F375446

General Info

Members Datasets Scaffolds Average Seq Length
268 148 536 440

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10084808|Ga0105240_100848085
Length 521
Sequence MHDIKTIRDDPEAFTAGLNRRGIADAAALTSKLLARDKELRDLLTRLQLAQARRNEASKLIGQAKAKKDEGQANALLKEVAGLKDEIXXXEQKERELSEALKNDLAEIPNLPASDVPDGASEDENKPVPARAFGRAPGMNAPKDHVVLGEALGMLDFERAAKISGSRFVYLKGELARLSRALASFMLDNHTAKFGYLEVAPPLLVRDEAMFGTGQLPKFEADLFPTRLLKEQEQTAKAPDSAIRYLAANTAAPAVSGQIFEKILATNIGASHDPADIVRKYVEAISQITSIDPGRSTATAAPERRQQALREFASDTALFESLWLIPTAEVSLTNYVNGEIVAEAELPLRFTAFTPCFRAEAGAAGKDTRGMIRMHQFDKVELVSITTPEQSSAEHERMTDAAQDILKRLGLHHRVVTLCTGDMGFAARKTYDIEVWLPGQNRFREISSCSNCGEFQARRMNTRFRGADGKVKGMVHTLNGSGLAIGRTIVAIMENYQEPDGSIAIPDALRPYMNGLEKITK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
145 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
146 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 2643221552 Caulobacter sp. Root1472 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 0.37
Rhizosphere 92.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10084808 3300009093 Bacteria 3883
2 JGI25165J46597_1000425 3300003214 Bacteria 43589
3 JGI25153J46596_10000552 3300003215 Bacteria 23376
4 Ga0070658_10002834 3300005327 Bacteria 14407
5 Ga0070676_10003089 3300005328 Bacteria 8607
6 Ga0070690_100011918 3300005330 Bacteria 5103
7 Ga0068869_100112551 3300005334 Bacteria 2072
8 Ga0070666_10050107 3300005335 Bacteria 2808
9 Ga0070680_100002345 3300005336 Bacteria 13991
10 Ga0070691_10006364 3300005341 Bacteria 5399
11 Ga0070661_100000415 3300005344 Bacteria 32936
12 Ga0070675_100033231 3300005354 Bacteria 4181
13 Ga0070709_10000925 3300005434 Bacteria 16265
14 Ga0070709_10030740 3300005434 Bacteria 3225
15 Ga0070714_100178459 3300005435 Bacteria 1931
16 Ga0070713_100000003 3300005436 Bacteria 245840
17 Ga0070713_100047865 3300005436 Bacteria 3517
18 Ga0070710_10053139 3300005437 Bacteria 2281
19 Ga0070711_100118555 3300005439 Bacteria 1953
20 Ga0070678_100014168 3300005456 Bacteria 5022
21 Ga0070681_10000001 3300005458 Bacteria 946857
22 Ga0068867_100008937 3300005459 Bacteria 7071
23 Ga0070679_100000096 3300005530 Bacteria 67304
24 Ga0070679_100009547 3300005530 Bacteria 9177
25 Ga0068853_100024052 3300005539 Bacteria 5105
26 Ga0068853_100029713 3300005539 Bacteria 4610
27 Ga0070665_100053196 3300005548 Bacteria 4060
28 Ga0070665_100147960 3300005548 Bacteria 2351
29 Ga0070665_100150898 3300005548 Bacteria 2327
30 Ga0068855_100000010 3300005563 Bacteria 246022
31 Ga0068855_100047875 3300005563 Bacteria 5049
32 Ga0068855_100107814 3300005563 Bacteria 3200
33 Ga0068857_100000666 3300005577 Bacteria 25433
34 Ga0068857_100044805 3300005577 Bacteria 3925
35 Ga0068856_100020312 3300005614 Bacteria 6452
36 Ga0068856_100039458 3300005614 Bacteria 4636
37 Ga0068852_100015405 3300005616 Bacteria 5929
38 Ga0068858_100020049 3300005842 Bacteria 6253
39 Ga0068858_100099201 3300005842 Bacteria 2716
40 Ga0070712_100000031 3300006175 Bacteria 72694
41 Ga0070712_100005740 3300006175 Bacteria 7674
42 Ga0097621_100026484 3300006237 Bacteria 4549
43 Ga0097621_100215227 3300006237 Bacteria 1672
44 Ga0068871_100131663 3300006358 Bacteria 2121
45 Ga0075436_100000113 3300006914 Bacteria 47637
46 Ga0075436_100018409 3300006914 Bacteria 4782
47 Ga0075435_100186735 3300007076 Bacteria 1753
48 Ga0105240_10000189 3300009093 Bacteria 125396
49 Ga0105240_10022178 3300009093 Bacteria 8424
50 Ga0105240_10040506 3300009093 Bacteria 5957
51 Ga0105240_10042036 3300009093 Bacteria 5827
52 Ga0105240_10111207 3300009093 Bacteria 3314
53 Ga0105240_10114933 3300009093 Bacteria 3250
54 Ga0105240_10282365 3300009093 Bacteria 1907
55 Ga0105240_10351657 3300009093 Bacteria 1672
56 Ga0105240_10380048 3300009093 Bacteria 1595
57 Ga0105240_10385687 3300009093 Bacteria 1581
58 Ga0105245_10069679 3300009098 Bacteria 3189
59 Ga0105247_10008542 3300009101 Bacteria 6239
60 Ga0105247_10099811 3300009101 Bacteria 1855
61 Ga0105243_10003266 3300009148 Bacteria 13205
62 Ga0105241_10013409 3300009174 Bacteria 6008
63 Ga0105241_10109093 3300009174 Bacteria 2213
64 Ga0105241_10194972 3300009174 Bacteria 1688
65 Ga0105241_10254191 3300009174 Bacteria 1491
66 Ga0105242_10021628 3300009176 Bacteria 5053
67 Ga0105248_10000001 3300009177 Bacteria 1881304
68 Ga0105248_10015485 3300009177 Bacteria 8407
69 Ga0105237_10007036 3300009545 Bacteria 12385
70 Ga0105237_10053100 3300009545 Bacteria 4066
71 Ga0105238_10000588 3300009551 Bacteria 38151
72 Ga0105238_10042019 3300009551 Bacteria 4629
73 Ga0105238_10216944 3300009551 Bacteria 1889
74 Ga0105239_10007355 3300010375 Bacteria 12647
75 Ga0105239_10013960 3300010375 Bacteria 8920
76 Ga0105239_10021044 3300010375 Bacteria 7198
77 Ga0105239_10084285 3300010375 Bacteria 3500
78 Ga0105239_10084817 3300010375 Bacteria 3490
79 Ga0105239_10105041 3300010375 Bacteria 3128
80 Ga0105246_10018317 3300011119 Bacteria 4462
81 Ga0105246_10167866 3300011119 Bacteria 1678
82 Ga0157373_10002418 3300013100 Bacteria 14193
83 Ga0157373_10122553 3300013100 Bacteria 1827
84 Ga0157370_10011125 3300013104 Bacteria 9433
85 Ga0157369_10038176 3300013105 Bacteria 5252
86 Ga0157369_10069800 3300013105 Bacteria 3775
87 Ga0157378_10208703 3300013297 Bacteria 1851
88 Ga0157378_10253300 3300013297 Bacteria 1686
89 Ga0163162_10303937 3300013306 Bacteria 1727
90 Ga0157372_10046370 3300013307 Bacteria 4825
91 Ga0157372_10050479 3300013307 Bacteria 4627
92 Ga0157372_10083141 3300013307 Bacteria 3626
93 Ga0157372_10116345 3300013307 Bacteria 3066
94 Ga0163163_10000111 3300014325 Bacteria 86620
95 Ga0157379_10051140 3300014968 Bacteria 3691
96 Ga0157379_10079419 3300014968 Bacteria 2938
97 Ga0163161_10003624 3300017792 Bacteria 10840
98 Ga0213874_10003640 3300021377 Bacteria 3445
99 Ga0213876_10000225 3300021384 Bacteria 56051
100 Ga0213876_10000485 3300021384 Bacteria 31453
101 Ga0209233_1000013 3300025261 Bacteria 1013785
102 Ga0209758_1000036 3300025297 Bacteria 441671
103 Ga0207699_10000159 3300025906 Bacteria 42165
104 Ga0207699_10027854 3300025906 Bacteria 3134
105 Ga0207645_10007556 3300025907 Bacteria 7667
106 Ga0207705_10000092 3300025909 Bacteria 109488
107 Ga0207705_10145548 3300025909 Bacteria 1772
108 Ga0207654_10058258 3300025911 Bacteria 2248
109 Ga0207707_10000001 3300025912 Bacteria 1212482
110 Ga0207707_10176951 3300025912 Bacteria 1864
111 Ga0207695_10000003 3300025913 Bacteria 1368691
112 Ga0207695_10006268 3300025913 Bacteria 15485
113 Ga0207695_10012889 3300025913 Bacteria 10006
114 Ga0207695_10033816 3300025913 Bacteria 5569
115 Ga0207695_10063803 3300025913 Bacteria 3795
116 Ga0207695_10105792 3300025913 Bacteria 2801
117 Ga0207695_10164317 3300025913 Bacteria 2149
118 Ga0207693_10000336 3300025915 Bacteria 43208
119 Ga0207693_10002532 3300025915 Bacteria 15883
120 Ga0207663_10109502 3300025916 Bacteria 1872
121 Ga0207660_10001894 3300025917 Bacteria 13943
122 Ga0207660_10103366 3300025917 Bacteria 2131
123 Ga0207662_10061723 3300025918 Bacteria 2251
124 Ga0207657_10000568 3300025919 Bacteria 39225
125 Ga0207649_10000448 3300025920 Bacteria 29660
126 Ga0207649_10033693 3300025920 Bacteria 3063
127 Ga0207652_10000815 3300025921 Bacteria 29778
128 Ga0207652_10027461 3300025921 Bacteria 4743
129 Ga0207652_10194650 3300025921 Bacteria 1824
130 Ga0207694_10000011 3300025924 Bacteria 417640
131 Ga0207694_10096536 3300025924 Bacteria 2337
132 Ga0207694_10120416 3300025924 Bacteria 2095
133 Ga0207659_10056125 3300025926 Bacteria 2820
134 Ga0207687_10074460 3300025927 Bacteria 2434
135 Ga0207700_10000010 3300025928 Bacteria 298473
136 Ga0207664_10159485 3300025929 Bacteria 1923
137 Ga0207706_10171550 3300025933 Bacteria 1906
138 Ga0207691_10157293 3300025940 Bacteria 1995
139 Ga0207691_10273686 3300025940 Bacteria 1454
140 Ga0207711_10000002 3300025941 Bacteria 1228676
141 Ga0207711_10039352 3300025941 Bacteria 4022
142 Ga0207689_10010945 3300025942 Bacteria 7799
143 Ga0207667_10000093 3300025949 Bacteria 145814
144 Ga0207667_10014628 3300025949 Bacteria 8936
145 Ga0207667_10202095 3300025949 Bacteria 2038
146 Ga0207677_10203120 3300026023 Bacteria 1577
147 Ga0207639_10000300 3300026041 Bacteria 35006
148 Ga0207639_10010896 3300026041 Bacteria 6305
149 Ga0207639_10019676 3300026041 Bacteria 4819
150 Ga0207639_10026761 3300026041 Bacteria 4193
151 Ga0207708_10149505 3300026075 Bacteria 1837
152 Ga0207702_10000013 3300026078 Bacteria 257468
153 Ga0207702_10093011 3300026078 Bacteria 2644
154 Ga0207648_10002527 3300026089 Bacteria 19628
155 Ga0207674_10000450 3300026116 Bacteria 53632
156 Ga0207674_10032788 3300026116 Bacteria 5445
157 Ga0207683_10039839 3300026121 Bacteria 4099
158 Ga0207683_10126085 3300026121 Bacteria 2301
159 Ga0207698_10002935 3300026142 Bacteria 10197
160 Ga0268266_10054552 3300028379 Bacteria 3434
161 Ga0268266_10093103 3300028379 Bacteria 2644
162 Ga0265338_10000014 3300028800 Bacteria 378751
163 Ga0265338_10092255 3300028800 Bacteria 2498
164 Ga0265338_10127017 3300028800 Bacteria 2021
165 Ga0265332_10012772 3300031238 Bacteria 3726
166 Ga0265320_10000496 3300031240 Bacteria 30651
167 Ga0265325_10000001 3300031241 Bacteria 726814
168 Ga0265325_10000413 3300031241 Bacteria 30484
169 Ga0265329_10012262 3300031242 Bacteria 3086
170 Ga0265339_10000941 3300031249 Bacteria 22348
171 Ga0265339_10085364 3300031249 Bacteria 1662
172 Ga0265331_10081639 3300031250 Bacteria 1501
173 Ga0265316_10004731 3300031344 Bacteria 13468
174 Ga0265316_10048659 3300031344 Bacteria 3345
175 Ga0265313_10000660 3300031595 Bacteria 35564
176 Ga0265313_10003885 3300031595 Bacteria 11771
177 Ga0265313_10009639 3300031595 Bacteria 6240
178 Ga0265314_10005627 3300031711 Bacteria 11255
179 Ga0265314_10040422 3300031711 Bacteria 3347
180 Ga0265342_10013146 3300031712 Bacteria 5568
181 Ga0373937_0198960 3300036401 Bacteria 1883
182 Ga0373925_0024920 3300037068 Bacteria 4370
183 Ga0395900_0093221 3300037418 Bacteria 3094
184 Ga0395898_0005472 3300037466 Bacteria 13720
185 Ga0436365_0014930 3300039437 Bacteria 48249
186 Ga0436365_0054295 3300039437 Bacteria 3679
187 Ga0436365_0269340 3300039437 Bacteria 68150
188 Ga0436365_0622981 3300039437 Bacteria 8155
189 Ga0436363_0061747 3300039450 Bacteria 4137
190 Ga0436363_1188229 3300039450 Bacteria 18343
191 Ga0439446_0028234 3300042156 Archaea 1615
192 Ga0439434_0021596 3300042435 Archaea 1934
193 Ga0451577_0000055 3300042876 Bacteria 276883
194 Ga0451577_0040623 3300042876 Bacteria 4176
195 Ga0453683_0000578 3300044673 Bacteria 40570
196 Ga0453684_0001373 3300044712 Bacteria 70489
197 Ga0453684_0025967 3300044712 Bacteria 8482
198 Ga0453684_0032187 3300044712 Bacteria 7348
199 Ga0453684_0088513 3300044712 Bacteria 3834
200 Ga0453684_0111292 3300044712 Bacteria 3326
201 Ga0453684_0118443 3300044712 Bacteria 3202
202 Ga0453684_0188611 3300044712 Bacteria 2413
203 Ga0453684_0293177 3300044712 Bacteria 1851
204 Ga0453684_0355880 3300044712 Bacteria 1649
205 Ga0451576_0000157 3300045051 Bacteria 173851
206 Ga0495638_0000612 3300046460 Bacteria 39869
207 Ga0495664_0072565 3300046477 Bacteria 2057
208 Ga0495610_0000092 3300046512 Bacteria 105874
209 Ga0495616_0049724 3300046513 Bacteria 2100
210 Ga0495645_0048976 3300046543 Bacteria 3077
211 Ga0495622_0002516 3300046557 Bacteria 8850
212 Ga0495625_0085330 3300046660 Bacteria 2191
213 Ga0495657_0170870 3300046675 Bacteria 1339
214 Ga0495660_0008185 3300046810 Bacteria 6134
215 Ga0495675_0038266 3300047444 Bacteria 3054
216 Ga0496102_0144388 3300048905 Bacteria 2233
217 Ga0496121_0035908 3300048924 Bacteria 4428
218 Ga0496126_0001513 3300048929 Bacteria 35899
219 Ga0495682_0024756 3300049460 Bacteria 2236
220 Ga0501033_0003945 3300049570 Bacteria 12027
221 Ga0501033_0018570 3300049570 Bacteria 5255
222 Ga0501033_0062131 3300049570 Bacteria 2751
223 Ga0501033_0188988 3300049570 Bacteria 1474
224 Ga0501034_0004847 3300049571 Bacteria 14856
225 Ga0501034_0312620 3300049571 Bacteria 1505
226 Ga0501036_0032381 3300049572 Bacteria 4417
227 Ga0501037_0089228 3300049573 Bacteria 2231
228 Ga0501038_0028541 3300049574 Bacteria 4957
229 Ga0501046_0005747 3300049580 Bacteria 11069
230 Ga0501047_0003221 3300049581 Bacteria 15472
231 Ga0501047_0004336 3300049581 Bacteria 13356
232 Ga0501047_0006557 3300049581 Bacteria 10960
233 Ga0501047_0009499 3300049581 Bacteria 9190
234 Ga0501047_0019518 3300049581 Bacteria 6503
235 Ga0501047_0120321 3300049581 Bacteria 2508
236 Ga0501047_0200824 3300049581 Bacteria 1855
237 Ga0501067_0014420 3300049583 Bacteria 4376
238 Ga0501070_0004447 3300049586 Bacteria 12038
239 Ga0501070_0012654 3300049586 Bacteria 7115
240 Ga0501070_0020618 3300049586 Bacteria 5528
241 Ga0501070_0143526 3300049586 Bacteria 1971
242 Ga0501072_0013300 3300049588 Bacteria 6300
243 Ga0501073_0010254 3300049589 Bacteria 6881
244 Ga0501074_0001610 3300049590 Bacteria 15287
245 Ga0501080_0007694 3300049742 Bacteria 9737
246 Ga0501035_0000615 3300049822 Bacteria 39227
247 Ga0501035_0007894 3300049822 Bacteria 9937
248 Ga0501035_0013193 3300049822 Bacteria 7627
249 Ga0501035_0025262 3300049822 Bacteria 5446
250 Ga0501035_0087382 3300049822 Bacteria 2748
251 Ga0501035_0224723 3300049822 Bacteria 1602
252 Ga0501044_0001173 3300049823 Bacteria 31079
253 Ga0501044_0016248 3300049823 Bacteria 7999
254 Ga0501044_0027675 3300049823 Bacteria 5986
255 Ga0501044_0037395 3300049823 Bacteria 5074
256 Ga0501044_0165688 3300049823 Bacteria 2184
257 Ga0501044_0237608 3300049823 Bacteria 1767
258 Ga0501044_0299862 3300049823 Bacteria 1536
259 Ga0501044_0326334 3300049823 Bacteria 1458
260 nmdc:mga08y16_19238_c1 3300050511 Bacteria 7196
261 nmdc:mga0rr50_70927_c1 3300050513 Bacteria 2656
262 nmdc:mga08x19_140_c1 3300050514 Bacteria 64178
263 nmdc:mga08x19_92881_c1 3300050514 Bacteria 1994
264 Ga0500595_008832 3300053119 Bacteria 4095
265 Ga0500573_0000003 3300053140 Bacteria 355643
266 Ga0500619_003827 3300053154 Bacteria 3147
267 Ga0501082_0012021 3300060353 Bacteria 7444
268 2643780296 2643221552 Bacteria 5708754
269 Ga0105240_10084808
270 JGI25165J46597_1000425
271 JGI25153J46596_10000552
272 Ga0070658_10002834
273 Ga0070676_10003089
274 Ga0070690_100011918
275 Ga0068869_100112551
276 Ga0070666_10050107
277 Ga0070680_100002345
278 Ga0070691_10006364
279 Ga0070661_100000415
280 Ga0070675_100033231
281 Ga0070709_10000925
282 Ga0070709_10030740
283 Ga0070714_100178459
284 Ga0070713_100000003
285 Ga0070713_100047865
286 Ga0070710_10053139
287 Ga0070711_100118555
288 Ga0070678_100014168
289 Ga0070681_10000001
290 Ga0068867_100008937
291 Ga0070679_100000096
292 Ga0070679_100009547
293 Ga0068853_100024052
294 Ga0068853_100029713
295 Ga0070665_100053196
296 Ga0070665_100147960
297 Ga0070665_100150898
298 Ga0068855_100000010
299 Ga0068855_100047875
300 Ga0068855_100107814
301 Ga0068857_100000666
302 Ga0068857_100044805
303 Ga0068856_100020312
304 Ga0068856_100039458
305 Ga0068852_100015405
306 Ga0068858_100020049
307 Ga0068858_100099201
308 Ga0070712_100000031
309 Ga0070712_100005740
310 Ga0097621_100026484
311 Ga0097621_100215227
312 Ga0068871_100131663
313 Ga0075436_100000113
314 Ga0075436_100018409
315 Ga0075435_100186735
316 Ga0105240_10000189
317 Ga0105240_10022178
318 Ga0105240_10040506
319 Ga0105240_10042036
320 Ga0105240_10111207
321 Ga0105240_10114933
322 Ga0105240_10282365
323 Ga0105240_10351657
324 Ga0105240_10380048
325 Ga0105240_10385687
326 Ga0105245_10069679
327 Ga0105247_10008542
328 Ga0105247_10099811
329 Ga0105243_10003266
330 Ga0105241_10013409
331 Ga0105241_10109093
332 Ga0105241_10194972
333 Ga0105241_10254191
334 Ga0105242_10021628
335 Ga0105248_10000001
336 Ga0105248_10015485
337 Ga0105237_10007036
338 Ga0105237_10053100
339 Ga0105238_10000588
340 Ga0105238_10042019
341 Ga0105238_10216944
342 Ga0105239_10007355
343 Ga0105239_10013960
344 Ga0105239_10021044
345 Ga0105239_10084285
346 Ga0105239_10084817
347 Ga0105239_10105041
348 Ga0105246_10018317
349 Ga0105246_10167866
350 Ga0157373_10002418
351 Ga0157373_10122553
352 Ga0157370_10011125
353 Ga0157369_10038176
354 Ga0157369_10069800
355 Ga0157378_10208703
356 Ga0157378_10253300
357 Ga0163162_10303937
358 Ga0157372_10046370
359 Ga0157372_10050479
360 Ga0157372_10083141
361 Ga0157372_10116345
362 Ga0163163_10000111
363 Ga0157379_10051140
364 Ga0157379_10079419
365 Ga0163161_10003624
366 Ga0213874_10003640
367 Ga0213876_10000225
368 Ga0213876_10000485
369 Ga0209233_1000013
370 Ga0209758_1000036
371 Ga0207699_10000159
372 Ga0207699_10027854
373 Ga0207645_10007556
374 Ga0207705_10000092
375 Ga0207705_10145548
376 Ga0207654_10058258
377 Ga0207707_10000001
378 Ga0207707_10176951
379 Ga0207695_10000003
380 Ga0207695_10006268
381 Ga0207695_10012889
382 Ga0207695_10033816
383 Ga0207695_10063803
384 Ga0207695_10105792
385 Ga0207695_10164317
386 Ga0207693_10000336
387 Ga0207693_10002532
388 Ga0207663_10109502
389 Ga0207660_10001894
390 Ga0207660_10103366
391 Ga0207662_10061723
392 Ga0207657_10000568
393 Ga0207649_10000448
394 Ga0207649_10033693
395 Ga0207652_10000815
396 Ga0207652_10027461
397 Ga0207652_10194650
398 Ga0207694_10000011
399 Ga0207694_10096536
400 Ga0207694_10120416
401 Ga0207659_10056125
402 Ga0207687_10074460
403 Ga0207700_10000010
404 Ga0207664_10159485
405 Ga0207706_10171550
406 Ga0207691_10157293
407 Ga0207691_10273686
408 Ga0207711_10000002
409 Ga0207711_10039352
410 Ga0207689_10010945
411 Ga0207667_10000093
412 Ga0207667_10014628
413 Ga0207667_10202095
414 Ga0207677_10203120
415 Ga0207639_10000300
416 Ga0207639_10010896
417 Ga0207639_10019676
418 Ga0207639_10026761
419 Ga0207708_10149505
420 Ga0207702_10000013
421 Ga0207702_10093011
422 Ga0207648_10002527
423 Ga0207674_10000450
424 Ga0207674_10032788
425 Ga0207683_10039839
426 Ga0207683_10126085
427 Ga0207698_10002935
428 Ga0268266_10054552
429 Ga0268266_10093103
430 Ga0265338_10000014
431 Ga0265338_10092255
432 Ga0265338_10127017
433 Ga0265332_10012772
434 Ga0265320_10000496
435 Ga0265325_10000001
436 Ga0265325_10000413
437 Ga0265329_10012262
438 Ga0265339_10000941
439 Ga0265339_10085364
440 Ga0265331_10081639
441 Ga0265316_10004731
442 Ga0265316_10048659
443 Ga0265313_10000660
444 Ga0265313_10003885
445 Ga0265313_10009639
446 Ga0265314_10005627
447 Ga0265314_10040422
448 Ga0265342_10013146
449 Ga0373937_0198960
450 Ga0373925_0024920
451 Ga0395900_0093221
452 Ga0395898_0005472
453 Ga0436365_0014930
454 Ga0436365_0054295
455 Ga0436365_0269340
456 Ga0436365_0622981
457 Ga0436363_0061747
458 Ga0436363_1188229
459 Ga0439446_0028234
460 Ga0439434_0021596
461 Ga0451577_0000055
462 Ga0451577_0040623
463 Ga0453683_0000578
464 Ga0453684_0001373
465 Ga0453684_0025967
466 Ga0453684_0032187
467 Ga0453684_0088513
468 Ga0453684_0111292
469 Ga0453684_0118443
470 Ga0453684_0188611
471 Ga0453684_0293177
472 Ga0453684_0355880
473 Ga0451576_0000157
474 Ga0495638_0000612
475 Ga0495664_0072565
476 Ga0495610_0000092
477 Ga0495616_0049724
478 Ga0495645_0048976
479 Ga0495622_0002516
480 Ga0495625_0085330
481 Ga0495657_0170870
482 Ga0495660_0008185
483 Ga0495675_0038266
484 Ga0496102_0144388
485 Ga0496121_0035908
486 Ga0496126_0001513
487 Ga0495682_0024756
488 Ga0501033_0003945
489 Ga0501033_0018570
490 Ga0501033_0062131
491 Ga0501033_0188988
492 Ga0501034_0004847
493 Ga0501034_0312620
494 Ga0501036_0032381
495 Ga0501037_0089228
496 Ga0501038_0028541
497 Ga0501046_0005747
498 Ga0501047_0003221
499 Ga0501047_0004336
500 Ga0501047_0006557
501 Ga0501047_0009499
502 Ga0501047_0019518
503 Ga0501047_0120321
504 Ga0501047_0200824
505 Ga0501067_0014420
506 Ga0501070_0004447
507 Ga0501070_0012654
508 Ga0501070_0020618
509 Ga0501070_0143526
510 Ga0501072_0013300
511 Ga0501073_0010254
512 Ga0501074_0001610
513 Ga0501080_0007694
514 Ga0501035_0000615
515 Ga0501035_0007894
516 Ga0501035_0013193
517 Ga0501035_0025262
518 Ga0501035_0087382
519 Ga0501035_0224723
520 Ga0501044_0001173
521 Ga0501044_0016248
522 Ga0501044_0027675
523 Ga0501044_0037395
524 Ga0501044_0165688
525 Ga0501044_0237608
526 Ga0501044_0299862
527 Ga0501044_0326334
528 nmdc:mga08y16_19238_c1
529 nmdc:mga0rr50_70927_c1
530 nmdc:mga08x19_140_c1
531 nmdc:mga08x19_92881_c1
532 Ga0500595_008832
533 Ga0500573_0000003
534 Ga0500619_003827
535 Ga0501082_0012021
536 2643780296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02403

Seryl_tRNA_N

Seryl-tRNA synthetase N-terminal domain

1

112

0.98

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

312

496

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r1n-assembly1.cif.gz_A-2 crystal structure of s. aureus seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9481 1 456
6r1m-assembly1.cif.gz_B crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9472 1 456
6r1m-assembly1.cif.gz_B crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.945 1 456
6x94-assembly1.cif.gz_A an orthogonal seryl-trna synthetase/trna pair for noncanonical amino acid mutagenesis in escherichia coli 0.944 1 455
6r1o-assembly1.cif.gz_A-2 crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative 0.9426 1 456
ID Description Score Start End Superfamily
af_P9WFT7_105_418_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9553 101 455 3.30.930.10
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.95 100 455 3.30.930.10
af_P9WFT7_105_418_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9435 101 455 3.30.930.10
af_Q16512_13_98_1.10.287.160 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9405 27 96 1.10.287.160
1sryA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9385 100 455 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A257NUA9-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.988 319 456 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A3D5XK32-F1-model_v4 deleted 0.9858 330 456
AF-A0A353Y9I4-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9848 312 452 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A7V7E8Z2-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9834 333 456 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A257WTY7-F1-model_v4 deleted 0.9833 321 456

Map