F375103

General Info

Members Datasets Scaffolds Average Seq Length
267 208 532 81

Family's Representative Sequence

Representative Sequence 3300049653|Ga0501206_038395|Ga0501206_038395_400_660
Length 86
Sequence MAEDLKDAAARDGSKDRPTARKSSLVQTFKAVAWSFFGIRRSKDYANDVEKLNPVHVVIAGIVGALIFIGCLVLLVRWVVGSGVAS

Samples

Sample ID Description Type Environment
1 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
67 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
93 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
94 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
97 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
98 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
99 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
100 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
101 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
102 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
105 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
137 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
138 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
139 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
140 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
141 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
151 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
152 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
153 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
154 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
155 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
156 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
159 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
162 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
165 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
168 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
169 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
172 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
173 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
174 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
175 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
176 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
177 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
178 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
179 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
180 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
181 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
182 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
183 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2643221585 Pelomonas sp. Root662 Isolate Unclassified
203 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
204 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
205 2643221656 Pelomonas sp. Root405 Isolate Unclassified
206 2738541337 Pelomonas sp. BT06 Isolate Unclassified
207 2831864461 Roseateles noduli HZ7 Isolate Nodule
208 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 1.12
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.22
Nodule 1.12
Rhizoplane 1.12
Rhizosphere 64.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501206_038395 3300049653 Bacteria 732
2 JGI24740J21852_10003715 3300001979 Bacteria 6644
3 JGI25152J39213_1000752 3300002773 Bacteria 16498
4 JGI25150J39212_1004196 3300002774 Bacteria 3243
5 JGI25153J46596_10014796 3300003215 Bacteria 3221
6 rootH1_10017790 3300003316 Bacteria 2103
7 rootH2_10043945 3300003320 Bacteria 1749
8 rootL2_10000579 3300003322 Bacteria 16628
9 rootL2_10000580 3300003322 Bacteria 1644
10 rootH1_10016701 3300003323 Bacteria 1920
11 rootH1_10044409 3300003323 Bacteria 1519
12 rootH1_10125484 3300003323 Bacteria 1382
13 Ga0055526_1007400 3300003771 Bacteria 5717
14 Ga0055526_1009134 3300003771 Bacteria 4823
15 Ga0055524_1000733 3300003775 Bacteria 22506
16 Ga0055524_1005494 3300003775 Bacteria 5643
17 Ga0055540_1030319 3300003792 Bacteria 1257
18 Ga0055531_10000043 3300003794 Bacteria 133906
19 Ga0055531_10007153 3300003794 Bacteria 6154
20 Ga0055531_10021663 3300003794 Bacteria 2482
21 Ga0065165_1000016 3300005262 Bacteria 286248
22 Ga0070668_100468775 3300005347 Bacteria 1086
23 Ga0070708_100110016 3300005445 Bacteria 2531
24 Ga0070678_101985509 3300005456 Bacteria 550
25 Ga0070684_100462434 3300005535 Bacteria 1173
26 Ga0068855_100123577 3300005563 Bacteria 2961
27 Ga0068857_100698488 3300005577 Bacteria 964
28 Ga0068857_101277561 3300005577 Bacteria 712
29 Ga0068856_100449837 3300005614 Bacteria 1309
30 Ga0068852_100128943 3300005616 Bacteria 2327
31 Ga0068859_101486156 3300005617 Bacteria 748
32 Ga0068862_100031437 3300005844 Bacteria 4481
33 Ga0075363_100010995 3300006048 Bacteria 4320
34 Ga0075364_10132666 3300006051 Bacteria 1672
35 Ga0075362_10031183 3300006177 Bacteria 2306
36 Ga0075367_10064695 3300006178 Bacteria 2188
37 Ga0075369_10019440 3300006186 Bacteria 2773
38 Ga0075366_10014699 3300006195 Bacteria 4474
39 Ga0075366_10039564 3300006195 Bacteria 2787
40 Ga0075366_10063663 3300006195 Bacteria 2192
41 Ga0075366_10102003 3300006195 Bacteria 1722
42 Ga0075366_10314733 3300006195 Bacteria 958
43 Ga0097621_101655439 3300006237 Bacteria 609
44 Ga0075370_10000954 3300006353 Bacteria 11903
45 Ga0075370_10096275 3300006353 Bacteria 1710
46 Ga0075370_10207573 3300006353 Bacteria 1156
47 Ga0075428_101324095 3300006844 Bacteria 757
48 Ga0068865_101116613 3300006881 Bacteria 695
49 Ga0097620_101486051 3300006931 Bacteria 748
50 Ga0099823_1000101 3300006944 Bacteria 41834
51 Ga0111539_10396325 3300009094 Bacteria 1608
52 Ga0105245_11073088 3300009098 Bacteria 851
53 Ga0105243_10318964 3300009148 Bacteria 1415
54 Ga0105248_11560771 3300009177 Bacteria 748
55 Ga0157317_1000388 3300012475 Bacteria 1808
56 Ga0157378_13074269 3300013297 Bacteria 518
57 Ga0157372_12775467 3300013307 Bacteria 562
58 Ga0157375_10159070 3300013308 Bacteria 2400
59 Ga0163163_11640227 3300014325 Bacteria 704
60 Ga0209258_119930 3300025242 Bacteria 707
61 Ga0207425_1003440 3300025245 Bacteria 5070
62 Ga0209129_1000062 3300025258 Bacteria 240655
63 Ga0209673_1013829 3300025273 Bacteria 3163
64 Ga0209673_1028406 3300025273 Bacteria 1801
65 Ga0209673_1063031 3300025273 Bacteria 916
66 Ga0209673_1071764 3300025273 Bacteria 822
67 Ga0209564_1000008 3300025295 Bacteria 953227
68 Ga0209564_1000176 3300025295 Bacteria 152363
69 Ga0209758_1000129 3300025297 Bacteria 185022
70 Ga0209758_1161485 3300025297 Bacteria 556
71 Ga0209050_1006476 3300025298 Bacteria 6915
72 Ga0209050_1010700 3300025298 Bacteria 4477
73 Ga0209256_1005979 3300025299 Bacteria 6687
74 Ga0209256_1008383 3300025299 Bacteria 4810
75 Ga0209256_1032560 3300025299 Bacteria 1412
76 Ga0209051_1002891 3300025303 Bacteria 11797
77 Ga0209051_1004957 3300025303 Bacteria 7956
78 Ga0209051_1056255 3300025303 Bacteria 1270
79 Ga0209257_1000182 3300025304 Bacteria 156672
80 Ga0209257_1002253 3300025304 Bacteria 19751
81 Ga0209257_1003886 3300025304 Bacteria 12194
82 Ga0209257_1070736 3300025304 Bacteria 920
83 Ga0207705_10758747 3300025909 Bacteria 754
84 Ga0207709_10196224 3300025935 Bacteria 1438
85 Ga0207711_10942738 3300025941 Bacteria 802
86 Ga0207712_10518317 3300025961 Bacteria 1021
87 Ga0207658_10000968 3300025986 Bacteria 23705
88 Ga0207702_11839634 3300026078 Bacteria 597
89 Ga0207674_10137753 3300026116 Bacteria 2402
90 Ga0207683_11273776 3300026121 Bacteria 681
91 Ga0207698_10108356 3300026142 Bacteria 2322
92 Ga0207698_12468615 3300026142 Bacteria 530
93 Ga0209973_1005543 3300027252 Bacteria 1347
94 Ga0209389_1001650 3300027296 Bacteria 16043
95 Ga0209371_1005027 3300027312 Bacteria 5450
96 Ga0210002_1039806 3300027617 Bacteria 797
97 Ga0209813_10046238 3300027866 Bacteria 1344
98 Ga0268265_10062205 3300028380 Bacteria 2867
99 Ga0307515_10064108 3300028794 Bacteria 5143
100 Ga0268256_1004264 3300030500 Bacteria 6002
101 Ga0265327_10143146 3300031251 Bacteria 1116
102 Ga0307513_10218198 3300031456 Bacteria 1731
103 Ga0307408_100000023 3300031548 Bacteria 295931
104 Ga0307408_100038396 3300031548 Bacteria 3379
105 Ga0307408_100272287 3300031548 Bacteria 1406
106 Ga0307408_100791379 3300031548 Bacteria 860
107 Ga0307408_101531504 3300031548 Bacteria 631
108 Ga0307508_10253381 3300031616 Bacteria 1356
109 Ga0307413_10810079 3300031824 Bacteria 788
110 Ga0307406_10819367 3300031901 Bacteria 787
111 Ga0307412_10198827 3300031911 Bacteria 1521
112 Ga0307412_10530506 3300031911 Bacteria 985
113 Ga0307416_100614945 3300032002 Bacteria 1168
114 Ga0307416_102337270 3300032002 Bacteria 635
115 Ga0307414_10055368 3300032004 Bacteria 2777
116 Ga0307414_10999680 3300032004 Bacteria 770
117 Ga0307411_10042706 3300032005 Bacteria 2895
118 Ga0307415_101829730 3300032126 Bacteria 588
119 Ga0373959_0173741 3300034820 Bacteria 556
120 Ga0373939_0000820 3300035114 Bacteria 7682
121 Ga0373960_0000664 3300035121 Bacteria 7081
122 Ga0373961_0162419 3300035241 Bacteria 768
123 Ga0373931_0000400 3300035691 Bacteria 17756
124 Ga0395905_0000071 3300037471 Bacteria 174580
125 Ga0395905_0105304 3300037471 Bacteria 2648
126 Ga0395905_0249522 3300037471 Bacteria 1658
127 Ga0451849_0785915 3300041505 Bacteria 847
128 Ga0439431_0089432 3300041997 Bacteria 838
129 Ga0439437_001189 3300042000 Bacteria 2726
130 Ga0439443_065657 3300042003 Bacteria 655
131 Ga0450912_002130 3300042116 Bacteria 1299
132 Ga0450920_047346 3300042122 Bacteria 860
133 Ga0450888_002724 3300042126 Bacteria 1755
134 Ga0450890_002129 3300042127 Bacteria 2768
135 Ga0450890_004502 3300042127 Bacteria 1820
136 Ga0450890_028243 3300042127 Bacteria 789
137 Ga0450891_000338 3300042129 Bacteria 4819
138 Ga0450898_107585 3300042134 Bacteria 587
139 Ga0450904_014733 3300042139 Bacteria 781
140 Ga0450889_001387 3300042144 Bacteria 2494
141 Ga0450909_018063 3300042185 Bacteria 1047
142 Ga0439434_0254501 3300042435 Bacteria 601
143 Ga0439459_0001722 3300042438 Bacteria 3270
144 Ga0439459_0016514 3300042438 Bacteria 1365
145 Ga0450893_0003596 3300042532 Bacteria 2443
146 Ga0451577_0457876 3300042876 Bacteria 1158
147 Ga0451577_1632007 3300042876 Bacteria 568
148 Ga0453683_0571464 3300044673 Bacteria 736
149 Ga0466965_0126294 3300044683 Bacteria 1323
150 Ga0466966_0064148 3300044684 Bacteria 2313
151 Ga0466961_0014966 3300044693 Bacteria 4980
152 Ga0466963_0014398 3300044694 Bacteria 4876
153 Ga0453684_0134527 3300044712 Bacteria 2962
154 Ga0453684_0347160 3300044712 Bacteria 1674
155 Ga0453684_0504607 3300044712 Bacteria 1339
156 Ga0466971_0012513 3300044719 Bacteria 3720
157 Ga0466970_0031867 3300044765 Bacteria 2784
158 Ga0466960_0370946 3300044901 Bacteria 820
159 Ga0466959_0000491 3300045049 Bacteria 23088
160 Ga0451576_0006110 3300045051 Bacteria 14839
161 Ga0451576_0167234 3300045051 Bacteria 2295
162 Ga0451576_0204431 3300045051 Bacteria 2062
163 Ga0466958_0003695 3300045836 Bacteria 7992
164 Ga0466967_0034904 3300045976 Bacteria 4274
165 Ga0495605_0162870 3300046474 Bacteria 989
166 Ga0495583_0058798 3300046506 Bacteria 1725
167 Ga0495632_0008136 3300046519 Bacteria 6484
168 Ga0495642_0090246 3300046528 Bacteria 1297
169 Ga0495654_0121492 3300046530 Bacteria 1182
170 Ga0495658_0873093 3300046683 Bacteria 575
171 Ga0495670_0047547 3300046691 Bacteria 2145
172 Ga0495649_0002161 3300046694 Bacteria 14071
173 Ga0495660_0098376 3300046810 Bacteria 1509
174 Ga0495687_001027 3300047443 Bacteria 27802
175 Ga0495687_012737 3300047443 Bacteria 4430
176 Ga0495679_073335 3300047446 Bacteria 982
177 Ga0495626_0196966 3300048091 Bacteria 828
178 Ga0496109_0612110 3300048912 Bacteria 1026
179 Ga0496113_0386007 3300048916 Bacteria 1124
180 Ga0496113_0916153 3300048916 Bacteria 693
181 Ga0496124_0125855 3300048927 Bacteria 2042
182 Ga0496126_1032627 3300048929 Bacteria 615
183 Ga0501291_019288 3300049514 Bacteria 1069
184 Ga0501293_044772 3300049516 Bacteria 513
185 Ga0501294_004503 3300049517 Bacteria 1309
186 Ga0501298_098335 3300049521 Bacteria 664
187 Ga0501300_002873 3300049523 Bacteria 2572
188 Ga0501314_002786 3300049530 Bacteria 1374
189 Ga0501318_019624 3300049534 Bacteria 845
190 Ga0501340_006083 3300049556 Bacteria 802
191 Ga0501039_0784950 3300049575 Bacteria 743
192 Ga0501071_0523602 3300049587 Bacteria 910
193 Ga0501076_1440753 3300049592 Bacteria 566
194 Ga0501199_001603 3300049650 Bacteria 2065
195 Ga0501201_002378 3300049651 Bacteria 1723
196 Ga0501202_013660 3300049652 Bacteria 1547
197 Ga0501207_007227 3300049654 Bacteria 1580
198 Ga0501208_140340 3300049655 Bacteria 544
199 Ga0501210_000133 3300049657 Bacteria 2804
200 Ga0501211_003444 3300049658 Bacteria 1630
201 Ga0501216_010532 3300049660 Bacteria 1489
202 Ga0501217_023421 3300049661 Bacteria 1471
203 Ga0501222_021184 3300049662 Bacteria 871
204 Ga0501223_005971 3300049663 Bacteria 2534
205 Ga0501223_019207 3300049663 Bacteria 1343
206 Ga0501227_013649 3300049665 Bacteria 1792
207 Ga0501233_005538 3300049668 Bacteria 2345
208 Ga0501235_002255 3300049669 Bacteria 4149
209 Ga0501242_005876 3300049674 Bacteria 1391
210 Ga0501246_041562 3300049676 Bacteria 551
211 Ga0501249_004638 3300049679 Bacteria 2793
212 Ga0501253_002917 3300049683 Bacteria 1988
213 Ga0501255_005805 3300049684 Bacteria 1248
214 Ga0501257_081304 3300049686 Bacteria 835
215 Ga0501258_002136 3300049687 Bacteria 1704
216 Ga0501261_007192 3300049690 Bacteria 1426
217 Ga0501221_002548 3300049704 Bacteria 3003
218 Ga0501225_0015995 3300049705 Bacteria 2085
219 Ga0501229_000314 3300049706 Bacteria 5488
220 Ga0501234_007203 3300049707 Bacteria 1742
221 Ga0501232_000876 3300049757 Bacteria 2210
222 Ga0501262_002302 3300049759 Bacteria 2158
223 Ga0501262_030551 3300049759 Bacteria 774
224 Ga0501265_008532 3300049762 Bacteria 1223
225 Ga0501267_000521 3300049764 Bacteria 3015
226 Ga0501268_022716 3300049765 Bacteria 1085
227 Ga0501269_001955 3300049766 Bacteria 2603
228 Ga0501271_006399 3300049768 Bacteria 1168
229 Ga0501272_012231 3300049769 Bacteria 973
230 Ga0501274_000923 3300049771 Bacteria 2183
231 Ga0501278_015639 3300049774 Bacteria 655
232 Ga0501280_030227 3300049776 Bacteria 843
233 Ga0501035_0158828 3300049822 Bacteria 1958
234 Ga0501045_0707697 3300049824 Bacteria 743
235 Ga0501226_002953 3300049853 Bacteria 2043
236 nmdc:mga03683_9751_c1 3300050489 Bacteria 2301
237 nmdc:mga03n38_192775_c1 3300050490 Bacteria 1051
238 nmdc:mga0k408_175268_c1 3300050493 Bacteria 1278
239 nmdc:mga0k408_191030_c1 3300050493 Bacteria 1222
240 nmdc:mga0k408_225184_c1 3300050493 Bacteria 1120
241 nmdc:mga0k408_435728_c1 3300050493 Bacteria 779
242 nmdc:mga0k408_43752_c1 3300050493 Bacteria 2582
243 nmdc:mga0k408_565_c1 3300050493 Bacteria 20434
244 nmdc:mga0k408_96999_c1 3300050493 Bacteria 1736
245 nmdc:mga06z11_26746_c1 3300050494 Bacteria 2750
246 nmdc:mga04h51_112404_c1 3300050495 Bacteria 1006
247 nmdc:mga07m45_35365_c1 3300050496 Bacteria 2778
248 nmdc:mga07m45_412621_c1 3300050496 Bacteria 784
249 nmdc:mga07m45_600228_c1 3300050496 Bacteria 636
250 nmdc:mga07m45_9342_c1 3300050496 Bacteria 5083
251 nmdc:mga05p37_389871_c1 3300050507 Bacteria 1629
252 nmdc:mga08y16_1442631_c1 3300050511 Bacteria 650
253 nmdc:mga0sz30_33107_c1 3300050516 Bacteria 2147
254 Ga0500578_0288721 3300053086 Bacteria 976
255 Ga0500593_004453 3300053117 Bacteria 5424
256 Ga0500568_0043971 3300053139 Bacteria 1783
257 Ga0500622_0035639 3300053156 Bacteria 2603
258 Ga0590071_038969 3300059421 Bacteria 1142
259 Ga0466962_0022328 3300061719 Bacteria 3040
260 2643933031 2643221585 Bacteria 5812563
261 2644217173 2643221639 Bacteria 6649903
262 2644259054 2643221646 Bacteria 6433402
263 2644314280 2643221656 Bacteria 5809961
264 2739055798 2738541337 Bacteria 6183410
265 2831869389 2831864461 Bacteria 6502356
266 2886849889 2886848708 Bacteria 5632523
267 Ga0501206_038395
268 JGI24740J21852_10003715
269 JGI25152J39213_1000752
270 JGI25150J39212_1004196
271 JGI25153J46596_10014796
272 rootH1_10017790
273 rootH2_10043945
274 rootL2_10000579
275 rootL2_10000580
276 rootH1_10016701
277 rootH1_10044409
278 rootH1_10125484
279 Ga0055526_1007400
280 Ga0055526_1009134
281 Ga0055524_1000733
282 Ga0055524_1005494
283 Ga0055540_1030319
284 Ga0055531_10000043
285 Ga0055531_10007153
286 Ga0055531_10021663
287 Ga0065165_1000016
288 Ga0070668_100468775
289 Ga0070708_100110016
290 Ga0070678_101985509
291 Ga0070684_100462434
292 Ga0068855_100123577
293 Ga0068857_100698488
294 Ga0068857_101277561
295 Ga0068856_100449837
296 Ga0068852_100128943
297 Ga0068859_101486156
298 Ga0068862_100031437
299 Ga0075363_100010995
300 Ga0075364_10132666
301 Ga0075362_10031183
302 Ga0075367_10064695
303 Ga0075369_10019440
304 Ga0075366_10014699
305 Ga0075366_10039564
306 Ga0075366_10063663
307 Ga0075366_10102003
308 Ga0075366_10314733
309 Ga0097621_101655439
310 Ga0075370_10000954
311 Ga0075370_10096275
312 Ga0075370_10207573
313 Ga0075428_101324095
314 Ga0068865_101116613
315 Ga0097620_101486051
316 Ga0099823_1000101
317 Ga0111539_10396325
318 Ga0105245_11073088
319 Ga0105243_10318964
320 Ga0105248_11560771
321 Ga0157317_1000388
322 Ga0157378_13074269
323 Ga0157372_12775467
324 Ga0157375_10159070
325 Ga0163163_11640227
326 Ga0209258_119930
327 Ga0207425_1003440
328 Ga0209129_1000062
329 Ga0209673_1013829
330 Ga0209673_1028406
331 Ga0209673_1063031
332 Ga0209673_1071764
333 Ga0209564_1000008
334 Ga0209564_1000176
335 Ga0209758_1000129
336 Ga0209758_1161485
337 Ga0209050_1006476
338 Ga0209050_1010700
339 Ga0209256_1005979
340 Ga0209256_1008383
341 Ga0209256_1032560
342 Ga0209051_1002891
343 Ga0209051_1004957
344 Ga0209051_1056255
345 Ga0209257_1000182
346 Ga0209257_1002253
347 Ga0209257_1003886
348 Ga0209257_1070736
349 Ga0207705_10758747
350 Ga0207709_10196224
351 Ga0207711_10942738
352 Ga0207712_10518317
353 Ga0207658_10000968
354 Ga0207702_11839634
355 Ga0207674_10137753
356 Ga0207683_11273776
357 Ga0207698_10108356
358 Ga0207698_12468615
359 Ga0209973_1005543
360 Ga0209389_1001650
361 Ga0209371_1005027
362 Ga0210002_1039806
363 Ga0209813_10046238
364 Ga0268265_10062205
365 Ga0307515_10064108
366 Ga0268256_1004264
367 Ga0265327_10143146
368 Ga0307513_10218198
369 Ga0307408_100000023
370 Ga0307408_100038396
371 Ga0307408_100272287
372 Ga0307408_100791379
373 Ga0307408_101531504
374 Ga0307508_10253381
375 Ga0307413_10810079
376 Ga0307406_10819367
377 Ga0307412_10198827
378 Ga0307412_10530506
379 Ga0307416_100614945
380 Ga0307416_102337270
381 Ga0307414_10055368
382 Ga0307414_10999680
383 Ga0307411_10042706
384 Ga0307415_101829730
385 Ga0373959_0173741
386 Ga0373939_0000820
387 Ga0373960_0000664
388 Ga0373961_0162419
389 Ga0373931_0000400
390 Ga0395905_0000071
391 Ga0395905_0105304
392 Ga0395905_0249522
393 Ga0451849_0785915
394 Ga0439431_0089432
395 Ga0439437_001189
396 Ga0439443_065657
397 Ga0450912_002130
398 Ga0450920_047346
399 Ga0450888_002724
400 Ga0450890_002129
401 Ga0450890_004502
402 Ga0450890_028243
403 Ga0450891_000338
404 Ga0450898_107585
405 Ga0450904_014733
406 Ga0450889_001387
407 Ga0450909_018063
408 Ga0439434_0254501
409 Ga0439459_0001722
410 Ga0439459_0016514
411 Ga0450893_0003596
412 Ga0451577_0457876
413 Ga0451577_1632007
414 Ga0453683_0571464
415 Ga0466965_0126294
416 Ga0466966_0064148
417 Ga0466961_0014966
418 Ga0466963_0014398
419 Ga0453684_0134527
420 Ga0453684_0347160
421 Ga0453684_0504607
422 Ga0466971_0012513
423 Ga0466970_0031867
424 Ga0466960_0370946
425 Ga0466959_0000491
426 Ga0451576_0006110
427 Ga0451576_0167234
428 Ga0451576_0204431
429 Ga0466958_0003695
430 Ga0466967_0034904
431 Ga0495605_0162870
432 Ga0495583_0058798
433 Ga0495632_0008136
434 Ga0495642_0090246
435 Ga0495654_0121492
436 Ga0495658_0873093
437 Ga0495670_0047547
438 Ga0495649_0002161
439 Ga0495660_0098376
440 Ga0495687_001027
441 Ga0495687_012737
442 Ga0495679_073335
443 Ga0495626_0196966
444 Ga0496109_0612110
445 Ga0496113_0386007
446 Ga0496113_0916153
447 Ga0496124_0125855
448 Ga0496126_1032627
449 Ga0501291_019288
450 Ga0501293_044772
451 Ga0501294_004503
452 Ga0501298_098335
453 Ga0501300_002873
454 Ga0501314_002786
455 Ga0501318_019624
456 Ga0501340_006083
457 Ga0501039_0784950
458 Ga0501071_0523602
459 Ga0501076_1440753
460 Ga0501199_001603
461 Ga0501201_002378
462 Ga0501202_013660
463 Ga0501207_007227
464 Ga0501208_140340
465 Ga0501210_000133
466 Ga0501211_003444
467 Ga0501216_010532
468 Ga0501217_023421
469 Ga0501222_021184
470 Ga0501223_005971
471 Ga0501223_019207
472 Ga0501227_013649
473 Ga0501233_005538
474 Ga0501235_002255
475 Ga0501242_005876
476 Ga0501246_041562
477 Ga0501249_004638
478 Ga0501253_002917
479 Ga0501255_005805
480 Ga0501257_081304
481 Ga0501258_002136
482 Ga0501261_007192
483 Ga0501221_002548
484 Ga0501225_0015995
485 Ga0501229_000314
486 Ga0501234_007203
487 Ga0501232_000876
488 Ga0501262_002302
489 Ga0501262_030551
490 Ga0501265_008532
491 Ga0501267_000521
492 Ga0501268_022716
493 Ga0501269_001955
494 Ga0501271_006399
495 Ga0501272_012231
496 Ga0501274_000923
497 Ga0501278_015639
498 Ga0501280_030227
499 Ga0501035_0158828
500 Ga0501045_0707697
501 Ga0501226_002953
502 nmdc:mga03683_9751_c1
503 nmdc:mga03n38_192775_c1
504 nmdc:mga0k408_175268_c1
505 nmdc:mga0k408_191030_c1
506 nmdc:mga0k408_225184_c1
507 nmdc:mga0k408_435728_c1
508 nmdc:mga0k408_43752_c1
509 nmdc:mga0k408_565_c1
510 nmdc:mga0k408_96999_c1
511 nmdc:mga06z11_26746_c1
512 nmdc:mga04h51_112404_c1
513 nmdc:mga07m45_35365_c1
514 nmdc:mga07m45_412621_c1
515 nmdc:mga07m45_600228_c1
516 nmdc:mga07m45_9342_c1
517 nmdc:mga05p37_389871_c1
518 nmdc:mga08y16_1442631_c1
519 nmdc:mga0sz30_33107_c1
520 Ga0500578_0288721
521 Ga0500593_004453
522 Ga0500568_0043971
523 Ga0500622_0035639
524 Ga0590071_038969
525 Ga0466962_0022328
526 2643933031
527 2644217173
528 2644259054
529 2644314280
530 2739055798
531 2831869389
532 2886849889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11174

DUF2970

Protein of unknown function (DUF2970)

25

80

0.98

Map