F375248

General Info

Members Datasets Scaffolds Average Seq Length
268 150 536 401

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10016333|Ga0070658_100163334
Length 413
Sequence MSSVPRKTPVTDKKAIVLYLHVHQPFRVRHYTVFDAGVDHTYFNAPYEDGASNERILRKVAEKSYLPTNARLLQMLHEHPQFKLSLSITGTVLEQLEAWAPEALHSFKELVKTGRVEIVAETYHHSLAFFYSREEFEAQVKMHADKVKKVFDVVPTAFRNTELCYNNDVAYWADKAGYKAILAEGWDPILGWRSPNYVYRPAYTKHIRLLMKNYRLSDDIAFRFGDRSSPAWPLTAEKFSRWLADNQEATNFDLFMDYETFGEHQWGDTGIFDFLAHLPKEWLANRHHTFMTVTEAAEAFEPKDEIDVQSTITWADTERDLSAWLGNSMQSNAIEALYSLRDQIIGTRDLAFIEDWRKLTASDHFYYMCTKYFNDGDIHAYFSPYNTPYEAYMNFMNAYHDLHFRLAEKGVSA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
129 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
138 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
139 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
140 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
143 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
147 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
150 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.24
Nodule 0
Rhizoplane 0.37
Rhizosphere 70.9
Stem 0
Stem Tuber 0
Unclassified 5.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10016333 3300005327 Bacteria 5941
2 JGI24737J22298_10000185 3300001990 Bacteria 20041
3 JGI24735J21928_10000436 3300002067 Bacteria 14576
4 JGI24742J22300_10000015 3300002244 Bacteria 27133
5 rootH1_10166688 3300003316 Unclassified 1444
6 rootH2_10000244 3300003320 Bacteria 697651
7 rootH2_10110119 3300003320 Bacteria 1727
8 rootH1_10201614 3300003323 Bacteria 4898
9 Ga0070658_10000012 3300005327 Bacteria 277871
10 Ga0070658_10000118 3300005327 Bacteria 71171
11 Ga0070658_10002966 3300005327 Bacteria 14062
12 Ga0070658_10006369 3300005327 Bacteria 9564
13 Ga0070658_10009373 3300005327 Bacteria 7866
14 Ga0070658_10016616 3300005327 Bacteria 5889
15 Ga0070658_10049851 3300005327 Bacteria 3393
16 Ga0070658_10135533 3300005327 Bacteria 2054
17 Ga0070676_10000882 3300005328 Bacteria 14791
18 Ga0070683_100000530 3300005329 Bacteria 26876
19 Ga0070680_100000260 3300005336 Bacteria 34804
20 Ga0070680_100008396 3300005336 Bacteria 7909
21 Ga0070682_100000552 3300005337 Bacteria 23228
22 Ga0070682_100211597 3300005337 Bacteria 1374
23 Ga0070660_100000176 3300005339 Bacteria 42222
24 Ga0070660_100000333 3300005339 Bacteria 31211
25 Ga0070660_100007872 3300005339 Bacteria 7432
26 Ga0070671_100000001 3300005355 Bacteria 1228151
27 Ga0070674_100001917 3300005356 Bacteria 11325
28 Ga0070673_100000501 3300005364 Bacteria 20926
29 Ga0070659_100000215 3300005366 Bacteria 44375
30 Ga0070659_100069882 3300005366 Bacteria 2788
31 Ga0070678_100000197 3300005456 Bacteria 26571
32 Ga0070681_10003450 3300005458 Bacteria 14804
33 Ga0070681_10120456 3300005458 Bacteria 2559
34 Ga0070681_10304107 3300005458 Unclassified 1504
35 Ga0068867_100039838 3300005459 Unclassified 3427
36 Ga0068867_100232129 3300005459 Bacteria 1492
37 Ga0070685_10000188 3300005466 Bacteria 41401
38 Ga0070685_10000840 3300005466 Bacteria 16747
39 Ga0070679_100055542 3300005530 Bacteria 3943
40 Ga0070679_100059333 3300005530 Unclassified 3814
41 Ga0070684_100062772 3300005535 Bacteria 3255
42 Ga0068853_100001601 3300005539 Bacteria 16493
43 Ga0070686_100001511 3300005544 Bacteria 13078
44 Ga0068855_100000168 3300005563 Bacteria 83242
45 Ga0068855_100012043 3300005563 Bacteria 10456
46 Ga0068855_100083078 3300005563 Unclassified 3711
47 Ga0068857_100055925 3300005577 Bacteria 3501
48 Ga0068856_100000001 3300005614 Bacteria 565602
49 Ga0068856_100001939 3300005614 Bacteria 21582
50 Ga0068856_100020458 3300005614 Bacteria 6428
51 Ga0068863_100079473 3300005841 Bacteria 3106
52 Ga0068863_100176544 3300005841 Bacteria 2050
53 Ga0068860_100129364 3300005843 Bacteria 2422
54 Ga0081455_10000003 3300005937 Bacteria 367763
55 Ga0075365_10000015 3300006038 Bacteria 73530
56 Ga0075365_10029794 3300006038 Bacteria 3491
57 Ga0075365_10057225 3300006038 Unclassified 2594
58 Ga0075368_10008472 3300006042 Bacteria 3665
59 Ga0075364_10000700 3300006051 Bacteria 17542
60 Ga0075364_10005582 3300006051 Bacteria 7332
61 Ga0075364_10069336 3300006051 Bacteria 2320
62 Ga0075364_10071336 3300006051 Bacteria 2288
63 Ga0075362_10000049 3300006177 Bacteria 39227
64 Ga0075362_10001108 3300006177 Bacteria 8359
65 Ga0075367_10000014 3300006178 Bacteria 37444
66 Ga0075369_10000003 3300006186 Bacteria 205269
67 Ga0075369_10000057 3300006186 Bacteria 28832
68 Ga0075366_10000001 3300006195 Bacteria 569172
69 Ga0075366_10000328 3300006195 Bacteria 21743
70 Ga0075366_10028768 3300006195 Bacteria 3263
71 Ga0097621_100001442 3300006237 Bacteria 16323
72 Ga0075370_10001676 3300006353 Bacteria 9810
73 Ga0068871_100000039 3300006358 Bacteria 69204
74 Ga0068865_100060239 3300006881 Unclassified 2657
75 Ga0105240_10000003 3300009093 Bacteria 1183681
76 Ga0105240_10005815 3300009093 Bacteria 18300
77 Ga0105245_10000001 3300009098 Bacteria 939270
78 Ga0105245_10000002 3300009098 Bacteria 634374
79 Ga0105245_10000050 3300009098 Bacteria 128014
80 Ga0105245_10000466 3300009098 Bacteria 37002
81 Ga0105243_10000001 3300009148 Bacteria 1156578
82 Ga0105243_10003970 3300009148 Bacteria 11796
83 Ga0105241_10000102 3300009174 Bacteria 62230
84 Ga0105242_10000011 3300009176 Bacteria 149791
85 Ga0105242_10001839 3300009176 Bacteria 16663
86 Ga0105237_10035154 3300009545 Bacteria 5072
87 Ga0105249_10007558 3300009553 Bacteria 9479
88 Ga0105030_101807 3300009987 Bacteria 1888
89 Ga0105239_10007293 3300010375 Bacteria 12695
90 Ga0105239_10014629 3300010375 Bacteria 8702
91 Ga0105239_10019556 3300010375 Bacteria 7475
92 Ga0105246_10082512 3300011119 Unclassified 2294
93 Ga0157373_10000351 3300013100 Bacteria 37083
94 Ga0157371_10000176 3300013102 Bacteria 93047
95 Ga0157369_10037570 3300013105 Bacteria 5301
96 Ga0157369_10236082 3300013105 Bacteria 1910
97 Ga0157374_10000031 3300013296 Bacteria 204840
98 Ga0157374_10000115 3300013296 Bacteria 73739
99 Ga0157374_10003322 3300013296 Bacteria 13513
100 Ga0157378_10003161 3300013297 Bacteria 14638
101 Ga0157378_10195808 3300013297 Bacteria 1909
102 Ga0157372_10000670 3300013307 Bacteria 37704
103 Ga0157372_10028510 3300013307 Bacteria 6093
104 Ga0157514_112305 3300013874 Bacteria 1774
105 Ga0163163_10026228 3300014325 Bacteria 5567
106 Ga0157380_10000010 3300014326 Bacteria 140132
107 Ga0157377_10042854 3300014745 Bacteria 2516
108 Ga0157377_10044165 3300014745 Bacteria 2483
109 Ga0157377_10056272 3300014745 Bacteria 2233
110 Ga0157376_10000001 3300014969 Bacteria 842910
111 Ga0207647_10004522 3300025904 Bacteria 10305
112 Ga0207645_10000476 3300025907 Bacteria 33063
113 Ga0207705_10000011 3300025909 Bacteria 517768
114 Ga0207705_10000038 3300025909 Bacteria 193812
115 Ga0207705_10000167 3300025909 Bacteria 71284
116 Ga0207705_10012185 3300025909 Bacteria 6215
117 Ga0207705_10018863 3300025909 Bacteria 4932
118 Ga0207705_10031728 3300025909 Bacteria 3773
119 Ga0207705_10110483 3300025909 Bacteria 2031
120 Ga0207654_10000463 3300025911 Bacteria 23194
121 Ga0207654_10015737 3300025911 Bacteria 3930
122 Ga0207707_10022601 3300025912 Bacteria 5498
123 Ga0207707_10108739 3300025912 Bacteria 2424
124 Ga0207695_10000005 3300025913 Bacteria 1196715
125 Ga0207660_10003102 3300025917 Bacteria 10862
126 Ga0207660_10017700 3300025917 Unclassified 4740
127 Ga0207660_10018218 3300025917 Bacteria 4677
128 Ga0207657_10000804 3300025919 Bacteria 33189
129 Ga0207657_10004485 3300025919 Bacteria 14756
130 Ga0207657_10019199 3300025919 Bacteria 6500
131 Ga0207652_10011483 3300025921 Bacteria 7140
132 Ga0207652_10024249 3300025921 Bacteria 5032
133 Ga0207652_10036785 3300025921 Bacteria 4140
134 Ga0207652_10042862 3300025921 Bacteria 3853
135 Ga0207687_10000001 3300025927 Bacteria 1130810
136 Ga0207687_10000030 3300025927 Bacteria 155548
137 Ga0207687_10000324 3300025927 Bacteria 32503
138 Ga0207687_10003264 3300025927 Bacteria 10981
139 Ga0207644_10000001 3300025931 Bacteria 1243214
140 Ga0207686_10000001 3300025934 Bacteria 1169580
141 Ga0207686_10001772 3300025934 Bacteria 12003
142 Ga0207709_10000002 3300025935 Bacteria 1171536
143 Ga0207661_10000021 3300025944 Bacteria 205381
144 Ga0207661_10015525 3300025944 Bacteria 5606
145 Ga0207667_10000339 3300025949 Bacteria 64087
146 Ga0207667_10014149 3300025949 Bacteria 9107
147 Ga0207667_10062126 3300025949 Bacteria 3907
148 Ga0207651_10000701 3300025960 Bacteria 14342
149 Ga0207658_10004436 3300025986 Bacteria 9760
150 Ga0207703_10009196 3300026035 Bacteria 7771
151 Ga0207639_10030353 3300026041 Bacteria 3964
152 Ga0207702_10000001 3300026078 Bacteria 895738
153 Ga0207702_10001013 3300026078 Bacteria 28866
154 Ga0207702_10120434 3300026078 Bacteria 2348
155 Ga0207641_10068097 3300026088 Bacteria 3051
156 Ga0207648_10038443 3300026089 Bacteria 4210
157 Ga0207674_10000001 3300026116 Bacteria 616581
158 Ga0207674_10171719 3300026116 Bacteria 2121
159 Ga0207683_10007791 3300026121 Bacteria 9166
160 Ga0207698_10123711 3300026142 Unclassified 2195
161 Ga0209813_10001750 3300027866 Bacteria 4892
162 Ga0268266_10001018 3300028379 Bacteria 35297
163 Ga0265337_1000001 3300028556 Bacteria 140973
164 Ga0265334_10000114 3300028573 Bacteria 52821
165 Ga0265334_10002952 3300028573 Bacteria 7793
166 Ga0265322_10008253 3300028654 Bacteria 3035
167 Ga0265338_10000217 3300028800 Bacteria 106453
168 Ga0265338_10000543 3300028800 Bacteria 66162
169 Ga0265338_10000925 3300028800 Bacteria 49504
170 Ga0265338_10004179 3300028800 Bacteria 19701
171 Ga0265338_10090823 3300028800 Unclassified 2526
172 Ga0265324_10000345 3300029957 Bacteria 33698
173 Ga0265340_10000533 3300031247 Bacteria 21017
174 Ga0265339_10027433 3300031249 Bacteria 3251
175 Ga0265327_10000017 3300031251 Bacteria 445264
176 Ga0265327_10001794 3300031251 Bacteria 25181
177 Ga0265327_10003189 3300031251 Bacteria 16013
178 Ga0265327_10004581 3300031251 Bacteria 12169
179 Ga0265316_10001231 3300031344 Bacteria 27541
180 Ga0395899_0008531 3300037312 Bacteria 7893
181 Ga0395899_0062905 3300037312 Archaea 2732
182 Ga0395899_0132713 3300037312 Bacteria 1777
183 Ga0395900_0001880 3300037418 Bacteria 23875
184 Ga0395900_0002167 3300037418 Bacteria 21936
185 Ga0395900_0026294 3300037418 Bacteria 5960
186 Ga0395905_0002458 3300037471 Bacteria 20515
187 Ga0395905_0006749 3300037471 Bacteria 11494
188 Ga0395905_0160786 3300037471 Archaea 2111
189 Ga0395901_0001243 3300038443 Bacteria 27219
190 Ga0395901_0012582 3300038443 Bacteria 8586
191 Ga0395901_0032784 3300038443 Bacteria 5359
192 Ga0395901_0043611 3300038443 Archaea 4652
193 Ga0395901_0193965 3300038443 Bacteria 2130
194 Ga0495588_0000235 3300046674 Bacteria 48543
195 Ga0495672_0000016 3300047320 Bacteria 500601
196 Ga0495672_0025341 3300047320 Bacteria 3799
197 Ga0496112_0004989 3300048915 Bacteria 11381
198 Ga0501031_0004124 3300049568 Bacteria 9384
199 Ga0501032_0000394 3300049569 Bacteria 36017
200 Ga0501034_0026304 3300049571 Bacteria 5926
201 Ga0501036_0024404 3300049572 Bacteria 5097
202 Ga0501037_0000133 3300049573 Bacteria 69741
203 Ga0501037_0034856 3300049573 Bacteria 3713
204 Ga0501038_0011555 3300049574 Bacteria 8055
205 Ga0501042_0034497 3300049578 Bacteria 3589
206 Ga0501043_0001721 3300049579 Bacteria 18919
207 Ga0501046_0000038 3300049580 Bacteria 159193
208 Ga0501047_0014762 3300049581 Bacteria 7433
209 Ga0501048_0011131 3300049582 Bacteria 6707
210 Ga0501070_0124429 3300049586 Bacteria 2131
211 Ga0501035_0001229 3300049822 Bacteria 26660
212 Ga0501035_0002682 3300049822 Bacteria 17322
213 Ga0501044_0015105 3300049823 Bacteria 8321
214 nmdc:mga03683_660_c1 3300050489 Bacteria 9603
215 nmdc:mga03683_66_c2 3300050489 Bacteria 39227
216 nmdc:mga00v17_145_c2 3300050491 Bacteria 17914
217 nmdc:mga00v17_26505_c1 3300050491 Bacteria 3379
218 nmdc:mga00v17_60489_c1 3300050491 Bacteria 2326
219 nmdc:mga00v17_62651_c1 3300050491 Bacteria 2288
220 nmdc:mga0yw44_14383_c1 3300050492 Bacteria 4201
221 nmdc:mga0yw44_24849_c1 3300050492 Bacteria 3396
222 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
223 nmdc:mga0yw44_50661_c1 3300050492 Bacteria 2511
224 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
225 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
226 nmdc:mga0k408_26861_c1 3300050493 Bacteria 3265
227 nmdc:mga0k408_34_c1 3300050493 Bacteria 65613
228 nmdc:mga0k408_3542_c1 3300050493 Bacteria 8250
229 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
230 nmdc:mga04h51_960_c1 3300050495 Bacteria 6654
231 nmdc:mga07m45_10695_c1 3300050496 Bacteria 4801
232 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
233 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
234 Ga0500610_0000001 3300053079 Bacteria 185468
235 Ga0500643_000010 3300053087 Bacteria 408084
236 Ga0500643_000011 3300053087 Bacteria 385630
237 Ga0500643_000038 3300053087 Bacteria 178974
238 Ga0500643_000948 3300053087 Bacteria 18151
239 Ga0500644_0000199 3300053088 Bacteria 36622
240 Ga0500644_0000281 3300053088 Bacteria 28221
241 Ga0500644_0002190 3300053088 Bacteria 4938
242 Ga0500583_0000067 3300053092 Bacteria 64775
243 Ga0500583_0006976 3300053092 Unclassified 3935
244 Ga0500651_0000050 3300053093 Bacteria 78674
245 Ga0500651_0010420 3300053093 Bacteria 5571
246 Ga0500650_0000001 3300053098 Bacteria 818797
247 Ga0500555_000001 3300053103 Bacteria 1353713
248 Ga0500555_000002 3300053103 Bacteria 1314346
249 Ga0500556_0000246 3300053104 Bacteria 43933
250 Ga0500562_000009 3300053108 Bacteria 187538
251 Ga0500594_0000001 3300053118 Bacteria 1178472
252 Ga0500594_0000439 3300053118 Bacteria 9195
253 Ga0500614_000001 3300053123 Bacteria 1274484
254 Ga0500614_005043 3300053123 Bacteria 2775
255 Ga0500628_000006 3300053129 Bacteria 154858
256 Ga0500642_0004467 3300053130 Bacteria 4382
257 Ga0500652_000054 3300053131 Bacteria 52348
258 Ga0500655_001916 3300053133 Unclassified 3867
259 Ga0500561_0000001 3300053137 Bacteria 957685
260 Ga0500568_0006636 3300053139 Bacteria 5787
261 Ga0500577_0002085 3300053142 Bacteria 5107
262 Ga0500577_0005983 3300053142 Unclassified 3318
263 Ga0500579_001169 3300053143 Bacteria 15311
264 Ga0500589_000008 3300053147 Bacteria 137145
265 Ga0500589_009623 3300053147 Unclassified 4097
266 Ga0500604_0004964 3300053151 Bacteria 3524
267 Ga0500649_000010 3300053722 Bacteria 91784
268 Ga0500611_011459 3300053727 Unclassified 1467
269 Ga0070658_10016333
270 JGI24737J22298_10000185
271 JGI24735J21928_10000436
272 JGI24742J22300_10000015
273 rootH1_10166688
274 rootH2_10000244
275 rootH2_10110119
276 rootH1_10201614
277 Ga0070658_10000012
278 Ga0070658_10000118
279 Ga0070658_10002966
280 Ga0070658_10006369
281 Ga0070658_10009373
282 Ga0070658_10016616
283 Ga0070658_10049851
284 Ga0070658_10135533
285 Ga0070676_10000882
286 Ga0070683_100000530
287 Ga0070680_100000260
288 Ga0070680_100008396
289 Ga0070682_100000552
290 Ga0070682_100211597
291 Ga0070660_100000176
292 Ga0070660_100000333
293 Ga0070660_100007872
294 Ga0070671_100000001
295 Ga0070674_100001917
296 Ga0070673_100000501
297 Ga0070659_100000215
298 Ga0070659_100069882
299 Ga0070678_100000197
300 Ga0070681_10003450
301 Ga0070681_10120456
302 Ga0070681_10304107
303 Ga0068867_100039838
304 Ga0068867_100232129
305 Ga0070685_10000188
306 Ga0070685_10000840
307 Ga0070679_100055542
308 Ga0070679_100059333
309 Ga0070684_100062772
310 Ga0068853_100001601
311 Ga0070686_100001511
312 Ga0068855_100000168
313 Ga0068855_100012043
314 Ga0068855_100083078
315 Ga0068857_100055925
316 Ga0068856_100000001
317 Ga0068856_100001939
318 Ga0068856_100020458
319 Ga0068863_100079473
320 Ga0068863_100176544
321 Ga0068860_100129364
322 Ga0081455_10000003
323 Ga0075365_10000015
324 Ga0075365_10029794
325 Ga0075365_10057225
326 Ga0075368_10008472
327 Ga0075364_10000700
328 Ga0075364_10005582
329 Ga0075364_10069336
330 Ga0075364_10071336
331 Ga0075362_10000049
332 Ga0075362_10001108
333 Ga0075367_10000014
334 Ga0075369_10000003
335 Ga0075369_10000057
336 Ga0075366_10000001
337 Ga0075366_10000328
338 Ga0075366_10028768
339 Ga0097621_100001442
340 Ga0075370_10001676
341 Ga0068871_100000039
342 Ga0068865_100060239
343 Ga0105240_10000003
344 Ga0105240_10005815
345 Ga0105245_10000001
346 Ga0105245_10000002
347 Ga0105245_10000050
348 Ga0105245_10000466
349 Ga0105243_10000001
350 Ga0105243_10003970
351 Ga0105241_10000102
352 Ga0105242_10000011
353 Ga0105242_10001839
354 Ga0105237_10035154
355 Ga0105249_10007558
356 Ga0105030_101807
357 Ga0105239_10007293
358 Ga0105239_10014629
359 Ga0105239_10019556
360 Ga0105246_10082512
361 Ga0157373_10000351
362 Ga0157371_10000176
363 Ga0157369_10037570
364 Ga0157369_10236082
365 Ga0157374_10000031
366 Ga0157374_10000115
367 Ga0157374_10003322
368 Ga0157378_10003161
369 Ga0157378_10195808
370 Ga0157372_10000670
371 Ga0157372_10028510
372 Ga0157514_112305
373 Ga0163163_10026228
374 Ga0157380_10000010
375 Ga0157377_10042854
376 Ga0157377_10044165
377 Ga0157377_10056272
378 Ga0157376_10000001
379 Ga0207647_10004522
380 Ga0207645_10000476
381 Ga0207705_10000011
382 Ga0207705_10000038
383 Ga0207705_10000167
384 Ga0207705_10012185
385 Ga0207705_10018863
386 Ga0207705_10031728
387 Ga0207705_10110483
388 Ga0207654_10000463
389 Ga0207654_10015737
390 Ga0207707_10022601
391 Ga0207707_10108739
392 Ga0207695_10000005
393 Ga0207660_10003102
394 Ga0207660_10017700
395 Ga0207660_10018218
396 Ga0207657_10000804
397 Ga0207657_10004485
398 Ga0207657_10019199
399 Ga0207652_10011483
400 Ga0207652_10024249
401 Ga0207652_10036785
402 Ga0207652_10042862
403 Ga0207687_10000001
404 Ga0207687_10000030
405 Ga0207687_10000324
406 Ga0207687_10003264
407 Ga0207644_10000001
408 Ga0207686_10000001
409 Ga0207686_10001772
410 Ga0207709_10000002
411 Ga0207661_10000021
412 Ga0207661_10015525
413 Ga0207667_10000339
414 Ga0207667_10014149
415 Ga0207667_10062126
416 Ga0207651_10000701
417 Ga0207658_10004436
418 Ga0207703_10009196
419 Ga0207639_10030353
420 Ga0207702_10000001
421 Ga0207702_10001013
422 Ga0207702_10120434
423 Ga0207641_10068097
424 Ga0207648_10038443
425 Ga0207674_10000001
426 Ga0207674_10171719
427 Ga0207683_10007791
428 Ga0207698_10123711
429 Ga0209813_10001750
430 Ga0268266_10001018
431 Ga0265337_1000001
432 Ga0265334_10000114
433 Ga0265334_10002952
434 Ga0265322_10008253
435 Ga0265338_10000217
436 Ga0265338_10000543
437 Ga0265338_10000925
438 Ga0265338_10004179
439 Ga0265338_10090823
440 Ga0265324_10000345
441 Ga0265340_10000533
442 Ga0265339_10027433
443 Ga0265327_10000017
444 Ga0265327_10001794
445 Ga0265327_10003189
446 Ga0265327_10004581
447 Ga0265316_10001231
448 Ga0395899_0008531
449 Ga0395899_0062905
450 Ga0395899_0132713
451 Ga0395900_0001880
452 Ga0395900_0002167
453 Ga0395900_0026294
454 Ga0395905_0002458
455 Ga0395905_0006749
456 Ga0395905_0160786
457 Ga0395901_0001243
458 Ga0395901_0012582
459 Ga0395901_0032784
460 Ga0395901_0043611
461 Ga0395901_0193965
462 Ga0495588_0000235
463 Ga0495672_0000016
464 Ga0495672_0025341
465 Ga0496112_0004989
466 Ga0501031_0004124
467 Ga0501032_0000394
468 Ga0501034_0026304
469 Ga0501036_0024404
470 Ga0501037_0000133
471 Ga0501037_0034856
472 Ga0501038_0011555
473 Ga0501042_0034497
474 Ga0501043_0001721
475 Ga0501046_0000038
476 Ga0501047_0014762
477 Ga0501048_0011131
478 Ga0501070_0124429
479 Ga0501035_0001229
480 Ga0501035_0002682
481 Ga0501044_0015105
482 nmdc:mga03683_660_c1
483 nmdc:mga03683_66_c2
484 nmdc:mga00v17_145_c2
485 nmdc:mga00v17_26505_c1
486 nmdc:mga00v17_60489_c1
487 nmdc:mga00v17_62651_c1
488 nmdc:mga0yw44_14383_c1
489 nmdc:mga0yw44_24849_c1
490 nmdc:mga0yw44_2_c1
491 nmdc:mga0yw44_50661_c1
492 nmdc:mga0k408_14_c3
493 nmdc:mga0k408_1_c1
494 nmdc:mga0k408_26861_c1
495 nmdc:mga0k408_34_c1
496 nmdc:mga0k408_3542_c1
497 nmdc:mga06z11_53_c2
498 nmdc:mga04h51_960_c1
499 nmdc:mga07m45_10695_c1
500 nmdc:mga0sz30_1_c1
501 nmdc:mga0sz30_8_c1
502 Ga0500610_0000001
503 Ga0500643_000010
504 Ga0500643_000011
505 Ga0500643_000038
506 Ga0500643_000948
507 Ga0500644_0000199
508 Ga0500644_0000281
509 Ga0500644_0002190
510 Ga0500583_0000067
511 Ga0500583_0006976
512 Ga0500651_0000050
513 Ga0500651_0010420
514 Ga0500650_0000001
515 Ga0500555_000001
516 Ga0500555_000002
517 Ga0500556_0000246
518 Ga0500562_000009
519 Ga0500594_0000001
520 Ga0500594_0000439
521 Ga0500614_000001
522 Ga0500614_005043
523 Ga0500628_000006
524 Ga0500642_0004467
525 Ga0500652_000054
526 Ga0500655_001916
527 Ga0500561_0000001
528 Ga0500568_0006636
529 Ga0500577_0002085
530 Ga0500577_0005983
531 Ga0500579_001169
532 Ga0500589_000008
533 Ga0500589_009623
534 Ga0500604_0004964
535 Ga0500649_000010
536 Ga0500611_011459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03065

Glyco_hydro_57

Glycosyl hydrolase family 57

17

309

0.94

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

69

181

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hm9-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme with restored enzymatic activity. 0.749 2 286
6hpa-assembly1.cif.gz_A crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme 0.7406 2 286
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.73 1 285
7bkf-assembly1.cif.gz_A crystal structure of wt ba3943, a ce4 family pseudoenzyme from bacillus anthracis 0.73 2 296
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.7235 1 285
ID Description Score Start End Superfamily
af_Q59006_30_367_3.20.110.20 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel; 0.937 41 355 3.20.110.20
af_Q59006_30_367_3.20.110.20 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel; 0.8724 41 355 3.20.110.20
5wu7B01 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.7309 2 298 3.20.110.10
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7103 3 290 3.20.20.370
af_P9WQ27_8_405_3.20.110.10 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.7097 2 297 3.20.110.10
ID Description Score Start End GO Terms
AF-A0A1F6FHB7-F1-model_v4 Alpha-amylase 0.9715 1 396 GO:0003824
GO:0005975
AF-A0A497TD87-F1-model_v4 Alpha-amylase 0.971 1 300 GO:0003824
GO:0005975
AF-T1CYJ2-F1-model_v4 Alpha-amylase 0.9702 1 294 GO:0003824
GO:0005975
AF-A0A842V5E2-F1-model_v4 Alpha-amylase 0.9693 1 147 GO:0005975
GO:0016810
AF-A0A2H0RKM2-F1-model_v4 Alpha-amylase 0.9669 1 398 GO:0003824
GO:0005975

Map