F375064

General Info

Members Datasets Scaffolds Average Seq Length
267 198 534 372

Family's Representative Sequence

Representative Sequence 3300049519|Ga0501296_001139|Ga0501296_001139_667_1908
Length 413
Sequence MVNILKKSKVANELLVICCLFLKINSELKFSKKMTEYDYLIVGAGLYGTTFAHLASKIGKKCLVIDRRNHIGGNTYCKNEDGINVHFYGAHIFHTNDKPIWDFVNSFTEFNRYTNSPLANYKGKLYNLPFNMNTFYQLWGVITPEEAQKKIDEQIGSLNIKDPQNLEEQALALIGTDIYEKLIKGYTEKQWGRKATELPAFIIKRLPVRFTYDNNYFNDKYQGIPIGGYNMITEKMLQGSDVKLNVDYFADRDYFNSIADKTVYTGALDEYYDYRFGELEYRSLRFDHKHLEISNFQGNAVVNYTEADIPYTRIIEHKHFEFGKQPHTVITYEYPDEWHRGKEQYYPVNDEINTKRFKQYQTLADEEDNILFGGRLAEYRYYDMHQVIASAFVKAKQELGIDFLNRSEKAIIL

Samples

Sample ID Description Type Environment
1 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
143 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
152 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
153 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
154 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
155 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
156 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
166 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
167 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
168 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
169 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
170 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
171 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
172 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
173 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
174 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
175 2739367656 Pedobacter sp. CF523 Isolate Unclassified
176 2739367663 Pedobacter sp. YR510 Isolate Unclassified
177 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
178 2818991444 Filimonas endophytica 3197 Isolate Unclassified
179 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
180 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
181 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
182 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
183 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
184 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
185 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
186 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
187 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
188 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
189 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
190 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
191 2914759650 Rhizosphaericola mali Isolate Rhizosphere
192 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
193 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
194 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
195 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
196 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
197 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
198 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.14
Metatranscriptomes 0
Isolates 13.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.49
Nodule 0.75
Rhizoplane 1.5
Rhizosphere 59.93
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501296_001139 3300049519 Bacteria 2666
2 SwRhRL2b_contig_1199032 2162886007 Bacteria 1385
3 JGI24033J26618_1000028 3300002155 Bacteria 22509
4 JGI24751J29686_10003799 3300002459 Bacteria 3047
5 JGI25154J39366_1000065 3300002738 Bacteria 104126
6 JGI25153J46596_10019523 3300003215 Bacteria 2593
7 JGI25153J46596_10023495 3300003215 Bacteria 2245
8 rootH2_10035902 3300003320 Bacteria 26941
9 rootH2_10083742 3300003320 Unclassified 11880
10 rootH2_10116251 3300003320 Bacteria 2813
11 rootH2_10121170 3300003320 Bacteria 6406
12 rootH2_10175314 3300003320 Bacteria 4411
13 rootL2_10011593 3300003322 Bacteria 2828
14 rootH1_10066215 3300003323 Bacteria 25527
15 JGI25160J50197_1013116 3300003354 Bacteria 2840
16 Ga0055535_1005410 3300003761 Bacteria 2805
17 Ga0055542_1003115 3300003762 Bacteria 4735
18 Ga0055536_1013815 3300003781 Bacteria 2880
19 Ga0055531_10000193 3300003794 Bacteria 67836
20 Ga0058692_1000261 3300003856 Bacteria 28622
21 Ga0058692_1000518 3300003856 Bacteria 16961
22 Ga0065165_1000442 3300005262 Bacteria 65218
23 Ga0065165_1021869 3300005262 Bacteria 2210
24 Ga0065714_10074983 3300005288 Bacteria 2964
25 Ga0065704_10098250 3300005289 Bacteria 2360
26 Ga0065707_10152961 3300005295 Bacteria 1638
27 Ga0070670_100007687 3300005331 Bacteria 9162
28 Ga0070666_10000380 3300005335 Bacteria 27930
29 Ga0070669_100000013 3300005353 Bacteria 210577
30 Ga0070671_100000009 3300005355 Bacteria 206508
31 Ga0070667_100010123 3300005367 Bacteria 7800
32 Ga0070705_100004942 3300005440 Bacteria 6493
33 Ga0068855_100210641 3300005563 Unclassified 2184
34 Ga0068859_100000390 3300005617 Bacteria 43803
35 Ga0068864_100001666 3300005618 Bacteria 18296
36 Ga0068858_100009228 3300005842 Bacteria 9417
37 Ga0068860_100009486 3300005843 Bacteria 9666
38 Ga0068862_100000560 3300005844 Bacteria 38687
39 Ga0075366_10002650 3300006195 Bacteria 9220
40 Ga0097620_100000390 3300006931 Bacteria 43803
41 Ga0079104_1001750 3300006946 Bacteria 13736
42 Ga0105251_10074094 3300009011 Bacteria 1581
43 Ga0105244_10000003 3300009036 Bacteria 494610
44 Ga0105240_10001078 3300009093 Bacteria 48195
45 Ga0105247_10010524 3300009101 Bacteria 5590
46 Ga0105241_10000172 3300009174 Bacteria 47857
47 Ga0105248_10150105 3300009177 Bacteria 2629
48 Ga0105237_10000107 3300009545 Bacteria 117149
49 Ga0105237_10003470 3300009545 Bacteria 18692
50 Ga0105237_10027874 3300009545 Bacteria 5756
51 Ga0105238_10008468 3300009551 Bacteria 10296
52 Ga0105249_10000355 3300009553 Bacteria 45955
53 Ga0105239_10112572 3300010375 Bacteria 3018
54 Ga0105239_10168365 3300010375 Bacteria 2450
55 Ga0157371_10001238 3300013102 Bacteria 27095
56 Ga0157371_10055839 3300013102 Bacteria 2802
57 Ga0157370_10005173 3300013104 Bacteria 14710
58 Ga0157370_10005208 3300013104 Bacteria 14652
59 Ga0157370_10025724 3300013104 Bacteria 5824
60 Ga0157370_10095717 3300013104 Bacteria 2785
61 Ga0157369_10002871 3300013105 Bacteria 20579
62 Ga0157374_10000025 3300013296 Bacteria 245131
63 Ga0163162_10009170 3300013306 Bacteria 9627
64 Ga0157372_10000298 3300013307 Bacteria 55298
65 Ga0157372_10003725 3300013307 Bacteria 16374
66 Ga0157372_10060000 3300013307 Bacteria 4256
67 Ga0182008_10000319 3300014497 Bacteria 37848
68 Ga0157379_10066030 3300014968 Bacteria 3234
69 Ga0157376_10000106 3300014969 Bacteria 60118
70 Ga0182006_1003400 3300015261 Bacteria 8142
71 Ga0182006_1006041 3300015261 Bacteria 5670
72 Ga0182005_1004138 3300015265 Bacteria 4744
73 Ga0163161_10001485 3300017792 Bacteria 17321
74 Ga0163161_10010339 3300017792 Bacteria 6461
75 Ga0209258_100032 3300025242 Bacteria 452764
76 Ga0207425_1010745 3300025245 Bacteria 2214
77 Ga0209646_1000002 3300025246 Bacteria 1425781
78 Ga0209026_1000216 3300025250 Bacteria 79756
79 Ga0209148_1000186 3300025254 Bacteria 117677
80 Ga0209676_1000491 3300025292 Bacteria 63873
81 Ga0209025_1006574 3300025294 Bacteria 8963
82 Ga0209758_1018369 3300025297 Bacteria 3429
83 Ga0207426_1000236 3300025302 Bacteria 125348
84 Ga0209257_1000233 3300025304 Bacteria 129948
85 Ga0207697_10001486 3300025315 Bacteria 12786
86 Ga0207655_1000010 3300025728 Bacteria 649325
87 Ga0207710_10015818 3300025900 Unclassified 3191
88 Ga0207654_10003856 3300025911 Bacteria 7554
89 Ga0207695_10000952 3300025913 Bacteria 51546
90 Ga0207671_10001600 3300025914 Bacteria 25735
91 Ga0207671_10002981 3300025914 Bacteria 17366
92 Ga0207671_10005431 3300025914 Bacteria 11734
93 Ga0207681_10000008 3300025923 Bacteria 414329
94 Ga0207694_10115360 3300025924 Bacteria 2140
95 Ga0207650_10016338 3300025925 Bacteria 5188
96 Ga0207659_10049560 3300025926 Bacteria 2979
97 Ga0207644_10000006 3300025931 Bacteria 408793
98 Ga0207712_10001433 3300025961 Bacteria 16278
99 Ga0207668_10001985 3300025972 Bacteria 11959
100 Ga0207658_10002000 3300025986 Bacteria 15211
101 Ga0207703_10002947 3300026035 Bacteria 14448
102 Ga0207702_10128368 3300026078 Bacteria 2279
103 Ga0207641_10033917 3300026088 Bacteria 4243
104 Ga0207676_10001343 3300026095 Bacteria 18286
105 Ga0207675_100000219 3300026118 Bacteria 53753
106 Ga0209281_1001332 3300027111 Bacteria 15526
107 Ga0209371_1000001 3300027312 Bacteria 2771503
108 Ga0209371_1000778 3300027312 Bacteria 26405
109 Ga0268265_10000171 3300028380 Bacteria 77721
110 Ga0268264_10000221 3300028381 Bacteria 111397
111 Ga0307515_10259783 3300028794 Bacteria 1475
112 Ga0265338_10046637 3300028800 Bacteria 3969
113 Ga0268256_1000001 3300030500 Bacteria 2771065
114 Ga0268256_1000714 3300030500 Bacteria 24660
115 Ga0307408_100000236 3300031548 Bacteria 57955
116 Ga0307412_10016236 3300031911 Bacteria 4431
117 Ga0307414_10075629 3300032004 Bacteria 2444
118 Ga0307414_10183048 3300032004 Bacteria 1687
119 Ga0395899_0000067 3300037312 Bacteria 202348
120 Ga0395899_0000986 3300037312 Bacteria 26237
121 Ga0395899_0001666 3300037312 Bacteria 18521
122 Ga0395900_0189049 3300037418 Bacteria 2090
123 Ga0400483_025497 3300039062 Bacteria 12661
124 Ga0400483_179569 3300039062 Bacteria 12576
125 Ga0451855_0465795 3300041511 Unclassified 1783
126 Ga0451855_0587129 3300041511 Bacteria 1435
127 Ga0451855_0855892 3300041511 Bacteria 2263
128 Ga0451855_0947533 3300041511 Bacteria 2807
129 Ga0451855_1150219 3300041511 Bacteria 1975
130 Ga0451855_1281008 3300041511 Bacteria 1327
131 Ga0451855_1299245 3300041511 Bacteria 2812
132 Ga0451855_1481788 3300041511 Bacteria 5544
133 Ga0451577_0128158 3300042876 Unclassified 2275
134 Ga0466972_0000067 3300044658 Bacteria 102835
135 Ga0466972_0006777 3300044658 Bacteria 5750
136 Ga0453683_0026162 3300044673 Bacteria 3705
137 Ga0466965_0009144 3300044683 Bacteria 4600
138 Ga0466966_0009589 3300044684 Bacteria 6408
139 Ga0466964_0006587 3300044706 Bacteria 4331
140 Ga0453684_0066296 3300044712 Bacteria 4598
141 Ga0466970_0000586 3300044765 Bacteria 17824
142 Ga0451576_0001160 3300045051 Bacteria 47491
143 Ga0451576_0179295 3300045051 Bacteria 2212
144 Ga0495627_000792 3300046453 Bacteria 23123
145 Ga0495629_0001158 3300046459 Bacteria 20831
146 Ga0495651_0123031 3300046462 Bacteria 1903
147 Ga0495650_0003984 3300046471 Bacteria 10374
148 Ga0495580_0011815 3300046472 Bacteria 6738
149 Ga0495582_0029592 3300046473 Bacteria 3006
150 Ga0495664_0015536 3300046477 Bacteria 4329
151 Ga0495610_0000702 3300046512 Bacteria 32041
152 Ga0495643_0009232 3300046522 Bacteria 6149
153 Ga0495597_0039149 3300046542 Bacteria 2124
154 Ga0495645_0005090 3300046543 Bacteria 9009
155 Ga0495661_0000941 3300046665 Bacteria 26481
156 Ga0495613_0050072 3300046689 Bacteria 3082
157 Ga0495589_0013079 3300046794 Bacteria 4286
158 Ga0495581_0017912 3300047315 Bacteria 4116
159 Ga0495687_000731 3300047443 Bacteria 36195
160 Ga0495687_003486 3300047443 Bacteria 11354
161 Ga0495687_077738 3300047443 Bacteria 1309
162 Ga0495681_0076110 3300047470 Bacteria 1509
163 Ga0495686_0000040 3300047472 Bacteria 301210
164 Ga0495614_0033480 3300048089 Bacteria 2211
165 Ga0496101_0110116 3300048904 Bacteria 2072
166 Ga0496114_0012381 3300048917 Bacteria 6826
167 Ga0496115_0250514 3300048918 Bacteria 1458
168 Ga0496116_0000931 3300048919 Bacteria 36023
169 Ga0496116_0013804 3300048919 Bacteria 6487
170 Ga0496116_0017695 3300048919 Bacteria 5522
171 Ga0496117_0000040 3300048920 Bacteria 318616
172 Ga0496117_0000060 3300048920 Bacteria 258500
173 Ga0496117_0000512 3300048920 Bacteria 64211
174 Ga0496118_0029472 3300048921 Bacteria 4601
175 Ga0496119_0003791 3300048922 Bacteria 15458
176 Ga0496119_0018703 3300048922 Bacteria 5139
177 Ga0496119_0113217 3300048922 Bacteria 1502
178 Ga0496120_0000003 3300048923 Bacteria 538703
179 Ga0496120_0001904 3300048923 Bacteria 23098
180 Ga0496120_0007641 3300048923 Bacteria 8010
181 Ga0496120_0008599 3300048923 Bacteria 7376
182 Ga0496120_0012549 3300048923 Bacteria 5761
183 Ga0496122_0000006 3300048925 Bacteria 625811
184 Ga0496122_0003119 3300048925 Bacteria 22206
185 Ga0496122_0044383 3300048925 Bacteria 3470
186 Ga0496123_0001346 3300048926 Bacteria 34633
187 Ga0496123_0002550 3300048926 Bacteria 22205
188 Ga0496123_0004381 3300048926 Bacteria 14893
189 Ga0496124_0000873 3300048927 Bacteria 49224
190 Ga0496124_0007521 3300048927 Bacteria 11564
191 Ga0496124_0092402 3300048927 Bacteria 2465
192 Ga0496125_0000133 3300048928 Bacteria 161487
193 Ga0496125_0001318 3300048928 Bacteria 36700
194 Ga0496125_0005821 3300048928 Bacteria 13544
195 Ga0496126_0000016 3300048929 Bacteria 625843
196 Ga0496126_0001445 3300048929 Bacteria 37246
197 Ga0496126_0038821 3300048929 Bacteria 4426
198 Ga0496126_0044410 3300048929 Bacteria 4092
199 Ga0501034_0212718 3300049571 Unclassified 1888
200 Ga0501199_001228 3300049650 Bacteria 2306
201 Ga0501207_002206 3300049654 Bacteria 2502
202 Ga0501217_000732 3300049661 Bacteria 5675
203 Ga0501217_002135 3300049661 Bacteria 3839
204 Ga0501223_000417 3300049663 Bacteria 10327
205 Ga0501224_006003 3300049664 Bacteria 1755
206 Ga0501233_004541 3300049668 Bacteria 2549
207 Ga0501233_005753 3300049668 Bacteria 2306
208 Ga0501235_000607 3300049669 Bacteria 7220
209 Ga0501235_024553 3300049669 Bacteria 1346
210 Ga0501243_000309 3300049675 Bacteria 6287
211 Ga0501249_012511 3300049679 Bacteria 1794
212 Ga0501249_023215 3300049679 Bacteria 1361
213 Ga0501251_001755 3300049681 Bacteria 2040
214 Ga0501259_000337 3300049688 Bacteria 7391
215 Ga0501259_002718 3300049688 Bacteria 2847
216 Ga0501234_015787 3300049707 Bacteria 1189
217 Ga0501245_001061 3300049708 Bacteria 3542
218 Ga0501241_000132 3300049758 Bacteria 16459
219 Ga0501268_002093 3300049765 Bacteria 2586
220 Ga0501044_0010686 3300049823 Bacteria 9960
221 nmdc:mga0k408_8308_c1 3300050493 Bacteria 5569
222 Ga0500646_0025845 3300053090 Bacteria 1588
223 Ga0500566_0009262 3300053094 Bacteria 5825
224 Ga0500641_0000006 3300053096 Bacteria 223991
225 Ga0500641_0000323 3300053096 Bacteria 17681
226 Ga0500562_000005 3300053108 Bacteria 266746
227 Ga0500568_0025175 3300053139 Unclassified 2514
228 Ga0500622_0001626 3300053156 Bacteria 17632
229 Ga0500624_000581 3300053157 Bacteria 10091
230 Ga0500661_009684 3300055283 Bacteria 1761
231 2522552690 2522125168 Bacteria 7376607
232 2571530084 2571042143 Bacteria 6986194
233 2586206731 2585427687 Bacteria 5544917
234 2601446352 2600255229 Bacteria 1988965
235 2644370086 2643221667 Bacteria 5627472
236 2644371164 2643221667 Bacteria 5627472
237 2644371182 2643221667 Bacteria 5627472
238 2671101319 2667528172 Bacteria 5170840
239 2712199050 2711768088 Bacteria 3195027
240 2728531451 2728368933 Bacteria 7044283
241 2739617298 2739367656 Bacteria 5152243
242 2739647766 2739367663 Bacteria 5040914
243 2793184137 2791355222 Bacteria 5898266
244 2793185572 2791355222 Bacteria 5898266
245 2819589738 2818991444 Bacteria 6968812
246 2819676541 2818991460 Bacteria 7595395
247 2834641348 2834641062 Bacteria 5559922
248 2856291370 2856287931 Bacteria 7223934
249 2857360002 2857357740 Bacteria 9937880
250 2857619773 2857618242 Bacteria 5635925
251 2857628637 2857627736 Bacteria 5625397
252 2858440492 2858438669 Bacteria 2058402
253 2881636115 2881633906 Bacteria 2972201
254 2881636518 2881633906 Bacteria 2972201
255 2881640336 2881636855 Bacteria 5205297
256 2884636762 2884634485 Bacteria 3928637
257 2904445641 2904445276 Bacteria 5310396
258 2904496389 2904490793 Bacteria 7046938
259 2914762105 2914759650 Bacteria 4701441
260 2928520110 2928519762 Bacteria 1953908
261 2929159906 2929154850 Bacteria 6753285
262 2939616691 2939615513 Bacteria 2384962
263 2939616795 2939615513 Bacteria 2384962
264 2977255234 2977254563 Bacteria 4828420
265 8007373947 8007371054 Bacteria 4849201
266 8055696698 8055693939 Bacteria 4772047
267 8057476529 8057473075 Bacteria 5892720
268 Ga0501296_001139
269 SwRhRL2b_contig_1199032
270 JGI24033J26618_1000028
271 JGI24751J29686_10003799
272 JGI25154J39366_1000065
273 JGI25153J46596_10019523
274 JGI25153J46596_10023495
275 rootH2_10035902
276 rootH2_10083742
277 rootH2_10116251
278 rootH2_10121170
279 rootH2_10175314
280 rootL2_10011593
281 rootH1_10066215
282 JGI25160J50197_1013116
283 Ga0055535_1005410
284 Ga0055542_1003115
285 Ga0055536_1013815
286 Ga0055531_10000193
287 Ga0058692_1000261
288 Ga0058692_1000518
289 Ga0065165_1000442
290 Ga0065165_1021869
291 Ga0065714_10074983
292 Ga0065704_10098250
293 Ga0065707_10152961
294 Ga0070670_100007687
295 Ga0070666_10000380
296 Ga0070669_100000013
297 Ga0070671_100000009
298 Ga0070667_100010123
299 Ga0070705_100004942
300 Ga0068855_100210641
301 Ga0068859_100000390
302 Ga0068864_100001666
303 Ga0068858_100009228
304 Ga0068860_100009486
305 Ga0068862_100000560
306 Ga0075366_10002650
307 Ga0097620_100000390
308 Ga0079104_1001750
309 Ga0105251_10074094
310 Ga0105244_10000003
311 Ga0105240_10001078
312 Ga0105247_10010524
313 Ga0105241_10000172
314 Ga0105248_10150105
315 Ga0105237_10000107
316 Ga0105237_10003470
317 Ga0105237_10027874
318 Ga0105238_10008468
319 Ga0105249_10000355
320 Ga0105239_10112572
321 Ga0105239_10168365
322 Ga0157371_10001238
323 Ga0157371_10055839
324 Ga0157370_10005173
325 Ga0157370_10005208
326 Ga0157370_10025724
327 Ga0157370_10095717
328 Ga0157369_10002871
329 Ga0157374_10000025
330 Ga0163162_10009170
331 Ga0157372_10000298
332 Ga0157372_10003725
333 Ga0157372_10060000
334 Ga0182008_10000319
335 Ga0157379_10066030
336 Ga0157376_10000106
337 Ga0182006_1003400
338 Ga0182006_1006041
339 Ga0182005_1004138
340 Ga0163161_10001485
341 Ga0163161_10010339
342 Ga0209258_100032
343 Ga0207425_1010745
344 Ga0209646_1000002
345 Ga0209026_1000216
346 Ga0209148_1000186
347 Ga0209676_1000491
348 Ga0209025_1006574
349 Ga0209758_1018369
350 Ga0207426_1000236
351 Ga0209257_1000233
352 Ga0207697_10001486
353 Ga0207655_1000010
354 Ga0207710_10015818
355 Ga0207654_10003856
356 Ga0207695_10000952
357 Ga0207671_10001600
358 Ga0207671_10002981
359 Ga0207671_10005431
360 Ga0207681_10000008
361 Ga0207694_10115360
362 Ga0207650_10016338
363 Ga0207659_10049560
364 Ga0207644_10000006
365 Ga0207712_10001433
366 Ga0207668_10001985
367 Ga0207658_10002000
368 Ga0207703_10002947
369 Ga0207702_10128368
370 Ga0207641_10033917
371 Ga0207676_10001343
372 Ga0207675_100000219
373 Ga0209281_1001332
374 Ga0209371_1000001
375 Ga0209371_1000778
376 Ga0268265_10000171
377 Ga0268264_10000221
378 Ga0307515_10259783
379 Ga0265338_10046637
380 Ga0268256_1000001
381 Ga0268256_1000714
382 Ga0307408_100000236
383 Ga0307412_10016236
384 Ga0307414_10075629
385 Ga0307414_10183048
386 Ga0395899_0000067
387 Ga0395899_0000986
388 Ga0395899_0001666
389 Ga0395900_0189049
390 Ga0400483_025497
391 Ga0400483_179569
392 Ga0451855_0465795
393 Ga0451855_0587129
394 Ga0451855_0855892
395 Ga0451855_0947533
396 Ga0451855_1150219
397 Ga0451855_1281008
398 Ga0451855_1299245
399 Ga0451855_1481788
400 Ga0451577_0128158
401 Ga0466972_0000067
402 Ga0466972_0006777
403 Ga0453683_0026162
404 Ga0466965_0009144
405 Ga0466966_0009589
406 Ga0466964_0006587
407 Ga0453684_0066296
408 Ga0466970_0000586
409 Ga0451576_0001160
410 Ga0451576_0179295
411 Ga0495627_000792
412 Ga0495629_0001158
413 Ga0495651_0123031
414 Ga0495650_0003984
415 Ga0495580_0011815
416 Ga0495582_0029592
417 Ga0495664_0015536
418 Ga0495610_0000702
419 Ga0495643_0009232
420 Ga0495597_0039149
421 Ga0495645_0005090
422 Ga0495661_0000941
423 Ga0495613_0050072
424 Ga0495589_0013079
425 Ga0495581_0017912
426 Ga0495687_000731
427 Ga0495687_003486
428 Ga0495687_077738
429 Ga0495681_0076110
430 Ga0495686_0000040
431 Ga0495614_0033480
432 Ga0496101_0110116
433 Ga0496114_0012381
434 Ga0496115_0250514
435 Ga0496116_0000931
436 Ga0496116_0013804
437 Ga0496116_0017695
438 Ga0496117_0000040
439 Ga0496117_0000060
440 Ga0496117_0000512
441 Ga0496118_0029472
442 Ga0496119_0003791
443 Ga0496119_0018703
444 Ga0496119_0113217
445 Ga0496120_0000003
446 Ga0496120_0001904
447 Ga0496120_0007641
448 Ga0496120_0008599
449 Ga0496120_0012549
450 Ga0496122_0000006
451 Ga0496122_0003119
452 Ga0496122_0044383
453 Ga0496123_0001346
454 Ga0496123_0002550
455 Ga0496123_0004381
456 Ga0496124_0000873
457 Ga0496124_0007521
458 Ga0496124_0092402
459 Ga0496125_0000133
460 Ga0496125_0001318
461 Ga0496125_0005821
462 Ga0496126_0000016
463 Ga0496126_0001445
464 Ga0496126_0038821
465 Ga0496126_0044410
466 Ga0501034_0212718
467 Ga0501199_001228
468 Ga0501207_002206
469 Ga0501217_000732
470 Ga0501217_002135
471 Ga0501223_000417
472 Ga0501224_006003
473 Ga0501233_004541
474 Ga0501233_005753
475 Ga0501235_000607
476 Ga0501235_024553
477 Ga0501243_000309
478 Ga0501249_012511
479 Ga0501249_023215
480 Ga0501251_001755
481 Ga0501259_000337
482 Ga0501259_002718
483 Ga0501234_015787
484 Ga0501245_001061
485 Ga0501241_000132
486 Ga0501268_002093
487 Ga0501044_0010686
488 nmdc:mga0k408_8308_c1
489 Ga0500646_0025845
490 Ga0500566_0009262
491 Ga0500641_0000006
492 Ga0500641_0000323
493 Ga0500562_000005
494 Ga0500568_0025175
495 Ga0500622_0001626
496 Ga0500624_000581
497 Ga0500661_009684
498 2522552690
499 2571530084
500 2586206731
501 2601446352
502 2644370086
503 2644371164
504 2644371182
505 2671101319
506 2712199050
507 2728531451
508 2739617298
509 2739647766
510 2793184137
511 2793185572
512 2819589738
513 2819676541
514 2834641348
515 2856291370
516 2857360002
517 2857619773
518 2857628637
519 2858440492
520 2881636115
521 2881636518
522 2881640336
523 2884636762
524 2904445641
525 2904496389
526 2914762105
527 2928520110
528 2929159906
529 2939616691
530 2939616795
531 2977255234
532 8007373947
533 8055696698
534 8057476529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03275

GLF

UDP-galactopyranose mutase

181

381

0.99

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

41

107

0.96

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

52

247

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9893 1 367
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9867 1 367
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.9864 1 363
6l6j-assembly1.cif.gz_A structure of 6-hydroxypseudooxynicotine (6-hpon) amine oxidase (hisd) from pseudomonas geniculata n1 0.9759 4 40
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.9731 1 363
ID Description Score Start End Superfamily
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9841 5 40 3.40.50.720
2yg4A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.983 2 38 3.50.50.60
af_A0A1D6EP38_13_160_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9821 4 36 3.50.50.60
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 4 38 3.50.50.60
af_P9WHH5_150_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9799 4 36 3.50.50.60
ID Description Score Start End GO Terms
AF-Q4JYG5-F1-model_v4 UDP-galactopyranose mutase Glf (EC 5.4.99.9) 0.9953 233 363 GO:0005829
GO:0008767
GO:0050660
AF-A0A7X2Y2H0-F1-model_v4 deleted 0.9946 202 357
AF-A0A3D0M1Q9-F1-model_v4 UDP-galactopyranose mutase 0.9942 2 295 GO:0005829
GO:0008767
GO:0050660
AF-A0A822Q3Y8-F1-model_v4 deleted 0.994 1 112
AF-E2NWJ3-F1-model_v4 deleted 0.9938 24 354

Map