710 3300044694 Bacteria 16256
151 Ga0466967_0160094 3300045976 Bacteria 2112
152 Ga0466967_0715289 3300045976 Bacteria 992
153 Ga0495592_0001063 3300046454 Bacteria 19010
154 Ga0495592_0015237 3300046454 Bacteria 5837
155 Ga0495592_0031092 3300046454 Bacteria 4037
156 Ga0495592_0088599 3300046454 Bacteria 2224
157 Ga0495603_0000302 3300046455 Bacteria 26272
158 Ga0495603_0000672 3300046455 Bacteria 19385
159 Ga0495629_0317197 3300046459 Bacteria 1066
160 Ga0495641_0000187 3300046461 Bacteria 47961
161 Ga0495641_0023926 3300046461 Bacteria 3025
162 Ga0495651_0174342 3300046462 Bacteria 1528
163 Ga0495582_0000005 3300046473 Bacteria 156170
164 Ga0495662_0000022 3300046476 Bacteria 54342
165 Ga0495608_0000406 3300046511 Bacteria 30178
166 Ga0495608_0019975 3300046511 Bacteria 4607
167 Ga0495608_0062991 3300046511 Bacteria 2435
168 Ga0495620_0000344 3300046515 Bacteria 32387
169 Ga0495628_0000070 3300046516 Bacteria 80592
170 Ga0495628_0004688 3300046516 Bacteria 12060
171 Ga0495628_0031488 3300046516 Bacteria 4290
172 Ga0495628_0031670 3300046516 Bacteria 4277
173 Ga0495628_0140105 3300046516 Bacteria 1846
174 Ga0495628_0290052 3300046516 Bacteria 1213
175 Ga0495628_0293512 3300046516 Bacteria 1205
176 Ga0495628_0309290 3300046516 Bacteria 1168
177 Ga0495630_0001004 3300046517 Bacteria 19578
178 Ga0495630_0135610 3300046517 Bacteria 1870
179 Ga0495644_0000600 3300046523 Bacteria 15119
180 Ga0495652_0006039 3300046529 Bacteria 11327
181 Ga0495640_0034817 3300046533 Bacteria 3566
182 Ga0495586_0001124 3300046535 Bacteria 15053
183 Ga0495587_0101815 3300046536 Bacteria 1654
184 Ga0495598_0004671 3300046537 Bacteria 2982
185 Ga0495621_0005720 3300046539 Bacteria 3592
186 Ga0495645_0009243 3300046543 Bacteria 6890
187 Ga0495667_0000015 3300046559 Bacteria 200377
188 Ga0495634_0000592 3300046642 Bacteria 35197
189 Ga0495634_0000910 3300046642 Bacteria 28215
190 Ga0495634_0011662 3300046642 Bacteria 6393
191 Ga0495634_0097255 3300046642 Bacteria 1906
192 Ga0495635_0000009 3300046663 Bacteria 259024
193 Ga0495635_0115182 3300046663 Bacteria 1835
194 Ga0495657_0008606 3300046675 Bacteria 7787
195 Ga0495599_0187453 3300046678 Bacteria 1273
196 Ga0495647_0000037 3300046681 Bacteria 42482
197 Ga0495658_0000019 3300046683 Bacteria 91606
198 Ga0495669_0000382 3300046684 Bacteria 22273
199 Ga0495613_0000257 3300046689 Bacteria 50000
200 Ga0495613_0014270 3300046689 Bacteria 5896
201 Ga0495624_0000013 3300046690 Bacteria 115278
202 Ga0495624_0032449 3300046690 Bacteria 3386
203 Ga0495670_0057675 3300046691 Bacteria 1949
204 Ga0495649_0003377 3300046694 Bacteria 10795
205 Ga0495604_0000033 3300047317 Bacteria 134810
206 Ga0495676_0000646 3300047321 Bacteria 28924
207 Ga0495680_0000023 3300047322 Bacteria 116444
208 Ga0495680_0001062 3300047322 Bacteria 30410
209 Ga0495680_0002013 3300047322 Bacteria 21325
210 Ga0495685_007491 3300047447 Bacteria 3605
211 Ga0495593_0062769 3300047673 Bacteria 1941
212 Ga0495602_0001999 3300048088 Bacteria 20491
213 Ga0496100_0000116 3300048903 Bacteria 45781
214 Ga0496100_0007372 3300048903 Bacteria 6065
215 Ga0496101_0000003 3300048904 Bacteria 406565
216 Ga0496101_0026168 3300048904 Bacteria 4055
217 Ga0496101_0118595 3300048904 Bacteria 1999
218 Ga0496102_0024171 3300048905 Bacteria 5401
219 Ga0496104_0000003 3300048907 Bacteria 669219
220 Ga0496104_0000147 3300048907 Bacteria 65131
221 Ga0496104_0159959 3300048907 Bacteria 2160
222 Ga0496104_0381458 3300048907 Unclassified 1322
223 Ga0496105_0000008 3300048908 Bacteria 335652
224 Ga0496105_0000138 3300048908 Bacteria 48896
225 Ga0496105_0011410 3300048908 Bacteria 7019
226 Ga0496105_0014661 3300048908 Bacteria 6241
227 Ga0496106_0000013 3300048909 Bacteria 202263
228 Ga0496106_0000177 3300048909 Bacteria 45808
229 Ga0496106_0027758 3300048909 Bacteria 4216
230 Ga0496107_0000081 3300048910 Bacteria 45824
231 Ga0496107_0044209 3300048910 Bacteria 3201
232 Ga0496108_0000002 3300048911 Bacteria 700890
233 Ga0496108_0004351 3300048911 Bacteria 11388
234 Ga0496109_0000001 3300048912 Bacteria 700852
235 Ga0496109_0000237 3300048912 Bacteria 53743
236 Ga0496109_0083279 3300048912 Bacteria 2949
237 Ga0496110_0016197 3300048913 Bacteria 6218
238 Ga0496110_0020908 3300048913 Bacteria 5529
239 Ga0496110_0041459 3300048913 Bacteria 4017
240 Ga0496111_0008241 3300048914 Bacteria 6891
241 Ga0496111_0040566 3300048914 Bacteria 3339
242 Ga0496112_0065433 3300048915 Bacteria 3587
243 Ga0496112_0711770 3300048915 Bacteria 932
244 Ga0496113_0050418 3300048916 Bacteria 3103
245 Ga0496113_0221942 3300048916 Bacteria 1506
246 Ga0496114_0240246 3300048917 Bacteria 1593
247 Ga0496115_0006099 3300048918 Bacteria 8806
248 Ga0501042_0079236 3300049578 Bacteria 2353
249 Ga0501075_0000855 3300049591 Bacteria 19203
250 Ga0501075_0301056 3300049591 Bacteria 1222
251 Ga0501076_0150554 3300049592 Bacteria 1893
252 Ga0501081_0373606 3300049743 Bacteria 1053
253 nmdc:mga08y16_462699_c1 3300050511 Bacteria 1292
254 nmdc:mga0rr50_157568_c1 3300050513 Bacteria 1840
255 nmdc:mga0a205_12_c3 3300050515 Bacteria 28260
256 Ga0495601_0001565 3300053077 Bacteria 12649
257 Ga0495612_0000843 3300053078 Bacteria 12451
258 Ga0495612_0006267 3300053078 Bacteria 4900
259 Ga0495612_0062205 3300053078 Bacteria 1547
260 Ga0495595_0000109 3300053084 Bacteria 37617
261 Ga0495595_0017403 3300053084 Bacteria 3093
262 Ga0495619_0000024 3300053085 Bacteria 180821
263 Ga0495619_0000192 3300053085 Bacteria 45153
264 Ga0495619_0000980 3300053085 Bacteria 18685
265 Ga0495619_0024858 3300053085 Bacteria 3843
266 Ga0495619_0050609 3300053085 Bacteria 2743
267 Ga0500614_003324 3300053123 Bacteria 3470
268 Ga0207677_10000376
269 JGI24746J21847_1000405
270 Ga0070683_100095010
271 Ga0070683_100315910
272 Ga0070677_10000048
273 Ga0070682_100000029
274 Ga0068868_100000451
275 Ga0068868_100002935
276 Ga0070691_10028085
277 Ga0070668_100065734
278 Ga0070671_100504379
279 Ga0070674_100000033
280 Ga0070674_100010008
281 Ga0070674_100510603
282 Ga0070673_100032178
283 Ga0070688_100295989
284 Ga0070659_100033215
285 Ga0070659_100117967
286 Ga0070713_100415897
287 Ga0070710_10077192
288 Ga0070711_100008682
289 Ga0070700_100003681
290 Ga0070663_100017122
291 Ga0070678_100018900
292 Ga0070662_100000008
293 Ga0070662_100379388
294 Ga0070681_10003882
295 Ga0068867_100000179
296 Ga0070679_100000823
297 Ga0070684_100047241
298 Ga0068853_100001640
299 Ga0070672_100254761
300 Ga0070693_100000793
301 Ga0070665_100000120
302 Ga0070665_100555088
303 Ga0068855_100748687
304 Ga0070664_100015666
305 Ga0070664_100129393
306 Ga0068857_100363955
307 Ga0068854_100005952
308 Ga0068854_100361487
309 Ga0068856_100040534
310 Ga0068864_100009102
311 Ga0068866_10000002
312 Ga0068866_10041459
313 Ga0068863_100009454
314 Ga0068858_100000035
315 Ga0068858_100000042
316 Ga0068860_100005398
317 Ga0081455_10187878
318 Ga0081455_10300493
319 Ga0075365_10196912
320 Ga0070715_10000015
321 Ga0070716_100039172
322 Ga0075435_100115174
323 Ga0105245_10000150
324 Ga0105245_10000327
325 Ga0105245_10002476
326 Ga0105243_10119891
327 Ga0105242_10087004
328 Ga0105237_10610377
329 Ga0105238_10000240
330 Ga0105249_10000095
331 Ga0105249_10127652
332 Ga0105249_10195794
333 Ga0105239_10060695
334 Ga0105239_10925431
335 Ga0105246_10038448
336 Ga0157370_10008336
337 Ga0157369_10357250
338 Ga0157374_10000668
339 Ga0157374_10004683
340 Ga0157375_10000723
341 Ga0163163_10519208
342 Ga0157377_10000518
343 Ga0157379_10104017
344 Ga0163161_10000058
345 Ga0207682_10000168
346 Ga0207642_10000001
347 Ga0207642_10000003
348 Ga0207642_10079024
349 Ga0207688_10009044
350 Ga0207685_10000001
351 Ga0207693_10089626
352 Ga0207663_10018381
353 Ga0207652_10001431
354 Ga0207694_10000067
355 Ga0207694_10148790
356 Ga0207687_10000021
357 Ga0207687_10000099
358 Ga0207687_10043591
359 Ga0207664_10077791
360 Ga0207644_10062622
361 Ga0207690_10030092
362 Ga0207690_10072941
363 Ga0207706_10000016
364 Ga0207706_10018493
365 Ga0207686_10217284
366 Ga0207709_10051031
367 Ga0207709_10106379
368 Ga0207669_10000137
369 Ga0207669_10024582
370 Ga0207669_10095366
371 Ga0207704_10024261
372 Ga0207665_10050900
373 Ga0207691_10290712
374 Ga0207661_10024131
375 Ga0207661_10584604
376 Ga0207679_10040059
377 Ga0207679_10104879
378 Ga0207667_10217920
379 Ga0207667_10591072
380 Ga0207651_10020827
381 Ga0207712_10000003
382 Ga0207712_10071656
383 Ga0207668_10030731
384 Ga0207640_10004089
385 Ga0207703_10000060
386 Ga0207703_10000067
387 Ga0207703_10625514
388 Ga0207639_10001333
389 Ga0207678_10275051
390 Ga0207708_10007741
391 Ga0207702_10186057
392 Ga0207641_10003078
393 Ga0207648_10000228
394 Ga0207683_10019636
395 Ga0207683_10035762
396 Ga0268266_10000023
397 Ga0268265_10563723
398 Ga0268264_10005149
399 Ga0265337_1000013
400 Ga0265326_10000012
401 Ga0265322_10000003
402 Ga0265336_10002736
403 Ga0265328_10000700
404 Ga0265320_10000001
405 Ga0265329_10001196
406 Ga0265339_10004334
407 Ga0265331_10001257
408 Ga0265327_10000003
409 Ga0265314_10000044
410 Ga0373937_0010103
411 Ga0373937_0021054
412 Ga0373937_0644576
413 Ga0395898_0450440
414 Ga0395901_0220444
415 Ga0451853_0441842
416 Ga0451853_0632861
417 Ga0466963_0000710
418 Ga0466967_0160094
419 Ga0466967_0715289
420 Ga0495592_0001063
421 Ga0495592_0015237
422 Ga0495592_0031092
423 Ga0495592_0088599
424 Ga0495603_0000302
425 Ga0495603_0000672
426 Ga0495629_0317197
427 Ga0495641_0000187
428 Ga0495641_0023926
429 Ga0495651_0174342
430 Ga0495582_0000005
431 Ga0495662_0000022
432 Ga0495608_0000406
433 Ga0495608_0019975
434 Ga0495608_0062991
435 Ga0495620_0000344
436 Ga0495628_0000070
437 Ga0495628_0004688
438 Ga0495628_0031488
439 Ga0495628_0031670
440 Ga0495628_0140105
441 Ga0495628_0290052
442 Ga0495628_0293512
443 Ga0495628_0309290
444 Ga0495630_0001004
445 Ga0495630_0135610
446 Ga0495644_0000600
447 Ga0495652_0006039
448 Ga0495640_0034817
449 Ga0495586_0001124
450 Ga0495587_0101815
451 Ga0495598_0004671
452 Ga0495621_0005720
453 Ga0495645_0009243
454 Ga0495667_0000015
455 Ga0495634_0000592
456 Ga0495634_0000910
457 Ga0495634_0011662
458 Ga0495634_0097255
459 Ga0495635_0000009
460 Ga0495635_0115182
461 Ga0495657_0008606
462 Ga0495599_0187453
463 Ga0495647_0000037
464 Ga0495658_0000019
465 Ga0495669_0000382
466 Ga0495613_0000257
467 Ga0495613_0014270
468 Ga0495624_0000013
469 Ga0495624_0032449
470 Ga0495670_0057675
471 Ga0495649_0003377
472 Ga0495604_0000033
473 Ga0495676_0000646
474 Ga0495680_0000023
475 Ga0495680_0001062
476 Ga0495680_0002013
477 Ga0495685_007491
478 Ga0495593_0062769
479 Ga0495602_0001999
480 Ga0496100_0000116
481 Ga0496100_0007372
482 Ga0496101_0000003
483 Ga0496101_0026168
484 Ga0496101_0118595
485 Ga0496102_0024171
486 Ga0496104_0000003
487 Ga0496104_0000147
488 Ga0496104_0159959
489 Ga0496104_0381458
490 Ga0496105_0000008
491 Ga0496105_0000138
492 Ga0496105_0011410
493 Ga0496105_0014661
494 Ga0496106_0000013
495 Ga0496106_0000177
496 Ga0496106_0027758
497 Ga0496107_0000081
498 Ga0496107_0044209
499 Ga0496108_0000002
500 Ga0496108_0004351
501 Ga0496109_0000001
502 Ga0496109_0000237
503 Ga0496109_0083279
504 Ga0496110_0016197
505 Ga0496110_0020908
506 Ga0496110_0041459
507 Ga0496111_0008241
508 Ga0496111_0040566
509 Ga0496112_0065433
510 Ga0496112_0711770
511 Ga0496113_0050418
512 Ga0496113_0221942
513 Ga0496114_0240246
514 Ga0496115_0006099
515 Ga0501042_0079236
516 Ga0501075_0000855
517 Ga0501075_0301056
518 Ga0501076_0150554
519 Ga0501081_0373606
520 nmdc:mga08y16_462699_c1
521 nmdc:mga0rr50_157568_c1
522 nmdc:mga0a205_12_c3
523 Ga0495601_0001565
524 Ga0495612_0000843
525 Ga0495612_0006267
526 Ga0495612_0062205
527 Ga0495595_0000109
528 Ga0495595_0017403
529 Ga0495619_0000024
530 Ga0495619_0000192
531 Ga0495619_0000980
532 Ga0495619_0024858
533 Ga0495619_0050609
534 Ga0500614_003324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

26

261

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

31

240

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r9q-assembly1.cif.gz_A structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9023 3 229
3qka-assembly1.cif.gz_E crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum 0.9018 2 236
4z0m-assembly1.cif.gz_C echa5 mycobacterium tuberculosis 0.8817 3 224
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.8811 4 228
3hrx-assembly2.cif.gz_E crystal structure of phenylacetic acid degradation protein paag 0.8803 5 227
ID Description Score Start End Superfamily
3qkaE02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9104 195 236 1.10.287.2460
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9073 84 192 3.90.226.20
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8997 2 194 3.90.226.10
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.895 2 194 3.90.226.10
3qkaE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8914 2 194 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7S3H8P0-F1-model_v4 Enoyl-CoA hydratase 0.9303 80 234 GO:0003824
AF-A0A848YEP7-F1-model_v4 Enoyl-CoA hydratase 0.9218 80 246
AF-A0A537ZCI5-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.907 1 250 GO:0003824
GO:0006631
AF-A0A1H6DHM3-F1-model_v4 Enoyl-CoA hydratase 0.9064 5 227 GO:0003824
GO:0006631
AF-A0A4R5AAP1-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9057 4 246 GO:0003824
GO:0006631

Map