F374892

General Info

Members Datasets Scaffolds Average Seq Length
267 204 229 156

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10174597|Ga0307518_101745972
Length 165
Sequence MELRMMEVLMEVALRPVHDSDLPVFFRQMNDPESLRMAAFAPKDPADRDAFDAHWKRIRASSDVLRTVLVDGDVVGSAAVYGEPGEREVTYWIDRAYWGKGIATAALRDLLAEVPERPLHARVAADNAGSRRVLEKCGFRVTAHARGFANARGEEIDELVLKLDV

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2643221647 Streptomyces sp. Root369 Isolate Unclassified
4 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
5 2643221714 Streptomyces sp. Root264 Isolate Unclassified
6 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
7 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
8 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
9 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
10 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
11 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
12 2808606448 Streptomyces sp. 193411 Isolate Unclassified
13 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
14 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
17 2862574272 Streptomyces sp. AcE210 Isolate Nodule
18 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
19 2867428634 Streptomyces sp. RP5T Isolate Unclassified
20 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
21 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
22 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
23 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
24 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
25 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
26 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
27 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
28 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
29 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
30 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
31 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
32 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
33 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
34 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
35 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
36 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
82 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
90 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
91 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
201 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
204 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.02
Metatranscriptomes 0.75
Isolates 14.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 1.5
Rhizoplane 0.37
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 16.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10024829 3300001990 Bacteria 1897
2 JGI24735J21928_10011542 3300002067 Bacteria 2798
3 JGI25153J46596_10084774 3300003215 Bacteria 780
4 rootH1_10005677 3300003323 Bacteria 1257
5 rootH1_10005678 3300003323 Bacteria 4528
6 rootH1_10006098 3300003323 Bacteria 2256
7 Ga0006562J51391_1061697 3300003578 Bacteria 1250
8 Ga0006562J51391_1061698 3300003578 Bacteria 1160
9 Ga0070675_101048707 3300005354 Bacteria 749
10 Ga0068857_101610464 3300005577 Bacteria 634
11 Ga0068856_101090400 3300005614 Bacteria 816
12 Ga0081455_10199792 3300005937 Bacteria 1498
13 Ga0075368_10001243 3300006042 Bacteria 8054
14 Ga0075363_100035480 3300006048 Bacteria 2610
15 Ga0075367_10000305 3300006178 Bacteria 17354
16 Ga0099826_10039552 3300006948 Bacteria 3298
17 Ga0105244_10065913 3300009036 Bacteria 1813
18 Ga0105243_10451697 3300009148 Bacteria 1206
19 Ga0105246_10003020 3300011119 Bacteria 10202
20 Ga0157369_11005818 3300013105 Bacteria 853
21 Ga0182008_10008519 3300014497 Bacteria 5600
22 Ga0182007_10002070 3300015262 Bacteria 10311
23 Ga0182005_1016952 3300015265 Bacteria 2019
24 Ga0183367_1007 3300015688 Bacteria 498079
25 Ga0209758_1003337 3300025297 Bacteria 14752
26 Ga0207426_1023515 3300025302 Bacteria 2101
27 Ga0207647_10026171 3300025904 Bacteria 3820
28 Ga0207657_10498728 3300025919 Bacteria 954
29 Ga0207709_10202610 3300025935 Bacteria 1418
30 Ga0207702_11473287 3300026078 Bacteria 674
31 Ga0209371_1028225 3300027312 Bacteria 1254
32 Ga0209813_10002001 3300027866 Bacteria 4614
33 Ga0268256_1032090 3300030500 Bacteria 1255
34 Ga0307511_10000572 3300030521 Bacteria 39456
35 Ga0307511_10048717 3300030521 Bacteria 3443
36 Ga0307512_10002089 3300030522 Bacteria 26241
37 Ga0307512_10005469 3300030522 Bacteria 13260
38 Ga0307509_10025473 3300031507 Bacteria 6604
39 Ga0307509_10080131 3300031507 Bacteria 3378
40 Ga0307508_10116120 3300031616 Bacteria 2278
41 Ga0307514_10006168 3300031649 Bacteria 10518
42 Ga0307516_10003074 3300031730 Bacteria 21757
43 Ga0307516_10205194 3300031730 Bacteria 1688
44 Ga0307518_10041587 3300031838 Bacteria 3346
45 Ga0307518_10174597 3300031838 Bacteria 1460
46 Ga0307518_10220930 3300031838 Bacteria 1236
47 Ga0307518_10322273 3300031838 Bacteria 922
48 Ga0307507_10076927 3300033179 Bacteria 2972
49 Ga0307510_10137512 3300033180 Bacteria 2096
50 Ga0307510_10157080 3300033180 Bacteria 1879
51 Ga0395900_0373746 3300037418 Bacteria 1395
52 Ga0395900_1482342 3300037418 Bacteria 591
53 Ga0395898_0008245 3300037466 Bacteria 11016
54 Ga0395898_0410024 3300037466 Bacteria 1292
55 Ga0436365_0279358 3300039437 Bacteria 1080
56 Ga0439436_0001136 3300041404 Bacteria 7544
57 Ga0439436_0008325 3300041404 Bacteria 3185
58 Ga0451807_1163587 3300041486 Bacteria 712
59 Ga0451841_0773482 3300041498 Bacteria 924
60 Ga0451849_0875547 3300041505 Bacteria 1339
61 Ga0451853_0427280 3300041512 Bacteria 1538
62 Ga0451853_1902937 3300041512 Bacteria 2037
63 Ga0451853_3430276 3300041512 Bacteria 1002
64 Ga0439433_0041882 3300041999 Bacteria 1067
65 Ga0439433_0064925 3300041999 Bacteria 874
66 Ga0439448_0001460 3300042005 Bacteria 6130
67 Ga0439449_0001547 3300042007 Bacteria 9005
68 Ga0439449_0045926 3300042007 Bacteria 1618
69 Ga0439455_0008938 3300042012 Bacteria 2161
70 Ga0439457_000063 3300042014 Bacteria 22796
71 Ga0439457_002801 3300042014 Bacteria 4876
72 Ga0439457_173194 3300042014 Bacteria 525
73 Ga0439462_0005997 3300042015 Bacteria 3009
74 Ga0439462_0047220 3300042015 Bacteria 1154
75 Ga0450894_001906 3300042131 Bacteria 2886
76 Ga0450895_002864 3300042132 Bacteria 1309
77 Ga0450898_000520 3300042134 Bacteria 4496
78 Ga0450899_000725 3300042135 Bacteria 3757
79 Ga0450903_000021 3300042138 Bacteria 30994
80 Ga0450910_005456 3300042147 Bacteria 1735
81 Ga0439458_0001500 3300042157 Bacteria 5856
82 Ga0439458_0017596 3300042157 Bacteria 1634
83 Ga0450908_008053 3300042184 Bacteria 1977
84 Ga0466969_0027257 3300044656 Bacteria 2926
85 Ga0466972_0006599 3300044658 Bacteria 5828
86 Ga0466972_0076049 3300044658 Bacteria 1599
87 Ga0466965_0000399 3300044683 Bacteria 14891
88 Ga0466965_0013754 3300044683 Bacteria 3823
89 Ga0466966_0030008 3300044684 Bacteria 3534
90 Ga0466961_0013843 3300044693 Bacteria 5169
91 Ga0466961_0092160 3300044693 Bacteria 1913
92 Ga0466963_0000036 3300044694 Bacteria 43635
93 Ga0466964_0005682 3300044706 Bacteria 4639
94 Ga0466971_0052358 3300044719 Bacteria 1838
95 Ga0466971_0503074 3300044719 Bacteria 598
96 Ga0466968_0044237 3300044735 Bacteria 1887
97 Ga0466970_0001765 3300044765 Bacteria 10425
98 Ga0466970_0010000 3300044765 Bacteria 4804
99 Ga0466957_0035706 3300044842 Bacteria 2983
100 Ga0466960_0147692 3300044901 Bacteria 1253
101 Ga0466960_0647968 3300044901 Bacteria 630
102 Ga0466959_0029353 3300045049 Bacteria 4074
103 Ga0466958_0046651 3300045836 Bacteria 2614
104 Ga0466967_0011988 3300045976 Bacteria 6604
105 Ga0466967_0371426 3300045976 Bacteria 1387
106 Ga0466967_0623375 3300045976 Bacteria 1065
107 Ga0495592_0007735 3300046454 Bacteria 8051
108 Ga0495603_0039684 3300046455 Bacteria 2819
109 Ga0495590_0052678 3300046457 Bacteria 1421
110 Ga0495590_0092656 3300046457 Bacteria 1070
111 Ga0495629_0003501 3300046459 Bacteria 11866
112 Ga0495629_0014271 3300046459 Bacteria 5720
113 Ga0495651_0010311 3300046462 Bacteria 7180
114 Ga0495582_0013765 3300046473 Bacteria 4454
115 Ga0495582_0065552 3300046473 Bacteria 2007
116 Ga0495605_0304549 3300046474 Bacteria 674
117 Ga0495662_0179815 3300046476 Bacteria 1042
118 Ga0495664_0000395 3300046477 Bacteria 21368
119 Ga0495585_0238785 3300046492 Bacteria 910
120 Ga0495594_0010996 3300046499 Bacteria 4699
121 Ga0495596_0058894 3300046500 Bacteria 1497
122 Ga0495607_0026058 3300046501 Bacteria 3630
123 Ga0495583_0163755 3300046506 Bacteria 916
124 Ga0495606_0017865 3300046507 Bacteria 5341
125 Ga0495610_0163333 3300046512 Bacteria 940
126 Ga0495618_0016086 3300046514 Bacteria 4571
127 Ga0495620_0093606 3300046515 Bacteria 1203
128 Ga0495628_0018331 3300046516 Bacteria 5801
129 Ga0495630_0433145 3300046517 Bacteria 1007
130 Ga0495632_0305766 3300046519 Bacteria 704
131 Ga0495637_0220692 3300046520 Bacteria 690
132 Ga0495643_0002536 3300046522 Bacteria 14308
133 Ga0495654_0024529 3300046530 Bacteria 3114
134 Ga0495665_0167335 3300046531 Bacteria 1145
135 Ga0495640_0030544 3300046533 Bacteria 3857
136 Ga0495640_0298218 3300046533 Bacteria 1001
137 Ga0495586_0015994 3300046535 Bacteria 3992
138 Ga0495587_0018963 3300046536 Bacteria 4263
139 Ga0495609_0030814 3300046538 Bacteria 2441
140 Ga0495645_0010721 3300046543 Bacteria 6437
141 Ga0495622_0022868 3300046557 Bacteria 2913
142 Ga0495622_0108984 3300046557 Bacteria 1268
143 Ga0495633_0038535 3300046558 Bacteria 2282
144 Ga0495667_0079685 3300046559 Bacteria 2129
145 Ga0495668_0015797 3300046616 Bacteria 4398
146 Ga0495668_0151390 3300046616 Bacteria 1270
147 Ga0495668_0207130 3300046616 Bacteria 1074
148 Ga0495634_0005020 3300046642 Bacteria 10214
149 Ga0495625_0041632 3300046660 Bacteria 3342
150 Ga0495625_0076337 3300046660 Bacteria 2343
151 Ga0495625_0119899 3300046660 Bacteria 1791
152 Ga0495635_0013334 3300046663 Bacteria 5752
153 Ga0495661_0059601 3300046665 Bacteria 2271
154 Ga0495657_0001364 3300046675 Bacteria 21209
155 Ga0495646_0000943 3300046680 Bacteria 16549
156 Ga0495613_0003375 3300046689 Bacteria 11934
157 Ga0495649_0013939 3300046694 Bacteria 4624
158 Ga0495589_0023947 3300046794 Bacteria 3105
159 Ga0495589_0109340 3300046794 Bacteria 1335
160 Ga0495600_0009164 3300046809 Bacteria 6105
161 Ga0495660_0127941 3300046810 Bacteria 1277
162 Ga0495660_0411468 3300046810 Bacteria 590
163 Ga0495604_0001577 3300047317 Bacteria 18781
164 Ga0495604_0115415 3300047317 Bacteria 1951
165 Ga0495636_0006713 3300047318 Bacteria 4526
166 Ga0495636_0108193 3300047318 Bacteria 1221
167 Ga0495674_0279830 3300047319 Bacteria 1367
168 Ga0495676_0076018 3300047321 Bacteria 2565
169 Ga0495680_0662241 3300047322 Bacteria 693
170 Ga0495683_0109805 3300047323 Bacteria 1317
171 Ga0495687_010443 3300047443 Bacteria 5094
172 Ga0495687_116553 3300047443 Bacteria 971
173 Ga0495675_0403836 3300047444 Bacteria 796
174 Ga0495677_0059783 3300047445 Bacteria 1412
175 Ga0495685_002169 3300047447 Bacteria 6097
176 Ga0495685_006114 3300047447 Bacteria 3939
177 Ga0495685_012363 3300047447 Bacteria 2891
178 Ga0495684_0535953 3300047471 Bacteria 799
179 Ga0495686_0175743 3300047472 Bacteria 1243
180 Ga0495686_0338757 3300047472 Bacteria 820
181 Ga0495593_0006357 3300047673 Bacteria 6930
182 Ga0495614_0000978 3300048089 Bacteria 12151
183 Ga0495614_0314506 3300048089 Bacteria 725
184 Ga0495626_0003841 3300048091 Bacteria 9425
185 Ga0495678_085800 3300049459 Bacteria 1120
186 Ga0501031_0585043 3300049568 Bacteria 718
187 Ga0501032_0106793 3300049569 Bacteria 1854
188 Ga0501033_0084670 3300049570 Bacteria 2323
189 Ga0501034_0127440 3300049571 Bacteria 2530
190 Ga0501034_0131401 3300049571 Bacteria 2486
191 Ga0501036_0003329 3300049572 Bacteria 12835
192 Ga0501036_0040038 3300049572 Bacteria 3964
193 Ga0501038_0141788 3300049574 Bacteria 1965
194 Ga0501038_0198350 3300049574 Bacteria 1612
195 Ga0501041_1009056 3300049577 Bacteria 535
196 Ga0501042_1212288 3300049578 Bacteria 550
197 Ga0501043_0063244 3300049579 Bacteria 2906
198 Ga0501043_0151741 3300049579 Bacteria 1813
199 Ga0501047_0059117 3300049581 Bacteria 3701
200 Ga0501047_0080274 3300049581 Bacteria 3135
201 Ga0501067_0001525 3300049583 Bacteria 12613
202 Ga0501069_0245592 3300049585 Bacteria 1044
203 Ga0501070_0216540 3300049586 Bacteria 1571
204 Ga0501070_0387051 3300049586 Bacteria 1132
205 Ga0501070_0560465 3300049586 Bacteria 914
206 Ga0501070_1096575 3300049586 Bacteria 614
207 Ga0501074_0675525 3300049590 Bacteria 729
208 Ga0501080_0097060 3300049742 Bacteria 2736
209 Ga0501080_0812729 3300049742 Bacteria 819
210 Ga0501083_0347325 3300049744 Bacteria 965
211 Ga0501035_0175267 3300049822 Bacteria 1850
212 Ga0501035_0188090 3300049822 Bacteria 1776
213 Ga0501035_0309094 3300049822 Bacteria 1330
214 Ga0501044_0001130 3300049823 Bacteria 31721
215 Ga0501044_0020656 3300049823 Bacteria 7031
216 Ga0501044_0247615 3300049823 Bacteria 1724
217 nmdc:mga03n38_15788_c1 3300050490 Bacteria 2923
218 nmdc:mga03n38_61732_c1 3300050490 Bacteria 1707
219 nmdc:mga06z11_499_c1 3300050494 Bacteria 14504
220 nmdc:mga04h51_289_c1 3300050495 Bacteria 12908
221 Ga0495612_0012163 3300053078 Bacteria 3469
222 Ga0500578_0068904 3300053086 Bacteria 2255
223 Ga0500644_0126755 3300053088 Bacteria 1001
224 Ga0500650_0527749 3300053098 Bacteria 500
225 Ga0500573_0224394 3300053140 Bacteria 983
226 Ga0500579_262041 3300053143 Bacteria 548
227 Ga0500624_012244 3300053157 Bacteria 1265
228 Ga0466962_0011680 3300061719 Bacteria 4228
229 Ga0466962_0208046 3300061719 Bacteria 957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0175743 Ga0495686_0175743_11_424 137
2 3300049586 Ga0501070_1096575 Ga0501070_1096575_185_598 137
3 3300053098 Ga0500650_0527749 Ga0500650_0527749_70_486 137
4 3300025919 Ga0207657_10498728 Ga0207657_104987282 139
5 3300049586 Ga0501070_0216540 Ga0501070_0216540_1105_1554 148
6 3300050490 nmdc:mga03n38_61732_c1 nmdc:mga03n38_61732_c1_17_478 149
7 iso_pu_bacteria 2784746763 2785340450 150
8 iso_pu_bacteria 2547132111 2547411024 152
9 iso_pu_bacteria 2582581313 2585307541 152
10 iso_pu_bacteria 2643221647 2644270802 152
11 iso_pu_bacteria 2643221678 2644435482 152
12 iso_pu_bacteria 2643221714 2644630515 152
13 iso_pu_bacteria 2784132148 2784587131 152
14 iso_pu_bacteria 2784746768 2785367622 152
15 iso_pu_bacteria 2786546132 2786668682 152
16 iso_pu_bacteria 2808606359 2808848104 152
17 iso_pu_bacteria 2808606375 2808918871 152
18 iso_pu_bacteria 2808606448 2809230691 152
19 iso_pu_bacteria 2811994879 2812359898 152
20 iso_pu_bacteria 2852635781 2852638132 152
21 iso_pu_bacteria 2862281513 2862289018 152
22 iso_pu_bacteria 2862574272 2862583246 152
23 iso_pu_bacteria 2867428634 2867432243 152
24 iso_pu_bacteria 2873151551 2873157275 152
25 iso_pu_bacteria 2877676314 2877682926 152
26 iso_pu_bacteria 2919468124 2919475035 152
27 iso_pu_bacteria 2946064051 2946066008 152
28 iso_pu_bacteria 2946072368 2946074326 152
29 iso_pu_bacteria 2954380949 2954388138 152
30 iso_pu_bacteria 2954673503 2954674961 152
31 iso_pu_bacteria 2954682443 2954689174 152
32 iso_pu_bacteria 2954691527 2954698944 152
33 iso_pu_bacteria 2954701450 2954703277 152
34 iso_pu_bacteria 2954711539 2954717902 152
35 iso_pu_bacteria 2954721474 2954727868 152
36 iso_pu_bacteria 2954731030 2954733936 152
37 iso_pu_bacteria 2954740390 2954746766 152
38 iso_pu_bacteria 2954749733 2954752819 152
39 iso_pu_bacteria 2954759201 2954765876 152
40 iso_pu_bacteria 3006493962 3006496594 152
41 iso_pu_bacteria 8023623736 8023625191 152
42 3300041404 Ga0439436_0001136 Ga0439436_0001136_1127_1594 154
43 3300041999 Ga0439433_0041882 Ga0439433_0041882_73_540 154
44 3300042014 Ga0439457_000063 Ga0439457_000063_16236_16703 154
45 3300042015 Ga0439462_0047220 Ga0439462_0047220_137_604 154
46 3300049577 Ga0501041_1009056 Ga0501041_1009056_20_508 154
47 3300049578 Ga0501042_1212288 Ga0501042_1212288_21_509 154
48 3300039437 Ga0436365_0279358 Ga0436365_0279358_273_743 155
49 3300044765 Ga0466970_0010000 Ga0466970_0010000_1720_2187 155
50 3300049583 Ga0501067_0001525 Ga0501067_0001525_11185_11667 155
51 3300049822 Ga0501035_0175267 Ga0501035_0175267_1015_1491 155
52 3300049823 Ga0501044_0020656 Ga0501044_0020656_4628_5104 155
53 iso_pu_bacteria 2862382967 2862389556 155
54 iso_pu_bacteria 2863404153 2863409402 155
55 iso_pu_bacteria 8008558824 8008563684 155
56 3300001990 JGI24737J22298_10024829 JGI24737J22298_100248292 156
57 3300002067 JGI24735J21928_10011542 JGI24735J21928_100115423 156
58 3300003215 JGI25153J46596_10084774 JGI25153J46596_100847742 156
59 3300003323 rootH1_10005677 rootH1_100056771 156
60 3300003323 rootH1_10005678 rootH1_100056785 156
61 3300003323 rootH1_10006098 rootH1_100060981 156
62 3300003578 Ga0006562J51391_1061697 Ga0006562J51391_10616972 156
63 3300003578 Ga0006562J51391_1061698 Ga0006562J51391_10616981 156
64 3300005354 Ga0070675_101048707 Ga0070675_1010487071 156
65 3300005577 Ga0068857_101610464 Ga0068857_1016104642 156
66 3300005614 Ga0068856_101090400 Ga0068856_1010904002 156
67 3300005937 Ga0081455_10199792 Ga0081455_101997922 156
68 3300006042 Ga0075368_10001243 Ga0075368_100012433 156
69 3300006048 Ga0075363_100035480 Ga0075363_1000354803 156
70 3300006178 Ga0075367_10000305 Ga0075367_1000030513 156
71 3300006948 Ga0099826_10039552 Ga0099826_100395523 156
72 3300009036 Ga0105244_10065913 Ga0105244_100659132 156
73 3300009148 Ga0105243_10451697 Ga0105243_104516972 156
74 3300011119 Ga0105246_10003020 Ga0105246_100030202 156
75 3300013105 Ga0157369_11005818 Ga0157369_110058182 156
76 3300014497 Ga0182008_10008519 Ga0182008_100085192 156
77 3300015262 Ga0182007_10002070 Ga0182007_1000207011 156
78 3300015265 Ga0182005_1016952 Ga0182005_10169522 156
79 3300015688 Ga0183367_1007 Ga0183367_1007114 156
80 3300025297 Ga0209758_1003337 Ga0209758_100333712 156
81 3300025302 Ga0207426_1023515 Ga0207426_10235152 156
82 3300025904 Ga0207647_10026171 Ga0207647_100261712 156
83 3300025935 Ga0207709_10202610 Ga0207709_102026102 156
84 3300026078 Ga0207702_11473287 Ga0207702_114732871 156
85 3300027312 Ga0209371_1028225 Ga0209371_10282252 156
86 3300027866 Ga0209813_10002001 Ga0209813_100020013 156
87 3300030500 Ga0268256_1032090 Ga0268256_10320902 156
88 3300030521 Ga0307511_10000572 Ga0307511_1000057234 156
89 3300030521 Ga0307511_10048717 Ga0307511_100487174 156
90 3300030522 Ga0307512_10002089 Ga0307512_1000208914 156
91 3300030522 Ga0307512_10005469 Ga0307512_100054699 156
92 3300031507 Ga0307509_10025473 Ga0307509_100254735 156
93 3300031507 Ga0307509_10080131 Ga0307509_100801313 156
94 3300031616 Ga0307508_10116120 Ga0307508_101161203 156
95 3300031649 Ga0307514_10006168 Ga0307514_100061684 156
96 3300031730 Ga0307516_10003074 Ga0307516_1000307412 156
97 3300031730 Ga0307516_10205194 Ga0307516_102051942 156
98 3300031838 Ga0307518_10041587 Ga0307518_100415873 156
99 3300031838 Ga0307518_10174597 Ga0307518_101745972 156
100 3300031838 Ga0307518_10220930 Ga0307518_102209302 156
101 3300031838 Ga0307518_10322273 Ga0307518_103222732 156
102 3300033179 Ga0307507_10076927 Ga0307507_100769272 156
103 3300033180 Ga0307510_10137512 Ga0307510_101375122 156
104 3300033180 Ga0307510_10157080 Ga0307510_101570802 156
105 3300037418 Ga0395900_0373746 Ga0395900_0373746_333_803 156
106 3300037418 Ga0395900_1482342 Ga0395900_1482342_77_550 156
107 3300037466 Ga0395898_0008245 Ga0395898_0008245_7983_8456 156
108 3300037466 Ga0395898_0410024 Ga0395898_0410024_129_599 156
109 3300041404 Ga0439436_0008325 Ga0439436_0008325_1891_2364 156
110 3300041486 Ga0451807_1163587 Ga0451807_1163587_104_574 156
111 3300041498 Ga0451841_0773482 Ga0451841_0773482_65_535 156
112 3300041505 Ga0451849_0875547 Ga0451849_0875547_795_1265 156
113 3300041512 Ga0451853_0427280 Ga0451853_0427280_244_714 156
114 3300041512 Ga0451853_1902937 Ga0451853_1902937_1175_1645 156
115 3300041512 Ga0451853_3430276 Ga0451853_3430276_383_868 156
116 3300041999 Ga0439433_0064925 Ga0439433_0064925_322_795 156
117 3300042005 Ga0439448_0001460 Ga0439448_0001460_2132_2602 156
118 3300042007 Ga0439449_0001547 Ga0439449_0001547_1224_1694 156
119 3300042007 Ga0439449_0045926 Ga0439449_0045926_772_1245 156
120 3300042012 Ga0439455_0008938 Ga0439455_0008938_1591_2061 156
121 3300042014 Ga0439457_002801 Ga0439457_002801_3979_4452 156
122 3300042014 Ga0439457_173194 Ga0439457_173194_22_492 156
123 3300042015 Ga0439462_0005997 Ga0439462_0005997_1265_1738 156
124 3300042131 Ga0450894_001906 Ga0450894_001906_951_1436 156
125 3300042132 Ga0450895_002864 Ga0450895_002864_567_1052 156
126 3300042134 Ga0450898_000520 Ga0450898_000520_3334_3819 156
127 3300042135 Ga0450899_000725 Ga0450899_000725_1531_2016 156
128 3300042138 Ga0450903_000021 Ga0450903_000021_9803_10273 156
129 3300042147 Ga0450910_005456 Ga0450910_005456_642_1127 156
130 3300042157 Ga0439458_0001500 Ga0439458_0001500_4390_4860 156
131 3300042157 Ga0439458_0017596 Ga0439458_0017596_406_876 156
132 3300042184 Ga0450908_008053 Ga0450908_008053_490_975 156
133 3300044656 Ga0466969_0027257 Ga0466969_0027257_930_1400 156
134 3300044658 Ga0466972_0006599 Ga0466972_0006599_2012_2482 156
135 3300044658 Ga0466972_0076049 Ga0466972_0076049_631_1101 156
136 3300044683 Ga0466965_0000399 Ga0466965_0000399_9012_9482 156
137 3300044683 Ga0466965_0013754 Ga0466965_0013754_56_529 156
138 3300044684 Ga0466966_0030008 Ga0466966_0030008_1046_1516 156
139 3300044693 Ga0466961_0013843 Ga0466961_0013843_3468_3938 156
140 3300044693 Ga0466961_0092160 Ga0466961_0092160_1281_1751 156
141 3300044694 Ga0466963_0000036 Ga0466963_0000036_34443_34913 156
142 3300044706 Ga0466964_0005682 Ga0466964_0005682_221_691 156
143 3300044719 Ga0466971_0052358 Ga0466971_0052358_984_1454 156
144 3300044719 Ga0466971_0503074 Ga0466971_0503074_112_582 156
145 3300044735 Ga0466968_0044237 Ga0466968_0044237_237_707 156
146 3300044765 Ga0466970_0001765 Ga0466970_0001765_1232_1702 156
147 3300044842 Ga0466957_0035706 Ga0466957_0035706_803_1273 156
148 3300044901 Ga0466960_0147692 Ga0466960_0147692_138_608 156
149 3300044901 Ga0466960_0647968 Ga0466960_0647968_130_600 156
150 3300045049 Ga0466959_0029353 Ga0466959_0029353_1017_1487 156
151 3300045836 Ga0466958_0046651 Ga0466958_0046651_1112_1582 156
152 3300045976 Ga0466967_0011988 Ga0466967_0011988_5475_5945 156
153 3300045976 Ga0466967_0371426 Ga0466967_0371426_864_1334 156
154 3300045976 Ga0466967_0623375 Ga0466967_0623375_297_767 156
155 3300046454 Ga0495592_0007735 Ga0495592_0007735_5977_6450 156
156 3300046455 Ga0495603_0039684 Ga0495603_0039684_1313_1783 156
157 3300046457 Ga0495590_0052678 Ga0495590_0052678_715_1185 156
158 3300046457 Ga0495590_0092656 Ga0495590_0092656_262_732 156
159 3300046459 Ga0495629_0003501 Ga0495629_0003501_3908_4381 156
160 3300046459 Ga0495629_0014271 Ga0495629_0014271_2828_3298 156
161 3300046462 Ga0495651_0010311 Ga0495651_0010311_139_612 156
162 3300046473 Ga0495582_0013765 Ga0495582_0013765_3543_4016 156
163 3300046473 Ga0495582_0065552 Ga0495582_0065552_1409_1879 156
164 3300046474 Ga0495605_0304549 Ga0495605_0304549_21_491 156
165 3300046476 Ga0495662_0179815 Ga0495662_0179815_394_867 156
166 3300046477 Ga0495664_0000395 Ga0495664_0000395_17850_18323 156
167 3300046492 Ga0495585_0238785 Ga0495585_0238785_77_547 156
168 3300046499 Ga0495594_0010996 Ga0495594_0010996_2917_3387 156
169 3300046500 Ga0495596_0058894 Ga0495596_0058894_591_1061 156
170 3300046501 Ga0495607_0026058 Ga0495607_0026058_571_1041 156
171 3300046506 Ga0495583_0163755 Ga0495583_0163755_289_759 156
172 3300046507 Ga0495606_0017865 Ga0495606_0017865_3835_4305 156
173 3300046512 Ga0495610_0163333 Ga0495610_0163333_43_513 156
174 3300046514 Ga0495618_0016086 Ga0495618_0016086_1261_1734 156
175 3300046515 Ga0495620_0093606 Ga0495620_0093606_147_617 156
176 3300046516 Ga0495628_0018331 Ga0495628_0018331_354_827 156
177 3300046517 Ga0495630_0433145 Ga0495630_0433145_397_870 156
178 3300046519 Ga0495632_0305766 Ga0495632_0305766_32_502 156
179 3300046520 Ga0495637_0220692 Ga0495637_0220692_148_618 156
180 3300046522 Ga0495643_0002536 Ga0495643_0002536_36_506 156
181 3300046530 Ga0495654_0024529 Ga0495654_0024529_593_1063 156
182 3300046531 Ga0495665_0167335 Ga0495665_0167335_656_1129 156
183 3300046533 Ga0495640_0030544 Ga0495640_0030544_1387_1860 156
184 3300046533 Ga0495640_0298218 Ga0495640_0298218_315_785 156
185 3300046535 Ga0495586_0015994 Ga0495586_0015994_648_1121 156
186 3300046536 Ga0495587_0018963 Ga0495587_0018963_3166_3639 156
187 3300046538 Ga0495609_0030814 Ga0495609_0030814_28_498 156
188 3300046543 Ga0495645_0010721 Ga0495645_0010721_5510_5983 156
189 3300046557 Ga0495622_0022868 Ga0495622_0022868_1648_2118 156
190 3300046557 Ga0495622_0108984 Ga0495622_0108984_229_702 156
191 3300046558 Ga0495633_0038535 Ga0495633_0038535_372_842 156
192 3300046559 Ga0495667_0079685 Ga0495667_0079685_280_753 156
193 3300046616 Ga0495668_0015797 Ga0495668_0015797_1489_1959 156
194 3300046616 Ga0495668_0151390 Ga0495668_0151390_31_501 156
195 3300046616 Ga0495668_0207130 Ga0495668_0207130_290_760 156
196 3300046642 Ga0495634_0005020 Ga0495634_0005020_3038_3511 156
197 3300046660 Ga0495625_0041632 Ga0495625_0041632_2077_2547 156
198 3300046660 Ga0495625_0076337 Ga0495625_0076337_1631_2101 156
199 3300046660 Ga0495625_0119899 Ga0495625_0119899_1245_1736 156
200 3300046663 Ga0495635_0013334 Ga0495635_0013334_4532_5005 156
201 3300046665 Ga0495661_0059601 Ga0495661_0059601_253_723 156
202 3300046675 Ga0495657_0001364 Ga0495657_0001364_17893_18366 156
203 3300046680 Ga0495646_0000943 Ga0495646_0000943_9043_9516 156
204 3300046689 Ga0495613_0003375 Ga0495613_0003375_5076_5549 156
205 3300046694 Ga0495649_0013939 Ga0495649_0013939_3117_3587 156
206 3300046794 Ga0495589_0023947 Ga0495589_0023947_805_1275 156
207 3300046794 Ga0495589_0109340 Ga0495589_0109340_74_544 156
208 3300046809 Ga0495600_0009164 Ga0495600_0009164_2447_2920 156
209 3300046810 Ga0495660_0127941 Ga0495660_0127941_661_1131 156
210 3300046810 Ga0495660_0411468 Ga0495660_0411468_73_543 156
211 3300047317 Ga0495604_0001577 Ga0495604_0001577_17561_18034 156
212 3300047317 Ga0495604_0115415 Ga0495604_0115415_657_1130 156
213 3300047318 Ga0495636_0006713 Ga0495636_0006713_94_564 156
214 3300047318 Ga0495636_0108193 Ga0495636_0108193_387_857 156
215 3300047319 Ga0495674_0279830 Ga0495674_0279830_342_815 156
216 3300047321 Ga0495676_0076018 Ga0495676_0076018_628_1098 156
217 3300047322 Ga0495680_0662241 Ga0495680_0662241_25_498 156
218 3300047323 Ga0495683_0109805 Ga0495683_0109805_429_899 156
219 3300047443 Ga0495687_010443 Ga0495687_010443_3028_3498 156
220 3300047443 Ga0495687_116553 Ga0495687_116553_302_772 156
221 3300047444 Ga0495675_0403836 Ga0495675_0403836_92_565 156
222 3300047445 Ga0495677_0059783 Ga0495677_0059783_410_880 156
223 3300047447 Ga0495685_002169 Ga0495685_002169_2676_3146 156
224 3300047447 Ga0495685_006114 Ga0495685_006114_1663_2133 156
225 3300047447 Ga0495685_012363 Ga0495685_012363_48_518 156
226 3300047471 Ga0495684_0535953 Ga0495684_0535953_280_753 156
227 3300047472 Ga0495686_0338757 Ga0495686_0338757_141_611 156
228 3300047673 Ga0495593_0006357 Ga0495593_0006357_1417_1890 156
229 3300048089 Ga0495614_0000978 Ga0495614_0000978_8798_9271 156
230 3300048089 Ga0495614_0314506 Ga0495614_0314506_48_518 156
231 3300048091 Ga0495626_0003841 Ga0495626_0003841_4782_5252 156
232 3300049459 Ga0495678_085800 Ga0495678_085800_313_783 156
233 3300049568 Ga0501031_0585043 Ga0501031_0585043_181_651 156
234 3300049569 Ga0501032_0106793 Ga0501032_0106793_1321_1791 156
235 3300049570 Ga0501033_0084670 Ga0501033_0084670_108_578 156
236 3300049571 Ga0501034_0127440 Ga0501034_0127440_249_719 156
237 3300049571 Ga0501034_0131401 Ga0501034_0131401_1500_1970 156
238 3300049572 Ga0501036_0003329 Ga0501036_0003329_4839_5309 156
239 3300049572 Ga0501036_0040038 Ga0501036_0040038_2609_3079 156
240 3300049574 Ga0501038_0141788 Ga0501038_0141788_673_1143 156
241 3300049574 Ga0501038_0198350 Ga0501038_0198350_289_759 156
242 3300049579 Ga0501043_0063244 Ga0501043_0063244_826_1296 156
243 3300049579 Ga0501043_0151741 Ga0501043_0151741_324_794 156
244 3300049581 Ga0501047_0059117 Ga0501047_0059117_2812_3282 156
245 3300049581 Ga0501047_0080274 Ga0501047_0080274_2189_2659 156
246 3300049585 Ga0501069_0245592 Ga0501069_0245592_107_577 156
247 3300049586 Ga0501070_0387051 Ga0501070_0387051_587_1057 156
248 3300049586 Ga0501070_0560465 Ga0501070_0560465_355_825 156
249 3300049590 Ga0501074_0675525 Ga0501074_0675525_143_613 156
250 3300049742 Ga0501080_0097060 Ga0501080_0097060_1671_2141 156
251 3300049742 Ga0501080_0812729 Ga0501080_0812729_23_493 156
252 3300049744 Ga0501083_0347325 Ga0501083_0347325_372_842 156
253 3300049822 Ga0501035_0188090 Ga0501035_0188090_269_739 156
254 3300049822 Ga0501035_0309094 Ga0501035_0309094_167_637 156
255 3300049823 Ga0501044_0001130 Ga0501044_0001130_27789_28259 156
256 3300049823 Ga0501044_0247615 Ga0501044_0247615_215_685 156
257 3300050490 nmdc:mga03n38_15788_c1 nmdc:mga03n38_15788_c1_561_1031 156
258 3300050494 nmdc:mga06z11_499_c1 nmdc:mga06z11_499_c1_10753_11235 156
259 3300050495 nmdc:mga04h51_289_c1 nmdc:mga04h51_289_c1_11205_11687 156
260 3300053078 Ga0495612_0012163 Ga0495612_0012163_1655_2128 156
261 3300053086 Ga0500578_0068904 Ga0500578_0068904_1431_1901 156
262 3300053088 Ga0500644_0126755 Ga0500644_0126755_41_514 156
263 3300053140 Ga0500573_0224394 Ga0500573_0224394_308_781 156
264 3300053143 Ga0500579_262041 Ga0500579_262041_64_534 156
265 3300053157 Ga0500624_012244 Ga0500624_012244_589_1062 156
266 3300061719 Ga0466962_0011680 Ga0466962_0011680_1868_2338 156
267 3300061719 Ga0466962_0208046 Ga0466962_0208046_68_538 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

46

160

0.88

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

11

140

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

139

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.9105 109 155
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8989 109 156
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.8923 109 156
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8879 109 156
6vfn-assembly1.cif.gz_D crystal structure of speg allosteric polyamine acetyltransferase from bacillus thuringiensis in complex with spermine 0.8547 2 155
ID Description Score Start End Superfamily
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8922 109 156 3.30.572.10
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8597 4 155 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8571 92 155 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8441 108 156 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8394 3 154 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1X4HTH5-F1-model_v4 GNAT family N-acetyltransferase 0.9976 1 125 GO:0016747
AF-A0A101PWL2-F1-model_v4 deleted 0.994 1 156
AF-A0A6I5CGX2-F1-model_v4 GNAT family N-acetyltransferase 0.9932 1 114 GO:0016747
AF-A0A0N0S5E8-F1-model_v4 Acetyltransferase 0.9925 6 156 GO:0016747
AF-A0A4R2EMD0-F1-model_v4 deleted 0.9912 1 156

Feature Viewer

pLDDT pTM Quality
93.85 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map