F375110

General Info

Members Datasets Scaffolds Average Seq Length
267 127 534 146

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0212660|Ga0501035_0212660_955_1485
Length 176
Sequence MATGRPVDVNQYRRARPSASCRHPPTPKEPIMFKRLLVPTDGSELSLRAANIAIEMAAALHASVLAVHVVAPFHTISYLGEMLAATELEYTQDAVESAERYLAEVRDMATRAGVPCDTMHALEDQPHEVIVRTATDHQCDLIVMGSHGWRGLNRLLLGSETQKVLLTAKVPVLVCH

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
121 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 2643221629 Devosia sp. Root105 Isolate Unclassified
124 2643221662 Devosia sp. Root413D1 Isolate Unclassified
125 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
126 2928963466 Dyella japonica 1073 Isolate Unclassified
127 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.37
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.97
Nodule 0
Rhizoplane 1.87
Rhizosphere 61.05
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0212660 3300049822 Bacteria 1654
2 JGI24739J22299_10094568 3300001989 Bacteria 907
3 JGI24737J22298_10161982 3300001990 Bacteria 660
4 JGI24735J21928_10006224 3300002067 Bacteria 3942
5 JGI25156J39149_1005911 3300002705 Bacteria 3435
6 JGI25156J39149_1007466 3300002705 Bacteria 2864
7 JGI25162J39368_1000597 3300002737 Bacteria 26205
8 JGI25162J39368_1003640 3300002737 Bacteria 4235
9 JGI25162J39368_1004685 3300002737 Bacteria 3053
10 JGI25154J39366_1012007 3300002738 Bacteria 971
11 JGI25157J39369_1000370 3300002741 Bacteria 30908
12 JGI25157J39369_1001161 3300002741 Bacteria 11328
13 JGI25157J39369_1001724 3300002741 Bacteria 7310
14 JGI25164J39214_1000198 3300002772 Bacteria 51603
15 JGI25164J39214_1000259 3300002772 Bacteria 39804
16 JGI25164J39214_1006681 3300002772 Bacteria 1200
17 JGI25165J46597_1000354 3300003214 Bacteria 51605
18 JGI25165J46597_1000379 3300003214 Bacteria 48698
19 rootL2_10205861 3300003322 Bacteria 3445
20 rootH1_10049970 3300003323 Bacteria 1921
21 rootH1_10382948 3300003323 Archaea 1573
22 Ga0055539_1000300 3300003752 Bacteria 26848
23 Ga0055533_1000167 3300003756 Bacteria 60266
24 Ga0055533_1000290 3300003756 Bacteria 25784
25 Ga0055533_1001291 3300003756 Bacteria 6815
26 Ga0055525_1000266 3300003759 Bacteria 49472
27 Ga0055527_1000044 3300003760 Bacteria 111829
28 Ga0055527_1000047 3300003760 Bacteria 109679
29 Ga0055535_1000040 3300003761 Bacteria 157988
30 Ga0055535_1000109 3300003761 Bacteria 89299
31 Ga0055535_1000295 3300003761 Bacteria 51620
32 Ga0055535_1000991 3300003761 Bacteria 18354
33 Ga0055535_1008754 3300003761 Bacteria 1794
34 Ga0055542_1000065 3300003762 Bacteria 157988
35 Ga0055542_1000108 3300003762 Bacteria 111829
36 Ga0055542_1000292 3300003762 Bacteria 56160
37 Ga0055542_1000524 3300003762 Bacteria 34530
38 Ga0055542_1000966 3300003762 Bacteria 18722
39 Ga0055529_1000049 3300003763 Bacteria 208413
40 Ga0055529_1000094 3300003763 Bacteria 134217
41 Ga0055529_1000406 3300003763 Bacteria 45461
42 Ga0070680_100390403 3300005336 Bacteria 1186
43 Ga0070682_100004557 3300005337 Bacteria 7706
44 Ga0070682_100019519 3300005337 Bacteria 3977
45 Ga0070660_100127074 3300005339 Bacteria 2037
46 Ga0070660_100171553 3300005339 Bacteria 1752
47 Ga0070659_100043600 3300005366 Bacteria 3508
48 Ga0070659_100044900 3300005366 Bacteria 3461
49 Ga0070659_100176798 3300005366 Bacteria 1750
50 Ga0070659_100221851 3300005366 Bacteria 1560
51 Ga0070659_100845685 3300005366 Bacteria 797
52 Ga0070714_100000694 3300005435 Bacteria 23800
53 Ga0070714_100011953 3300005435 Bacteria 6905
54 Ga0070713_100000941 3300005436 Bacteria 18599
55 Ga0070662_100024492 3300005457 Bacteria 4158
56 Ga0070681_10015355 3300005458 Bacteria 7618
57 Ga0070679_100302962 3300005530 Bacteria 1549
58 Ga0070679_100439149 3300005530 Bacteria 1250
59 Ga0070684_100429934 3300005535 Bacteria 1219
60 Ga0068853_100072740 3300005539 Bacteria 2996
61 Ga0068853_100152821 3300005539 Bacteria 2078
62 Ga0070696_100002388 3300005546 Bacteria 12422
63 Ga0070693_100052893 3300005547 Bacteria 2330
64 Ga0068855_100012611 3300005563 Bacteria 10200
65 Ga0068857_100471619 3300005577 Bacteria 1175
66 Ga0068856_100645133 3300005614 Bacteria 1079
67 Ga0070712_100194605 3300006175 Bacteria 1589
68 Ga0075366_10627134 3300006195 Bacteria 667
69 Ga0105240_10799393 3300009093 Bacteria 1022
70 Ga0105241_10144309 3300009174 Bacteria 1942
71 Ga0105241_10488549 3300009174 Bacteria 1096
72 Ga0105238_10022760 3300009551 Bacteria 6386
73 Ga0105239_10086792 3300010375 Bacteria 3449
74 Ga0105239_10605829 3300010375 Bacteria 1249
75 Ga0157373_10004598 3300013100 Bacteria 10377
76 Ga0157371_10046447 3300013102 Bacteria 3089
77 Ga0157371_10456801 3300013102 Bacteria 939
78 Ga0157370_10037206 3300013104 Bacteria 4718
79 Ga0157370_10826574 3300013104 Bacteria 842
80 Ga0157369_10064267 3300013105 Bacteria 3952
81 Ga0157369_10235665 3300013105 Bacteria 1912
82 Ga0157372_10086350 3300013307 Bacteria 3559
83 Ga0182008_10004435 3300014497 Bacteria 8203
84 Ga0182008_10045120 3300014497 Bacteria 2191
85 Ga0182008_10050174 3300014497 Bacteria 2071
86 Ga0182008_10120889 3300014497 Bacteria 1302
87 Ga0182006_1006979 3300015261 Bacteria 5197
88 Ga0182006_1012629 3300015261 Bacteria 3692
89 Ga0182007_10015730 3300015262 Bacteria 2811
90 Ga0182007_10022104 3300015262 Bacteria 2250
91 Ga0182007_10042591 3300015262 Bacteria 1511
92 Ga0183368_1004 3300015687 Bacteria 1211761
93 Ga0206353_11434229 3300020082 Bacteria 1050
94 Ga0213872_10009739 3300021361 Bacteria 4595
95 Ga0209435_108694 3300025206 Bacteria 1115
96 Ga0209674_100016 3300025226 Bacteria 696756
97 Ga0209674_100026 3300025226 Bacteria 490631
98 Ga0209674_100063 3300025226 Bacteria 275507
99 Ga0209674_100587 3300025226 Bacteria 14006
100 Ga0209672_100017 3300025228 Bacteria 514236
101 Ga0209672_100024 3300025228 Bacteria 367869
102 Ga0209672_100173 3300025228 Bacteria 54084
103 Ga0209672_102819 3300025228 Bacteria 3953
104 Ga0209563_100067 3300025230 Bacteria 256096
105 Ga0207427_100101 3300025231 Bacteria 120866
106 Ga0207427_100213 3300025231 Bacteria 51669
107 Ga0207427_101914 3300025231 Bacteria 6455
108 Ga0207427_107113 3300025231 Bacteria 1338
109 Ga0207427_113410 3300025231 Bacteria 803
110 Ga0209437_100045 3300025233 Bacteria 429809
111 Ga0209437_100090 3300025233 Bacteria 247138
112 Ga0209437_100138 3300025233 Bacteria 172839
113 Ga0209437_101146 3300025233 Bacteria 7944
114 Ga0209258_100038 3300025242 Bacteria 398959
115 Ga0209258_100047 3300025242 Bacteria 367869
116 Ga0209258_100118 3300025242 Bacteria 183558
117 Ga0209258_100529 3300025242 Bacteria 36394
118 Ga0209258_100571 3300025242 Bacteria 31414
119 Ga0209258_101185 3300025242 Bacteria 10492
120 Ga0209258_102294 3300025242 Bacteria 5099
121 Ga0209646_1000824 3300025246 Bacteria 10466
122 Ga0209026_1000114 3300025250 Bacteria 136985
123 Ga0209026_1000261 3300025250 Bacteria 65449
124 Ga0209026_1000431 3300025250 Bacteria 34966
125 Ga0209026_1001167 3300025250 Bacteria 12199
126 Ga0209026_1002583 3300025250 Bacteria 6652
127 Ga0209677_100109 3300025253 Bacteria 88712
128 Ga0209148_1000002 3300025254 Bacteria 2399500
129 Ga0209148_1000009 3300025254 Bacteria 1395625
130 Ga0209148_1000024 3300025254 Bacteria 669890
131 Ga0209148_1000054 3300025254 Bacteria 367869
132 Ga0209148_1000541 3300025254 Bacteria 36394
133 Ga0209759_1000204 3300025256 Bacteria 93642
134 Ga0209759_1000301 3300025256 Bacteria 67978
135 Ga0209759_1022877 3300025256 Bacteria 1389
136 Ga0209233_1000077 3300025261 Bacteria 349570
137 Ga0209233_1000323 3300025261 Bacteria 51669
138 Ga0209233_1006987 3300025261 Bacteria 3605
139 Ga0209455_1000025 3300025272 Bacteria 670673
140 Ga0209455_1000032 3300025272 Bacteria 514243
141 Ga0209455_1000052 3300025272 Bacteria 367804
142 Ga0209455_1003384 3300025272 Bacteria 5668
143 Ga0207647_10008312 3300025904 Bacteria 7444
144 Ga0207647_10015810 3300025904 Bacteria 5165
145 Ga0207647_10189660 3300025904 Bacteria 1191
146 Ga0207705_10057696 3300025909 Bacteria 2800
147 Ga0207654_10214198 3300025911 Bacteria 1274
148 Ga0207707_10012197 3300025912 Bacteria 7472
149 Ga0207671_10140861 3300025914 Bacteria 1858
150 Ga0207693_10321519 3300025915 Bacteria 1211
151 Ga0207660_10196905 3300025917 Bacteria 1572
152 Ga0207657_10030565 3300025919 Bacteria 4888
153 Ga0207657_10041098 3300025919 Bacteria 4091
154 Ga0207657_10083321 3300025919 Bacteria 2683
155 Ga0207657_10120903 3300025919 Bacteria 2154
156 Ga0207652_10239437 3300025921 Bacteria 1636
157 Ga0207694_10143746 3300025924 Bacteria 1919
158 Ga0207694_10262437 3300025924 Bacteria 1415
159 Ga0207700_10013581 3300025928 Bacteria 5306
160 Ga0207664_10000666 3300025929 Bacteria 23590
161 Ga0207664_10397642 3300025929 Bacteria 1225
162 Ga0207690_10000124 3300025932 Bacteria 63516
163 Ga0207690_10004321 3300025932 Bacteria 8391
164 Ga0207690_10127856 3300025932 Bacteria 1855
165 Ga0207690_10319398 3300025932 Bacteria 1220
166 Ga0207690_10335750 3300025932 Bacteria 1191
167 Ga0207690_10821160 3300025932 Bacteria 769
168 Ga0207690_11601577 3300025932 Bacteria 544
169 Ga0207706_10046998 3300025933 Bacteria 3820
170 Ga0207667_10045352 3300025949 Bacteria 4656
171 Ga0207667_10139918 3300025949 Bacteria 2492
172 Ga0207639_10153025 3300026041 Bacteria 1934
173 Ga0207639_10848150 3300026041 Bacteria 853
174 Ga0207674_10027147 3300026116 Bacteria 6063
175 Ga0307408_100856070 3300031548 Bacteria 829
176 Ga0373924_0078864 3300035410 Bacteria 1398
177 Ga0373935_0224968 3300035692 Unclassified 1305
178 Ga0395899_0005919 3300037312 Bacteria 9496
179 Ga0395899_0030653 3300037312 Bacteria 4044
180 Ga0395899_0254889 3300037312 Bacteria 1202
181 Ga0395899_0550804 3300037312 Unclassified 741
182 Ga0395900_0000369 3300037418 Bacteria 64866
183 Ga0395900_0073095 3300037418 Bacteria 3525
184 Ga0395900_0127152 3300037418 Bacteria 2613
185 Ga0395900_0208798 3300037418 Bacteria 1972
186 Ga0395898_0000249 3300037466 Bacteria 134019
187 Ga0395898_0104085 3300037466 Bacteria 2722
188 Ga0395898_1584328 3300037466 Unclassified 579
189 Ga0395905_1266684 3300037471 Unclassified 641
190 Ga0395901_0000728 3300038443 Bacteria 37416
191 Ga0395901_0001304 3300038443 Bacteria 26281
192 Ga0395901_0005382 3300038443 Bacteria 12949
193 Ga0395901_0009370 3300038443 Bacteria 9933
194 Ga0395901_0096206 3300038443 Bacteria 3103
195 Ga0395901_0111701 3300038443 Bacteria 2870
196 Ga0395901_0257489 3300038443 Bacteria 1817
197 Ga0395901_0777439 3300038443 Bacteria 948
198 Ga0436361_0097922 3300039447 Unclassified 1034
199 Ga0436361_0174615 3300039447 Bacteria 4446
200 Ga0436361_0985945 3300039447 Bacteria 4761
201 Ga0439465_0244446 3300041413 Bacteria 662
202 Ga0451797_0607481 3300041453 Bacteria 853
203 Ga0451843_0015220 3300041509 Bacteria 787
204 Ga0451855_0867152 3300041511 Bacteria 805
205 Ga0466965_0524872 3300044683 Unclassified 666
206 Ga0495642_0025945 3300046528 Bacteria 2325
207 Ga0495642_0118913 3300046528 Bacteria 1133
208 Ga0495642_0318727 3300046528 Bacteria 682
209 Ga0495687_004243 3300047443 Bacteria 9825
210 Ga0495686_0000190 3300047472 Bacteria 115114
211 Ga0496104_0423580 3300048907 Bacteria 1243
212 Ga0496113_0112781 3300048916 Bacteria 2118
213 Ga0496113_0579291 3300048916 Bacteria 899
214 Ga0496115_0000079 3300048918 Bacteria 89431
215 Ga0496117_0325789 3300048920 Bacteria 803
216 Ga0496124_0222978 3300048927 Bacteria 1416
217 Ga0501031_0379525 3300049568 Bacteria 914
218 Ga0501031_0730210 3300049568 Bacteria 635
219 Ga0501033_0041022 3300049570 Bacteria 3454
220 Ga0501033_0074563 3300049570 Bacteria 2491
221 Ga0501033_0653803 3300049570 Bacteria 718
222 Ga0501034_0010411 3300049571 Bacteria 9692
223 Ga0501034_0084158 3300049571 Bacteria 3183
224 Ga0501034_0141722 3300049571 Bacteria 2383
225 Ga0501034_1268792 3300049571 Bacteria 614
226 Ga0501036_0018668 3300049572 Bacteria 5815
227 Ga0501036_0089789 3300049572 Bacteria 2596
228 Ga0501036_0118959 3300049572 Bacteria 2231
229 Ga0501037_0011730 3300049573 Bacteria 6452
230 Ga0501037_0046071 3300049573 Bacteria 3199
231 Ga0501037_0692301 3300049573 Bacteria 679
232 Ga0501039_0180973 3300049575 Bacteria 1658
233 Ga0501039_0281596 3300049575 Bacteria 1307
234 Ga0501043_0032474 3300049579 Bacteria 4104
235 Ga0501043_0053255 3300049579 Bacteria 3178
236 Ga0501047_0013994 3300049581 Bacteria 7625
237 Ga0501047_0015840 3300049581 Bacteria 7183
238 Ga0501047_0024123 3300049581 Bacteria 5842
239 Ga0501047_0957914 3300049581 Bacteria 669
240 Ga0501048_0009973 3300049582 Bacteria 7112
241 Ga0501048_0238355 3300049582 Bacteria 1291
242 Ga0501070_0027585 3300049586 Bacteria 4763
243 Ga0501070_0156576 3300049586 Bacteria 1879
244 Ga0501080_0683472 3300049742 Bacteria 906
245 Ga0501080_1022319 3300049742 Bacteria 716
246 Ga0501035_0044998 3300049822 Bacteria 3972
247 Ga0501035_0072317 3300049822 Bacteria 3052
248 Ga0501035_0182377 3300049822 Bacteria 1808
249 Ga0501035_0388636 3300049822 Bacteria 1163
250 Ga0501035_0483375 3300049822 Bacteria 1021
251 Ga0501044_0048774 3300049823 Bacteria 4373
252 Ga0501044_0345153 3300049823 Bacteria 1409
253 Ga0501044_0352993 3300049823 Bacteria 1390
254 Ga0501044_0382129 3300049823 Bacteria 1323
255 Ga0501044_0461500 3300049823 Bacteria 1175
256 Ga0501044_0465895 3300049823 Bacteria 1168
257 Ga0501044_0598002 3300049823 Bacteria 996
258 nmdc:mga03683_498087_c1 3300050489 Bacteria 590
259 nmdc:mga07m45_316066_c1 3300050496 Bacteria 908
260 Ga0500562_052636 3300053108 Bacteria 1090
261 Ga0500593_178090 3300053117 Bacteria 793
262 Ga0500616_0008116 3300053153 Bacteria 6566
263 2644167656 2643221629 Bacteria 5850260
264 2644349116 2643221662 Bacteria 5851492
265 2687583293 2687453130 Bacteria 4227172
266 2928966714 2928963466 Bacteria 5165703
267 2939615424 2939611941 Bacteria 3892017
268 Ga0501035_0212660
269 JGI24739J22299_10094568
270 JGI24737J22298_10161982
271 JGI24735J21928_10006224
272 JGI25156J39149_1005911
273 JGI25156J39149_1007466
274 JGI25162J39368_1000597
275 JGI25162J39368_1003640
276 JGI25162J39368_1004685
277 JGI25154J39366_1012007
278 JGI25157J39369_1000370
279 JGI25157J39369_1001161
280 JGI25157J39369_1001724
281 JGI25164J39214_1000198
282 JGI25164J39214_1000259
283 JGI25164J39214_1006681
284 JGI25165J46597_1000354
285 JGI25165J46597_1000379
286 rootL2_10205861
287 rootH1_10049970
288 rootH1_10382948
289 Ga0055539_1000300
290 Ga0055533_1000167
291 Ga0055533_1000290
292 Ga0055533_1001291
293 Ga0055525_1000266
294 Ga0055527_1000044
295 Ga0055527_1000047
296 Ga0055535_1000040
297 Ga0055535_1000109
298 Ga0055535_1000295
299 Ga0055535_1000991
300 Ga0055535_1008754
301 Ga0055542_1000065
302 Ga0055542_1000108
303 Ga0055542_1000292
304 Ga0055542_1000524
305 Ga0055542_1000966
306 Ga0055529_1000049
307 Ga0055529_1000094
308 Ga0055529_1000406
309 Ga0070680_100390403
310 Ga0070682_100004557
311 Ga0070682_100019519
312 Ga0070660_100127074
313 Ga0070660_100171553
314 Ga0070659_100043600
315 Ga0070659_100044900
316 Ga0070659_100176798
317 Ga0070659_100221851
318 Ga0070659_100845685
319 Ga0070714_100000694
320 Ga0070714_100011953
321 Ga0070713_100000941
322 Ga0070662_100024492
323 Ga0070681_10015355
324 Ga0070679_100302962
325 Ga0070679_100439149
326 Ga0070684_100429934
327 Ga0068853_100072740
328 Ga0068853_100152821
329 Ga0070696_100002388
330 Ga0070693_100052893
331 Ga0068855_100012611
332 Ga0068857_100471619
333 Ga0068856_100645133
334 Ga0070712_100194605
335 Ga0075366_10627134
336 Ga0105240_10799393
337 Ga0105241_10144309
338 Ga0105241_10488549
339 Ga0105238_10022760
340 Ga0105239_10086792
341 Ga0105239_10605829
342 Ga0157373_10004598
343 Ga0157371_10046447
344 Ga0157371_10456801
345 Ga0157370_10037206
346 Ga0157370_10826574
347 Ga0157369_10064267
348 Ga0157369_10235665
349 Ga0157372_10086350
350 Ga0182008_10004435
351 Ga0182008_10045120
352 Ga0182008_10050174
353 Ga0182008_10120889
354 Ga0182006_1006979
355 Ga0182006_1012629
356 Ga0182007_10015730
357 Ga0182007_10022104
358 Ga0182007_10042591
359 Ga0183368_1004
360 Ga0206353_11434229
361 Ga0213872_10009739
362 Ga0209435_108694
363 Ga0209674_100016
364 Ga0209674_100026
365 Ga0209674_100063
366 Ga0209674_100587
367 Ga0209672_100017
368 Ga0209672_100024
369 Ga0209672_100173
370 Ga0209672_102819
371 Ga0209563_100067
372 Ga0207427_100101
373 Ga0207427_100213
374 Ga0207427_101914
375 Ga0207427_107113
376 Ga0207427_113410
377 Ga0209437_100045
378 Ga0209437_100090
379 Ga0209437_100138
380 Ga0209437_101146
381 Ga0209258_100038
382 Ga0209258_100047
383 Ga0209258_100118
384 Ga0209258_100529
385 Ga0209258_100571
386 Ga0209258_101185
387 Ga0209258_102294
388 Ga0209646_1000824
389 Ga0209026_1000114
390 Ga0209026_1000261
391 Ga0209026_1000431
392 Ga0209026_1001167
393 Ga0209026_1002583
394 Ga0209677_100109
395 Ga0209148_1000002
396 Ga0209148_1000009
397 Ga0209148_1000024
398 Ga0209148_1000054
399 Ga0209148_1000541
400 Ga0209759_1000204
401 Ga0209759_1000301
402 Ga0209759_1022877
403 Ga0209233_1000077
404 Ga0209233_1000323
405 Ga0209233_1006987
406 Ga0209455_1000025
407 Ga0209455_1000032
408 Ga0209455_1000052
409 Ga0209455_1003384
410 Ga0207647_10008312
411 Ga0207647_10015810
412 Ga0207647_10189660
413 Ga0207705_10057696
414 Ga0207654_10214198
415 Ga0207707_10012197
416 Ga0207671_10140861
417 Ga0207693_10321519
418 Ga0207660_10196905
419 Ga0207657_10030565
420 Ga0207657_10041098
421 Ga0207657_10083321
422 Ga0207657_10120903
423 Ga0207652_10239437
424 Ga0207694_10143746
425 Ga0207694_10262437
426 Ga0207700_10013581
427 Ga0207664_10000666
428 Ga0207664_10397642
429 Ga0207690_10000124
430 Ga0207690_10004321
431 Ga0207690_10127856
432 Ga0207690_10319398
433 Ga0207690_10335750
434 Ga0207690_10821160
435 Ga0207690_11601577
436 Ga0207706_10046998
437 Ga0207667_10045352
438 Ga0207667_10139918
439 Ga0207639_10153025
440 Ga0207639_10848150
441 Ga0207674_10027147
442 Ga0307408_100856070
443 Ga0373924_0078864
444 Ga0373935_0224968
445 Ga0395899_0005919
446 Ga0395899_0030653
447 Ga0395899_0254889
448 Ga0395899_0550804
449 Ga0395900_0000369
450 Ga0395900_0073095
451 Ga0395900_0127152
452 Ga0395900_0208798
453 Ga0395898_0000249
454 Ga0395898_0104085
455 Ga0395898_1584328
456 Ga0395905_1266684
457 Ga0395901_0000728
458 Ga0395901_0001304
459 Ga0395901_0005382
460 Ga0395901_0009370
461 Ga0395901_0096206
462 Ga0395901_0111701
463 Ga0395901_0257489
464 Ga0395901_0777439
465 Ga0436361_0097922
466 Ga0436361_0174615
467 Ga0436361_0985945
468 Ga0439465_0244446
469 Ga0451797_0607481
470 Ga0451843_0015220
471 Ga0451855_0867152
472 Ga0466965_0524872
473 Ga0495642_0025945
474 Ga0495642_0118913
475 Ga0495642_0318727
476 Ga0495687_004243
477 Ga0495686_0000190
478 Ga0496104_0423580
479 Ga0496113_0112781
480 Ga0496113_0579291
481 Ga0496115_0000079
482 Ga0496117_0325789
483 Ga0496124_0222978
484 Ga0501031_0379525
485 Ga0501031_0730210
486 Ga0501033_0041022
487 Ga0501033_0074563
488 Ga0501033_0653803
489 Ga0501034_0010411
490 Ga0501034_0084158
491 Ga0501034_0141722
492 Ga0501034_1268792
493 Ga0501036_0018668
494 Ga0501036_0089789
495 Ga0501036_0118959
496 Ga0501037_0011730
497 Ga0501037_0046071
498 Ga0501037_0692301
499 Ga0501039_0180973
500 Ga0501039_0281596
501 Ga0501043_0032474
502 Ga0501043_0053255
503 Ga0501047_0013994
504 Ga0501047_0015840
505 Ga0501047_0024123
506 Ga0501047_0957914
507 Ga0501048_0009973
508 Ga0501048_0238355
509 Ga0501070_0027585
510 Ga0501070_0156576
511 Ga0501080_0683472
512 Ga0501080_1022319
513 Ga0501035_0044998
514 Ga0501035_0072317
515 Ga0501035_0182377
516 Ga0501035_0388636
517 Ga0501035_0483375
518 Ga0501044_0048774
519 Ga0501044_0345153
520 Ga0501044_0352993
521 Ga0501044_0382129
522 Ga0501044_0461500
523 Ga0501044_0465895
524 Ga0501044_0598002
525 nmdc:mga03683_498087_c1
526 nmdc:mga07m45_316066_c1
527 Ga0500562_052636
528 Ga0500593_178090
529 Ga0500616_0008116
530 2644167656
531 2644349116
532 2687583293
533 2928966714
534 2939615424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

32

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab7-assembly3.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.9009 4 143
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8491 3 143
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8476 2 145
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8452 4 143
1mjh-assembly1.cif.gz_A structure-based assignment of the biochemical function of hypothetical protein mj0577: a test case of structural genomics 0.8334 1 144
ID Description Score Start End Superfamily
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8596 4 145 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8491 3 143 3.40.50.620
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8469 4 145 3.40.50.620
1mjhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8334 1 144 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8303 1 144 3.40.50.620
ID Description Score Start End GO Terms
AF-A3WUR7-F1-model_v4 Putative universal stress protein 0.8985 1 145
AF-A3WUR7-F1-model_v4 Putative universal stress protein 0.8921 1 145
AF-A0A840SK17-F1-model_v4 Nucleotide-binding universal stress UspA family protein 0.883 1 145
AF-N8RBB1-F1-model_v4 Universal stress protein 0.8758 2 143 GO:0005737
AF-A0A1I1X4A9-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.8743 1 145

Map