F374873

General Info

Members Datasets Scaffolds Average Seq Length
267 169 534 404

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100003710|Ga0307408_1000037107
Length 386
Sequence MYDAIIIGGGACGLMCAVQAGYLGKRVLILEKTDKPGAKILISGGGRCNYTNMFATPANFISENEHFCKSAFSQWTVEDTISFFETYGIEGQEKTLGQLFPVSNKAKDIVEVFVGLCRDLEQDIRCNAEVKTVTKTDSGFTVGYERNGSLKEVKAGSVVIASGGLPIQKMGATDFGLKVKTAPALVPLTVTGKDAEWFANLSGNSIFCRVSNDKISFEENILFTHWGLSGPAILQISSYWKPGEEIVIDMLPNQSVMDLLEAERLNHGKKLLLNFLAGLYTKKFAEALAKYLPVDKNIASLTKDELLKIESFIHEFKLKPAGDKGYDKAEVMLGGVATDELSSKTLEAKKVPGLFFGGECVDVTGWLGGYNFQWAWASGFVIAQNI

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
141 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
142 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
143 2738541283 Pedobacter sp. OK701 Isolate Unclassified
144 2738541302 Pedobacter sp. CF074 Isolate Unclassified
145 2738543023 Pedobacter sp. OK628 Isolate Unclassified
146 2739367651 Pedobacter sp. OK291 Isolate Unclassified
147 2739367656 Pedobacter sp. CF523 Isolate Unclassified
148 2739367663 Pedobacter sp. YR510 Isolate Unclassified
149 2818991437 Pedobacter terrae 518 Isolate Unclassified
150 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
151 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
152 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
153 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
154 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
155 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
156 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
157 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
158 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
159 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
160 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
161 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
162 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
163 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
164 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
165 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
166 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
167 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
168 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
169 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0
Isolates 11.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0
Rhizoplane 0.75
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100003710 3300031548 Bacteria 10404
2 JGI24737J22298_10005695 3300001990 Bacteria 4287
3 JGI24737J22298_10009763 3300001990 Bacteria 3181
4 JGI24735J21928_10000001 3300002067 Bacteria 650042
5 JGI25162J39368_1000141 3300002737 Bacteria 77973
6 JGI25162J39368_1000427 3300002737 Bacteria 33903
7 JGI25164J39214_1003295 3300002772 Bacteria 2094
8 JGI25150J39212_1000051 3300002774 Bacteria 72281
9 JGI25151J46595_10000205 3300003187 Bacteria 72281
10 JGI25165J46597_1000548 3300003214 Bacteria 34311
11 JGI25153J46596_10000144 3300003215 Bacteria 72281
12 rootH2_10006566 3300003320 Bacteria 99379
13 rootH2_10080677 3300003320 Bacteria 2463
14 rootH1_10029634 3300003323 Bacteria 17261
15 Ga0055536_1000030 3300003781 Bacteria 153926
16 Ga0055530_10000723 3300003791 Bacteria 27721
17 Ga0065714_10003305 3300005288 Bacteria 11301
18 Ga0065714_10064513 3300005288 Bacteria 45040
19 Ga0065714_10067438 3300005288 Bacteria 5517
20 Ga0065714_10076052 3300005288 Bacteria 2834
21 Ga0065714_10076285 3300005288 Bacteria 2801
22 Ga0065704_10077142 3300005289 Bacteria 4839
23 Ga0070658_10000045 3300005327 Bacteria 130728
24 Ga0070658_10015727 3300005327 Bacteria 6051
25 Ga0070676_10000502 3300005328 Bacteria 18694
26 Ga0070671_100004475 3300005355 Bacteria 11067
27 Ga0070659_100000231 3300005366 Bacteria 43452
28 Ga0070659_100007893 3300005366 Bacteria 7750
29 Ga0070662_100000103 3300005457 Bacteria 46838
30 Ga0070681_10011112 3300005458 Bacteria 8911
31 Ga0068867_100003777 3300005459 Bacteria 10659
32 Ga0070684_100063468 3300005535 Bacteria 3238
33 Ga0068853_100053262 3300005539 Bacteria 3485
34 Ga0070672_100122974 3300005543 Bacteria 2126
35 Ga0070665_100000083 3300005548 Bacteria 181044
36 Ga0068855_100000227 3300005563 Bacteria 71930
37 Ga0068855_100003118 3300005563 Bacteria 20278
38 Ga0068855_100026390 3300005563 Bacteria 6948
39 Ga0068855_100037276 3300005563 Bacteria 5784
40 Ga0068855_100331053 3300005563 Bacteria 1681
41 Ga0068857_100031576 3300005577 Bacteria 4681
42 Ga0068856_100000263 3300005614 Bacteria 57295
43 Ga0068856_100020434 3300005614 Bacteria 6432
44 Ga0068856_100033423 3300005614 Bacteria 5035
45 Ga0068852_100005449 3300005616 Bacteria 9100
46 Ga0068866_10049412 3300005718 Bacteria 2131
47 Ga0075366_10002457 3300006195 Bacteria 9486
48 Ga0075366_10023977 3300006195 Bacteria 3557
49 Ga0097621_100000041 3300006237 Bacteria 66329
50 Ga0068871_100003606 3300006358 Bacteria 10633
51 Ga0105240_10000126 3300009093 Bacteria 157403
52 Ga0105240_10109439 3300009093 Bacteria 3346
53 Ga0105240_10160139 3300009093 Bacteria 2674
54 Ga0105240_10183893 3300009093 Bacteria 2464
55 Ga0105243_10000004 3300009148 Bacteria 601266
56 Ga0105241_10000775 3300009174 Bacteria 24313
57 Ga0105241_10051371 3300009174 Bacteria 3144
58 Ga0105241_10171959 3300009174 Bacteria 1790
59 Ga0105242_10229758 3300009176 Bacteria 1662
60 Ga0105237_10001772 3300009545 Bacteria 27889
61 Ga0105237_10002528 3300009545 Bacteria 22649
62 Ga0105237_10011250 3300009545 Bacteria 9469
63 Ga0105237_10114305 3300009545 Bacteria 2692
64 Ga0105237_10166815 3300009545 Bacteria 2201
65 Ga0105237_10279267 3300009545 Bacteria 1673
66 Ga0105239_10000002 3300010375 Bacteria 610298
67 Ga0105239_10000006 3300010375 Bacteria 442319
68 Ga0105239_10003720 3300010375 Bacteria 18575
69 Ga0105239_10031177 3300010375 Bacteria 5865
70 Ga0105239_10035680 3300010375 Bacteria 5460
71 Ga0105239_10235640 3300010375 Bacteria 2054
72 Ga0105246_10007565 3300011119 Bacteria 6667
73 Ga0157373_10000265 3300013100 Bacteria 42223
74 Ga0157371_10000034 3300013102 Bacteria 223947
75 Ga0157371_10000141 3300013102 Bacteria 104396
76 Ga0157371_10025142 3300013102 Bacteria 4343
77 Ga0157370_10006991 3300013104 Bacteria 12324
78 Ga0157370_10007182 3300013104 Bacteria 12153
79 Ga0157370_10012611 3300013104 Bacteria 8758
80 Ga0157370_10165449 3300013104 Bacteria 2057
81 Ga0157370_10226845 3300013104 Bacteria 1729
82 Ga0157369_10000002 3300013105 Bacteria 524510
83 Ga0157369_10337122 3300013105 Bacteria 1567
84 Ga0157369_10364646 3300013105 Bacteria 1500
85 Ga0157374_10000129 3300013296 Bacteria 69468
86 Ga0157374_10003215 3300013296 Bacteria 13719
87 Ga0163162_10000068 3300013306 Bacteria 97068
88 Ga0163162_10000330 3300013306 Bacteria 43379
89 Ga0163162_10028948 3300013306 Bacteria 5482
90 Ga0163162_10032538 3300013306 Bacteria 5180
91 Ga0157372_10000061 3300013307 Bacteria 119814
92 Ga0157372_10009804 3300013307 Bacteria 10187
93 Ga0157372_10253972 3300013307 Bacteria 2041
94 Ga0157375_10020891 3300013308 Bacteria 5993
95 Ga0182008_10000726 3300014497 Bacteria 23436
96 Ga0182008_10001151 3300014497 Bacteria 18248
97 Ga0182008_10009803 3300014497 Bacteria 5154
98 Ga0157377_10017962 3300014745 Bacteria 3669
99 Ga0157376_10084403 3300014969 Bacteria 2735
100 Ga0182006_1000505 3300015261 Bacteria 29828
101 Ga0182006_1002042 3300015261 Bacteria 11329
102 Ga0182006_1002694 3300015261 Bacteria 9542
103 Ga0182007_10000001 3300015262 Bacteria 1127301
104 Ga0182007_10055132 3300015262 Bacteria 1307
105 Ga0163161_10001017 3300017792 Bacteria 21369
106 Ga0163161_10001536 3300017792 Bacteria 17042
107 Ga0163161_10008145 3300017792 Bacteria 7248
108 Ga0163161_10009273 3300017792 Bacteria 6807
109 Ga0163161_10103173 3300017792 Bacteria 2125
110 Ga0207427_100090 3300025231 Bacteria 133759
111 Ga0209437_100034 3300025233 Bacteria 494007
112 Ga0209437_100070 3300025233 Bacteria 306718
113 Ga0207425_1000007 3300025245 Bacteria 777411
114 Ga0209026_1000526 3300025250 Bacteria 26962
115 Ga0209129_1000006 3300025258 Bacteria 777761
116 Ga0209233_1000038 3300025261 Bacteria 548972
117 Ga0209233_1011004 3300025261 Bacteria 2681
118 Ga0209676_1000001 3300025292 Bacteria 1852142
119 Ga0209025_1000025 3300025294 Bacteria 524454
120 Ga0209758_1000016 3300025297 Bacteria 778557
121 Ga0209050_1000018 3300025298 Bacteria 723263
122 Ga0207642_10051571 3300025899 Bacteria 1862
123 Ga0207647_10000062 3300025904 Bacteria 83809
124 Ga0207647_10000263 3300025904 Bacteria 43120
125 Ga0207645_10000224 3300025907 Bacteria 46998
126 Ga0207705_10000080 3300025909 Bacteria 119562
127 Ga0207654_10002243 3300025911 Bacteria 9913
128 Ga0207654_10059734 3300025911 Bacteria 2225
129 Ga0207654_10073633 3300025911 Bacteria 2036
130 Ga0207695_10000013 3300025913 Bacteria 821265
131 Ga0207695_10003717 3300025913 Bacteria 21241
132 Ga0207695_10004794 3300025913 Bacteria 18302
133 Ga0207695_10055377 3300025913 Bacteria 4133
134 Ga0207671_10001410 3300025914 Bacteria 27940
135 Ga0207671_10004324 3300025914 Bacteria 13650
136 Ga0207671_10005876 3300025914 Bacteria 11140
137 Ga0207671_10010835 3300025914 Bacteria 7479
138 Ga0207671_10080020 3300025914 Bacteria 2449
139 Ga0207657_10069967 3300025919 Bacteria 2975
140 Ga0207652_10070209 3300025921 Bacteria 3042
141 Ga0207644_10002859 3300025931 Bacteria 11132
142 Ga0207690_10002422 3300025932 Bacteria 11286
143 Ga0207706_10000851 3300025933 Bacteria 31416
144 Ga0207686_10132285 3300025934 Bacteria 1713
145 Ga0207709_10000010 3300025935 Bacteria 601305
146 Ga0207669_10057319 3300025937 Bacteria 2371
147 Ga0207704_10000037 3300025938 Bacteria 93990
148 Ga0207691_10179862 3300025940 Bacteria 1848
149 Ga0207667_10000217 3300025949 Bacteria 80489
150 Ga0207667_10029095 3300025949 Bacteria 5994
151 Ga0207667_10049302 3300025949 Bacteria 4448
152 Ga0207667_10320163 3300025949 Bacteria 1584
153 Ga0207640_10063089 3300025981 Bacteria 2461
154 Ga0207677_10096215 3300026023 Bacteria 2166
155 Ga0207639_10026733 3300026041 Bacteria 4195
156 Ga0207702_10000273 3300026078 Bacteria 59343
157 Ga0207702_10014812 3300026078 Bacteria 6468
158 Ga0207648_10000241 3300026089 Bacteria 58974
159 Ga0207674_10075825 3300026116 Bacteria 3372
160 Ga0207683_10006368 3300026121 Bacteria 10109
161 Ga0207698_10001086 3300026142 Bacteria 15810
162 Ga0268266_10000095 3300028379 Bacteria 186169
163 Ga0307517_10000719 3300028786 Bacteria 56987
164 Ga0307515_10004038 3300028794 Bacteria 30636
165 Ga0307515_10006107 3300028794 Bacteria 24219
166 Ga0307515_10011558 3300028794 Bacteria 16742
167 Ga0307515_10150613 3300028794 Bacteria 2434
168 Ga0307509_10044980 3300031507 Bacteria 4766
169 Ga0307408_100000611 3300031548 Bacteria 30550
170 Ga0307405_10000026 3300031731 Bacteria 118954
171 Ga0307405_10011965 3300031731 Bacteria 4572
172 Ga0307407_10000032 3300031903 Bacteria 87003
173 Ga0307412_10001456 3300031911 Bacteria 13169
174 Ga0307412_10242757 3300031911 Bacteria 1394
175 Ga0307416_100000045 3300032002 Bacteria 126832
176 Ga0307414_10008062 3300032004 Bacteria 5952
177 Ga0307414_10009300 3300032004 Bacteria 5636
178 Ga0307414_10256312 3300032004 Bacteria 1457
179 Ga0307507_10001815 3300033179 Bacteria 46860
180 Ga0307510_10006060 3300033180 Bacteria 14412
181 Ga0395899_0000002 3300037312 Bacteria 1324310
182 Ga0395900_0000694 3300037418 Bacteria 44919
183 Ga0395900_0001938 3300037418 Bacteria 23442
184 Ga0395905_0000841 3300037471 Bacteria 40055
185 Ga0395905_0002834 3300037471 Bacteria 18986
186 Ga0395901_0005109 3300038443 Bacteria 13255
187 Ga0395901_0027743 3300038443 Bacteria 5822
188 Ga0495651_0076782 3300046462 Bacteria 2530
189 Ga0495650_0000014 3300046471 Bacteria 581606
190 Ga0495585_0001451 3300046492 Bacteria 18615
191 Ga0495585_0002526 3300046492 Bacteria 13003
192 Ga0495606_0000241 3300046507 Bacteria 96663
193 Ga0495606_0106285 3300046507 Bacteria 1700
194 Ga0495610_0000472 3300046512 Bacteria 41524
195 Ga0495610_0001644 3300046512 Bacteria 19645
196 Ga0495616_0001895 3300046513 Bacteria 14129
197 Ga0495616_0009577 3300046513 Bacteria 5654
198 Ga0495631_0011593 3300046518 Bacteria 4331
199 Ga0495637_0058947 3300046520 Bacteria 1581
200 Ga0495644_0006471 3300046523 Bacteria 4540
201 Ga0495648_0071998 3300046524 Bacteria 2002
202 Ga0495652_0169428 3300046529 Bacteria 1687
203 Ga0495609_0001800 3300046538 Bacteria 13764
204 Ga0495609_0015002 3300046538 Bacteria 3631
205 Ga0495633_0000027 3300046558 Bacteria 204613
206 Ga0495633_0023065 3300046558 Bacteria 3086
207 Ga0495668_0000010 3300046616 Bacteria 487308
208 Ga0495625_0000003 3300046660 Bacteria 686847
209 Ga0495625_0000381 3300046660 Bacteria 67732
210 Ga0495625_0003720 3300046660 Bacteria 14873
211 Ga0495625_0017279 3300046660 Bacteria 5648
212 Ga0495625_0044401 3300046660 Bacteria 3217
213 Ga0495625_0053458 3300046660 Bacteria 2888
214 Ga0495661_0005263 3300046665 Bacteria 9200
215 Ga0495661_0024024 3300046665 Bacteria 3949
216 Ga0495649_0000002 3300046694 Bacteria 1093458
217 Ga0495687_003277 3300047443 Bacteria 11922
218 Ga0495685_025078 3300047447 Bacteria 2052
219 Ga0495686_0001273 3300047472 Bacteria 28543
220 Ga0495686_0002723 3300047472 Bacteria 16166
221 Ga0496115_0072539 3300048918 Bacteria 2794
222 Ga0496117_0000662 3300048920 Bacteria 55101
223 Ga0496118_0061152 3300048921 Bacteria 2791
224 Ga0496122_0000789 3300048925 Bacteria 60958
225 Ga0496122_0016472 3300048925 Bacteria 6990
226 Ga0496123_0002415 3300048926 Bacteria 23304
227 Ga0496123_0072041 3300048926 Bacteria 2152
228 Ga0495682_0024347 3300049460 Bacteria 2257
229 Ga0501223_002167 3300049663 Bacteria 4403
230 nmdc:mga0k408_1219_c1 3300050493 Bacteria 14084
231 nmdc:mga0k408_521_c1 3300050493 Bacteria 21145
232 Ga0500635_0000332 3300053080 Bacteria 16185
233 Ga0500608_033121 3300053122 Bacteria 2458
234 Ga0500608_044784 3300053122 Bacteria 2124
235 Ga0500614_006441 3300053123 Bacteria 2470
236 Ga0500618_000150 3300053125 Bacteria 57266
237 Ga0500622_0002157 3300053156 Bacteria 14602
238 2586209483 2585427687 Bacteria 5544917
239 2599477284 2599185184 Bacteria 6430550
240 2722727411 2721755487 Bacteria 6357185
241 2738756543 2738541283 Bacteria 7222293
242 2738853628 2738541302 Bacteria 5944758
243 2739303982 2738543023 Bacteria 6767879
244 2739588856 2739367651 Bacteria 6359826
245 2739617966 2739367656 Bacteria 5152243
246 2739645240 2739367663 Bacteria 5040914
247 2819548031 2818991437 Bacteria 5805520
248 2842726309 2842722452 Bacteria 6263924
249 2842910562 2842909656 Bacteria 6185908
250 2849282185 2849281842 Bacteria 6065644
251 2852624082 2852623160 Bacteria 4376875
252 2852627313 2852627209 Bacteria 5896285
253 2857628998 2857627736 Bacteria 5625397
254 2884936996 2884933994 Bacteria 4535041
255 2902048853 2902048731 Bacteria 4976191
256 2904445522 2904445276 Bacteria 5310396
257 2904781816 2904780799 Bacteria 5840761
258 2919181574 2919177583 Bacteria 5641607
259 2919187348 2919186247 Bacteria 6244071
260 2919442316 2919437846 Bacteria 6199444
261 2928079201 2928078545 Bacteria 6534839
262 2928148428 2928147474 Bacteria 6512076
263 2932085724 2932082852 Bacteria 6563563
264 2939665384 2939664404 Bacteria 6364494
265 2946000878 2945997725 Bacteria 6404843
266 2954017783 2954016120 Bacteria 6446024
267 2977236716 2977232053 Bacteria 5485925
268 Ga0307408_100003710
269 JGI24737J22298_10005695
270 JGI24737J22298_10009763
271 JGI24735J21928_10000001
272 JGI25162J39368_1000141
273 JGI25162J39368_1000427
274 JGI25164J39214_1003295
275 JGI25150J39212_1000051
276 JGI25151J46595_10000205
277 JGI25165J46597_1000548
278 JGI25153J46596_10000144
279 rootH2_10006566
280 rootH2_10080677
281 rootH1_10029634
282 Ga0055536_1000030
283 Ga0055530_10000723
284 Ga0065714_10003305
285 Ga0065714_10064513
286 Ga0065714_10067438
287 Ga0065714_10076052
288 Ga0065714_10076285
289 Ga0065704_10077142
290 Ga0070658_10000045
291 Ga0070658_10015727
292 Ga0070676_10000502
293 Ga0070671_100004475
294 Ga0070659_100000231
295 Ga0070659_100007893
296 Ga0070662_100000103
297 Ga0070681_10011112
298 Ga0068867_100003777
299 Ga0070684_100063468
300 Ga0068853_100053262
301 Ga0070672_100122974
302 Ga0070665_100000083
303 Ga0068855_100000227
304 Ga0068855_100003118
305 Ga0068855_100026390
306 Ga0068855_100037276
307 Ga0068855_100331053
308 Ga0068857_100031576
309 Ga0068856_100000263
310 Ga0068856_100020434
311 Ga0068856_100033423
312 Ga0068852_100005449
313 Ga0068866_10049412
314 Ga0075366_10002457
315 Ga0075366_10023977
316 Ga0097621_100000041
317 Ga0068871_100003606
318 Ga0105240_10000126
319 Ga0105240_10109439
320 Ga0105240_10160139
321 Ga0105240_10183893
322 Ga0105243_10000004
323 Ga0105241_10000775
324 Ga0105241_10051371
325 Ga0105241_10171959
326 Ga0105242_10229758
327 Ga0105237_10001772
328 Ga0105237_10002528
329 Ga0105237_10011250
330 Ga0105237_10114305
331 Ga0105237_10166815
332 Ga0105237_10279267
333 Ga0105239_10000002
334 Ga0105239_10000006
335 Ga0105239_10003720
336 Ga0105239_10031177
337 Ga0105239_10035680
338 Ga0105239_10235640
339 Ga0105246_10007565
340 Ga0157373_10000265
341 Ga0157371_10000034
342 Ga0157371_10000141
343 Ga0157371_10025142
344 Ga0157370_10006991
345 Ga0157370_10007182
346 Ga0157370_10012611
347 Ga0157370_10165449
348 Ga0157370_10226845
349 Ga0157369_10000002
350 Ga0157369_10337122
351 Ga0157369_10364646
352 Ga0157374_10000129
353 Ga0157374_10003215
354 Ga0163162_10000068
355 Ga0163162_10000330
356 Ga0163162_10028948
357 Ga0163162_10032538
358 Ga0157372_10000061
359 Ga0157372_10009804
360 Ga0157372_10253972
361 Ga0157375_10020891
362 Ga0182008_10000726
363 Ga0182008_10001151
364 Ga0182008_10009803
365 Ga0157377_10017962
366 Ga0157376_10084403
367 Ga0182006_1000505
368 Ga0182006_1002042
369 Ga0182006_1002694
370 Ga0182007_10000001
371 Ga0182007_10055132
372 Ga0163161_10001017
373 Ga0163161_10001536
374 Ga0163161_10008145
375 Ga0163161_10009273
376 Ga0163161_10103173
377 Ga0207427_100090
378 Ga0209437_100034
379 Ga0209437_100070
380 Ga0207425_1000007
381 Ga0209026_1000526
382 Ga0209129_1000006
383 Ga0209233_1000038
384 Ga0209233_1011004
385 Ga0209676_1000001
386 Ga0209025_1000025
387 Ga0209758_1000016
388 Ga0209050_1000018
389 Ga0207642_10051571
390 Ga0207647_10000062
391 Ga0207647_10000263
392 Ga0207645_10000224
393 Ga0207705_10000080
394 Ga0207654_10002243
395 Ga0207654_10059734
396 Ga0207654_10073633
397 Ga0207695_10000013
398 Ga0207695_10003717
399 Ga0207695_10004794
400 Ga0207695_10055377
401 Ga0207671_10001410
402 Ga0207671_10004324
403 Ga0207671_10005876
404 Ga0207671_10010835
405 Ga0207671_10080020
406 Ga0207657_10069967
407 Ga0207652_10070209
408 Ga0207644_10002859
409 Ga0207690_10002422
410 Ga0207706_10000851
411 Ga0207686_10132285
412 Ga0207709_10000010
413 Ga0207669_10057319
414 Ga0207704_10000037
415 Ga0207691_10179862
416 Ga0207667_10000217
417 Ga0207667_10029095
418 Ga0207667_10049302
419 Ga0207667_10320163
420 Ga0207640_10063089
421 Ga0207677_10096215
422 Ga0207639_10026733
423 Ga0207702_10000273
424 Ga0207702_10014812
425 Ga0207648_10000241
426 Ga0207674_10075825
427 Ga0207683_10006368
428 Ga0207698_10001086
429 Ga0268266_10000095
430 Ga0307517_10000719
431 Ga0307515_10004038
432 Ga0307515_10006107
433 Ga0307515_10011558
434 Ga0307515_10150613
435 Ga0307509_10044980
436 Ga0307408_100000611
437 Ga0307405_10000026
438 Ga0307405_10011965
439 Ga0307407_10000032
440 Ga0307412_10001456
441 Ga0307412_10242757
442 Ga0307416_100000045
443 Ga0307414_10008062
444 Ga0307414_10009300
445 Ga0307414_10256312
446 Ga0307507_10001815
447 Ga0307510_10006060
448 Ga0395899_0000002
449 Ga0395900_0000694
450 Ga0395900_0001938
451 Ga0395905_0000841
452 Ga0395905_0002834
453 Ga0395901_0005109
454 Ga0395901_0027743
455 Ga0495651_0076782
456 Ga0495650_0000014
457 Ga0495585_0001451
458 Ga0495585_0002526
459 Ga0495606_0000241
460 Ga0495606_0106285
461 Ga0495610_0000472
462 Ga0495610_0001644
463 Ga0495616_0001895
464 Ga0495616_0009577
465 Ga0495631_0011593
466 Ga0495637_0058947
467 Ga0495644_0006471
468 Ga0495648_0071998
469 Ga0495652_0169428
470 Ga0495609_0001800
471 Ga0495609_0015002
472 Ga0495633_0000027
473 Ga0495633_0023065
474 Ga0495668_0000010
475 Ga0495625_0000003
476 Ga0495625_0000381
477 Ga0495625_0003720
478 Ga0495625_0017279
479 Ga0495625_0044401
480 Ga0495625_0053458
481 Ga0495661_0005263
482 Ga0495661_0024024
483 Ga0495649_0000002
484 Ga0495687_003277
485 Ga0495685_025078
486 Ga0495686_0001273
487 Ga0495686_0002723
488 Ga0496115_0072539
489 Ga0496117_0000662
490 Ga0496118_0061152
491 Ga0496122_0000789
492 Ga0496122_0016472
493 Ga0496123_0002415
494 Ga0496123_0072041
495 Ga0495682_0024347
496 Ga0501223_002167
497 nmdc:mga0k408_1219_c1
498 nmdc:mga0k408_521_c1
499 Ga0500635_0000332
500 Ga0500608_033121
501 Ga0500608_044784
502 Ga0500614_006441
503 Ga0500618_000150
504 Ga0500622_0002157
505 2586209483
506 2599477284
507 2722727411
508 2738756543
509 2738853628
510 2739303982
511 2739588856
512 2739617966
513 2739645240
514 2819548031
515 2842726309
516 2842910562
517 2849282185
518 2852624082
519 2852627313
520 2857628998
521 2884936996
522 2902048853
523 2904445522
524 2904781816
525 2919181574
526 2919187348
527 2919442316
528 2928079201
529 2928148428
530 2932085724
531 2939665384
532 2946000878
533 2954017783
534 2977236716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22780

HI0933_like_1st

HI0933-like protein barrel and H2TH domain

182

331

0.98

PF03486

HI0933_like

HI0933-like protein Rossmann domain

2

385

0.96

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

6

50

0.95

PF00890

FAD_binding_2

FAD binding domain

3

204

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.9564 27 60
6eod-assembly3.cif.gz_C structure of reductive aminase from aspergillus terreus in complex with nadph 0.9192 25 53
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9058 25 55
4j0f-assembly1.cif.gz_B crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p212121 space group 0.9017 25 57
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9016 23 53
ID Description Score Start End Superfamily
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9202 27 57 3.40.50.720
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9152 27 56 3.40.50.720
4b3jB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9123 27 56 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9101 25 53 3.40.50.720
af_Q46808_105_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9039 27 55 3.40.50.720
ID Description Score Start End GO Terms
AF-F3GLF0-F1-model_v4 BaiN-like insert domain-containing protein 0.9135 205 354
AF-A0A4S0YY97-F1-model_v4 deleted 0.9092 224 339
AF-F3GLF0-F1-model_v4 BaiN-like insert domain-containing protein 0.8968 205 354
AF-A0A855HSZ4-F1-model_v4 deleted 0.8948 210 320
AF-A0A4S0YY97-F1-model_v4 deleted 0.8809 224 339

Map