F375655

General Info

Members Datasets Scaffolds Average Seq Length
268 178 536 337

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002906|Ga0395905_0002906_852_1940
Length 362
Sequence MPTWSFSHRICNSRQFTPKEKSLNSLMLDEARSAPECVAIQMKSDADLYAEASAYLRAADPASVVTVARGSSDHAASFFAYLSALRGGRLVSSLPMSLLTLHHAPLRFNAACAVAISQSGRSPDLCTVMSQFHAGGAATLALINDVSSPLTQSVHHALPLNAGAERSVAATKSFICSVVGGARLLGEWFHDADLLRALHELPQSLHSACLKDWSAAIDVLKDADRVMIIGRGTGLAIAQEAALKLKETCAIQAEAFSSAEVRHGPMALVEPGYPMLVFAPRGPAQPDLLNLARDMRSRGASVLLAASADVGDRQLTLAPTLLSELDPIAAIQSFYPMVEALARARGTDPDRPRHLSKVTSTL

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
106 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
107 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
108 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
109 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
110 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
111 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
112 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
113 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
167 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
168 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
169 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
170 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
171 2643221585 Pelomonas sp. Root662 Isolate Unclassified
172 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
173 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
174 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
175 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
176 2643221656 Pelomonas sp. Root405 Isolate Unclassified
177 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
178 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.13
Nodule 0
Rhizoplane 1.49
Rhizosphere 57.46
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0002906 3300037471 Bacteria 18693
2 JGI25152J39213_1003717 3300002773 Bacteria 5109
3 JGI25153J46596_10001057 3300003215 Bacteria 16789
4 JGI25153J46596_10004755 3300003215 Bacteria 7235
5 rootH1_10064001 3300003316 Bacteria 2639
6 rootL2_10025756 3300003322 Bacteria 4016
7 Ga0055525_1000222 3300003759 Bacteria 61500
8 Ga0055526_1005017 3300003771 Bacteria 7744
9 Ga0055530_10011803 3300003791 Bacteria 3102
10 Ga0055531_10000513 3300003794 Bacteria 34951
11 Ga0070682_100066693 3300005337 Bacteria 2290
12 Ga0070692_10063324 3300005345 Bacteria 1953
13 Ga0070667_100008719 3300005367 Bacteria 8406
14 Ga0070667_100180260 3300005367 Bacteria 1868
15 Ga0070709_10001056 3300005434 Bacteria 15203
16 Ga0070714_100002565 3300005435 Bacteria 13384
17 Ga0070710_10044630 3300005437 Bacteria 2460
18 Ga0070705_100129532 3300005440 Bacteria 1643
19 Ga0070708_100133485 3300005445 Bacteria 2299
20 Ga0070708_100160327 3300005445 Bacteria 2096
21 Ga0070662_100009371 3300005457 Bacteria 6399
22 Ga0070662_100086508 3300005457 Bacteria 2344
23 Ga0070662_100148132 3300005457 Bacteria 1825
24 Ga0068867_100000083 3300005459 Bacteria 58784
25 Ga0068867_100048785 3300005459 Bacteria 3116
26 Ga0070706_100280846 3300005467 Bacteria 1554
27 Ga0070707_100100654 3300005468 Bacteria 2800
28 Ga0070698_100206605 3300005471 Bacteria 1899
29 Ga0070699_100077303 3300005518 Bacteria 2897
30 Ga0070679_100131520 3300005530 Bacteria 2483
31 Ga0070697_100027990 3300005536 Bacteria 4511
32 Ga0070704_100018299 3300005549 Bacteria 4477
33 Ga0068857_100015430 3300005577 Bacteria 6671
34 Ga0075365_10005572 3300006038 Bacteria 6805
35 Ga0075365_10027973 3300006038 Bacteria 3591
36 Ga0075368_10009936 3300006042 Bacteria 3432
37 Ga0075363_100010376 3300006048 Bacteria 4420
38 Ga0075363_100083347 3300006048 Bacteria 1752
39 Ga0070716_100059268 3300006173 Bacteria 2206
40 Ga0075362_10012181 3300006177 Bacteria 3410
41 Ga0075367_10006653 3300006178 Bacteria 5860
42 Ga0075370_10015296 3300006353 Bacteria 4105
43 Ga0075433_10036728 3300006852 Bacteria 4222
44 Ga0075434_100071949 3300006871 Bacteria 3450
45 Ga0075429_100007851 3300006880 Bacteria 9269
46 Ga0075436_100008551 3300006914 Bacteria 6997
47 Ga0075435_100022703 3300007076 Bacteria 4842
48 Ga0105240_10013307 3300009093 Bacteria 11309
49 Ga0105240_10035441 3300009093 Bacteria 6430
50 Ga0105243_10000919 3300009148 Bacteria 27591
51 Ga0105243_10015671 3300009148 Bacteria 5731
52 Ga0105243_10064536 3300009148 Bacteria 2939
53 Ga0105243_10197919 3300009148 Bacteria 1760
54 Ga0105237_10003357 3300009545 Bacteria 19066
55 Ga0105238_10030082 3300009551 Bacteria 5527
56 Ga0105238_10054287 3300009551 Bacteria 4024
57 Ga0105239_10003475 3300010375 Bacteria 19275
58 Ga0157370_10023081 3300013104 Bacteria 6184
59 Ga0157375_10467457 3300013308 Bacteria 1427
60 Ga0157377_10000104 3300014745 Bacteria 58794
61 Ga0157377_10000546 3300014745 Bacteria 15869
62 Ga0213872_10000045 3300021361 Bacteria 112229
63 Ga0213872_10001196 3300021361 Bacteria 17590
64 Ga0209563_100088 3300025230 Bacteria 175375
65 Ga0207425_1001190 3300025245 Bacteria 11583
66 Ga0209129_1000481 3300025258 Bacteria 29172
67 Ga0209673_1005064 3300025273 Bacteria 6783
68 Ga0209673_1029679 3300025273 Bacteria 1737
69 Ga0209673_1038628 3300025273 Bacteria 1387
70 Ga0209564_1001182 3300025295 Bacteria 30216
71 Ga0209758_1000859 3300025297 Bacteria 42074
72 Ga0209758_1001201 3300025297 Bacteria 32708
73 Ga0209050_1000706 3300025298 Bacteria 49523
74 Ga0209050_1006687 3300025298 Bacteria 6748
75 Ga0209256_1036066 3300025299 Bacteria 1300
76 Ga0209051_1000833 3300025303 Bacteria 31762
77 Ga0209257_1000161 3300025304 Bacteria 176089
78 Ga0209257_1001107 3300025304 Bacteria 35003
79 Ga0209257_1024437 3300025304 Bacteria 2092
80 Ga0207692_10017293 3300025898 Bacteria 3214
81 Ga0207705_10153313 3300025909 Bacteria 1727
82 Ga0207684_10188210 3300025910 Bacteria 1780
83 Ga0207695_10013742 3300025913 Bacteria 9633
84 Ga0207695_10209599 3300025913 Bacteria 1860
85 Ga0207671_10036894 3300025914 Bacteria 3625
86 Ga0207693_10008099 3300025915 Bacteria 8621
87 Ga0207663_10061390 3300025916 Bacteria 2385
88 Ga0207657_10026339 3300025919 Bacteria 5345
89 Ga0207646_10001282 3300025922 Bacteria 31406
90 Ga0207664_10004507 3300025929 Bacteria 9438
91 Ga0207706_10002534 3300025933 Bacteria 17812
92 Ga0207706_10002795 3300025933 Bacteria 16962
93 Ga0207706_10172358 3300025933 Bacteria 1901
94 Ga0207706_10206469 3300025933 Bacteria 1722
95 Ga0207709_10000675 3300025935 Bacteria 27560
96 Ga0207709_10008364 3300025935 Bacteria 5725
97 Ga0207709_10078363 3300025935 Bacteria 2121
98 Ga0207704_10214226 3300025938 Bacteria 1420
99 Ga0207665_10015084 3300025939 Bacteria 5073
100 Ga0207665_10143701 3300025939 Bacteria 1704
101 Ga0207661_10123983 3300025944 Bacteria 2204
102 Ga0207712_10459618 3300025961 Bacteria 1081
103 Ga0207658_10001310 3300025986 Bacteria 19633
104 Ga0207677_10271385 3300026023 Bacteria 1388
105 Ga0207678_10045301 3300026067 Bacteria 3804
106 Ga0207648_10000243 3300026089 Bacteria 58746
107 Ga0207648_10003157 3300026089 Bacteria 17364
108 Ga0207674_10055677 3300026116 Bacteria 4020
109 Ga0207674_10075962 3300026116 Bacteria 3369
110 Ga0207683_10034605 3300026121 Bacteria 4391
111 Ga0207698_10032612 3300026142 Bacteria 3776
112 Ga0207698_10038392 3300026142 Bacteria 3538
113 Ga0207698_10121095 3300026142 Bacteria 2215
114 Ga0209813_10053953 3300027866 Bacteria 1265
115 Ga0268266_10241065 3300028379 Bacteria 1669
116 Ga0307517_10004774 3300028786 Bacteria 20694
117 Ga0307517_10081549 3300028786 Bacteria 2756
118 Ga0307517_10100404 3300028786 Bacteria 2286
119 Ga0307517_10184892 3300028786 Bacteria 1336
120 Ga0307515_10000093 3300028794 Bacteria 212053
121 Ga0307515_10000110 3300028794 Bacteria 195560
122 Ga0307515_10000521 3300028794 Bacteria 91558
123 Ga0307515_10014947 3300028794 Bacteria 14342
124 Ga0307515_10020162 3300028794 Bacteria 11919
125 Ga0307515_10026895 3300028794 Bacteria 9868
126 Ga0307515_10071573 3300028794 Bacteria 4697
127 Ga0307515_10110938 3300028794 Bacteria 3205
128 Ga0265331_10003373 3300031250 Bacteria 10353
129 Ga0265327_10000020 3300031251 Bacteria 424552
130 Ga0307513_10151172 3300031456 Unclassified 2230
131 Ga0307509_10001461 3300031507 Bacteria 40003
132 Ga0307509_10008460 3300031507 Bacteria 13108
133 Ga0307509_10064531 3300031507 Bacteria 3851
134 Ga0307509_10069865 3300031507 Bacteria 3669
135 Ga0307509_10071888 3300031507 Bacteria 3606
136 Ga0307509_10077041 3300031507 Bacteria 3457
137 Ga0307508_10000150 3300031616 Bacteria 83110
138 Ga0307508_10003770 3300031616 Bacteria 15140
139 Ga0307508_10005377 3300031616 Bacteria 12191
140 Ga0307508_10012427 3300031616 Bacteria 7784
141 Ga0307508_10095975 3300031616 Bacteria 2556
142 Ga0307514_10000780 3300031649 Bacteria 52828
143 Ga0307514_10003863 3300031649 Bacteria 14082
144 Ga0307514_10006326 3300031649 Bacteria 10346
145 Ga0307514_10097720 3300031649 Bacteria 2118
146 Ga0307516_10092122 3300031730 Bacteria 2858
147 Ga0307516_10164842 3300031730 Bacteria 1962
148 Ga0307516_10273970 3300031730 Bacteria 1372
149 Ga0307409_100168679 3300031995 Bacteria 1924
150 Ga0307411_10000368 3300032005 Bacteria 15274
151 Ga0307507_10029743 3300033179 Bacteria 5783
152 Ga0307507_10053118 3300033179 Bacteria 3875
153 Ga0307510_10000360 3300033180 Bacteria 42908
154 Ga0307510_10013533 3300033180 Bacteria 9677
155 Ga0307510_10078519 3300033180 Bacteria 3227
156 Ga0307510_10099867 3300033180 Bacteria 2698
157 Ga0307510_10128302 3300033180 Bacteria 2218
158 Ga0307510_10240009 3300033180 Bacteria 1307
159 Ga0373943_0030701 3300035170 Bacteria 2545
160 Ga0373924_0005011 3300035410 Bacteria 4662
161 Ga0373931_0021283 3300035691 Bacteria 3253
162 Ga0373927_0109513 3300035695 Bacteria 1799
163 Ga0373947_0059601 3300035725 Bacteria 2314
164 Ga0395900_0017145 3300037418 Bacteria 7392
165 Ga0395905_0002635 3300037471 Bacteria 19696
166 Ga0395905_0009501 3300037471 Bacteria 9503
167 Ga0395905_0025365 3300037471 Bacteria 5590
168 Ga0436361_0224989 3300039447 Bacteria 10880
169 Ga0436361_0694787 3300039447 Bacteria 33732
170 Ga0439449_0000524 3300042007 Bacteria 14275
171 Ga0450911_005505 3300042115 Bacteria 1961
172 Ga0450912_001836 3300042116 Bacteria 1355
173 Ga0450919_000919 3300042121 Bacteria 3812
174 Ga0450888_000044 3300042126 Bacteria 8907
175 Ga0450890_001995 3300042127 Bacteria 2878
176 Ga0450891_000948 3300042129 Bacteria 3027
177 Ga0450898_002163 3300042134 Bacteria 2720
178 Ga0450903_004970 3300042138 Bacteria 2240
179 Ga0450889_004449 3300042144 Bacteria 1386
180 Ga0439434_0031687 3300042435 Bacteria 1608
181 Ga0439464_0001135 3300042439 Bacteria 6168
182 Ga0450918_000028 3300042531 Bacteria 30240
183 Ga0451577_0000031 3300042876 Bacteria 388524
184 Ga0466969_0013317 3300044656 Bacteria 4331
185 Ga0466972_0001039 3300044658 Bacteria 13334
186 Ga0466972_0006603 3300044658 Bacteria 5826
187 Ga0466965_0005703 3300044683 Bacteria 5616
188 Ga0466966_0066790 3300044684 Bacteria 2259
189 Ga0466961_0047574 3300044693 Bacteria 2742
190 Ga0466961_0071848 3300044693 Bacteria 2195
191 Ga0466961_0174656 3300044693 Bacteria 1335
192 Ga0466963_0002273 3300044694 Bacteria 10673
193 Ga0466964_0020755 3300044706 Bacteria 2532
194 Ga0453684_0008697 3300044712 Bacteria 18059
195 Ga0453684_0030271 3300044712 Bacteria 7653
196 Ga0466971_0050975 3300044719 Bacteria 1862
197 Ga0466970_0013279 3300044765 Bacteria 4221
198 Ga0466959_0000197 3300045049 Bacteria 39640
199 Ga0466959_0043460 3300045049 Bacteria 3312
200 Ga0451576_0065465 3300045051 Bacteria 3784
201 Ga0451576_0318744 3300045051 Bacteria 1627
202 Ga0451576_0442951 3300045051 Bacteria 1363
203 Ga0466967_0082490 3300045976 Bacteria 2905
204 Ga0495592_0000145 3300046454 Bacteria 62850
205 Ga0495632_0009866 3300046519 Bacteria 5710
206 Ga0495632_0027994 3300046519 Bacteria 2944
207 Ga0495645_0013857 3300046543 Bacteria 5715
208 Ga0495625_0035048 3300046660 Bacteria 3701
209 Ga0495624_0048260 3300046690 Bacteria 2703
210 Ga0495649_0016275 3300046694 Bacteria 4216
211 Ga0495660_0050618 3300046810 Bacteria 2262
212 Ga0495687_001992 3300047443 Bacteria 17348
213 Ga0495687_012487 3300047443 Bacteria 4486
214 Ga0495687_013191 3300047443 Bacteria 4325
215 Ga0496102_0077260 3300048905 Bacteria 3064
216 Ga0496103_0075523 3300048906 Bacteria 2114
217 Ga0496107_0188500 3300048910 Bacteria 1532
218 Ga0496112_0362344 3300048915 Bacteria 1392
219 Ga0501047_0112563 3300049581 Bacteria 2604
220 Ga0501211_001515 3300049658 Bacteria 2488
221 Ga0501221_000227 3300049704 Bacteria 8057
222 Ga0501229_002005 3300049706 Bacteria 2392
223 nmdc:mga03683_13182_c1 3300050489 Bacteria 3036
224 nmdc:mga00v17_36808_c1 3300050491 Bacteria 2919
225 nmdc:mga0yw44_32996_c1 3300050492 Bacteria 3021
226 nmdc:mga0k408_146058_c1 3300050493 Bacteria 1408
227 nmdc:mga0k408_29244_c1 3300050493 Bacteria 3136
228 nmdc:mga0k408_31269_c2 3300050493 Bacteria 2089
229 nmdc:mga0k408_4153_c1 3300050493 Bacteria 7690
230 nmdc:mga0k408_6734_c1 3300050493 Bacteria 6130
231 nmdc:mga0k408_7545_c1 3300050493 Bacteria 5810
232 nmdc:mga0k408_7844_c1 3300050493 Bacteria 5709
233 nmdc:mga06z11_70817_c1 3300050494 Bacteria 1844
234 nmdc:mga07m45_11786_c1 3300050496 Bacteria 4602
235 nmdc:mga07m45_16713_c1 3300050496 Bacteria 3930
236 nmdc:mga07m45_3213_c1 3300050496 Bacteria 7839
237 nmdc:mga07m45_34888_c1 3300050496 Bacteria 2797
238 nmdc:mga07m45_6636_c1 3300050496 Bacteria 3945
239 nmdc:mga07m45_6934_c1 3300050496 Bacteria 5763
240 nmdc:mga07m45_8791_c1 3300050496 Bacteria 5207
241 nmdc:mga07m45_9371_c1 3300050496 Bacteria 5077
242 nmdc:mga09592_22946_c1 3300050508 Bacteria 5149
243 nmdc:mga0n895_240284_c1 3300050512 Bacteria 1838
244 nmdc:mga08x19_23043_c1 3300050514 Bacteria 3861
245 nmdc:mga0a205_42228_c1 3300050515 Bacteria 4393
246 Ga0500578_0085248 3300053086 Bacteria 2007
247 Ga0500644_0014861 3300053088 Bacteria 2206
248 Ga0500651_0012909 3300053093 Bacteria 5075
249 Ga0500650_0074056 3300053098 Bacteria 1592
250 Ga0500628_001689 3300053129 Bacteria 3729
251 Ga0500652_000630 3300053131 Bacteria 12093
252 Ga0500655_010612 3300053133 Bacteria 1664
253 Ga0500559_0000107 3300053136 Bacteria 65560
254 Ga0500622_0003559 3300053156 Bacteria 10296
255 Ga0500622_0034687 3300053156 Bacteria 2642
256 Ga0500587_003639 3300053739 Bacteria 2143
257 2587725442 2585428057 Bacteria 6737412
258 2587737027 2585428058 Bacteria 6853932
259 2588294317 2588253510 Bacteria 6901809
260 2643746732 2643221544 Bacteria 5886209
261 2643933825 2643221585 Bacteria 5812563
262 2643968563 2643221592 Bacteria 6608788
263 2644140645 2643221625 Bacteria 6512927
264 2644218822 2643221639 Bacteria 6649903
265 2644272835 2643221648 Bacteria 6521465
266 2644315319 2643221656 Bacteria 5809961
267 3007867657 3007866637 Bacteria 5899198
268 8057163825 8057160832 Bacteria 3268302
269 Ga0395905_0002906
270 JGI25152J39213_1003717
271 JGI25153J46596_10001057
272 JGI25153J46596_10004755
273 rootH1_10064001
274 rootL2_10025756
275 Ga0055525_1000222
276 Ga0055526_1005017
277 Ga0055530_10011803
278 Ga0055531_10000513
279 Ga0070682_100066693
280 Ga0070692_10063324
281 Ga0070667_100008719
282 Ga0070667_100180260
283 Ga0070709_10001056
284 Ga0070714_100002565
285 Ga0070710_10044630
286 Ga0070705_100129532
287 Ga0070708_100133485
288 Ga0070708_100160327
289 Ga0070662_100009371
290 Ga0070662_100086508
291 Ga0070662_100148132
292 Ga0068867_100000083
293 Ga0068867_100048785
294 Ga0070706_100280846
295 Ga0070707_100100654
296 Ga0070698_100206605
297 Ga0070699_100077303
298 Ga0070679_100131520
299 Ga0070697_100027990
300 Ga0070704_100018299
301 Ga0068857_100015430
302 Ga0075365_10005572
303 Ga0075365_10027973
304 Ga0075368_10009936
305 Ga0075363_100010376
306 Ga0075363_100083347
307 Ga0070716_100059268
308 Ga0075362_10012181
309 Ga0075367_10006653
310 Ga0075370_10015296
311 Ga0075433_10036728
312 Ga0075434_100071949
313 Ga0075429_100007851
314 Ga0075436_100008551
315 Ga0075435_100022703
316 Ga0105240_10013307
317 Ga0105240_10035441
318 Ga0105243_10000919
319 Ga0105243_10015671
320 Ga0105243_10064536
321 Ga0105243_10197919
322 Ga0105237_10003357
323 Ga0105238_10030082
324 Ga0105238_10054287
325 Ga0105239_10003475
326 Ga0157370_10023081
327 Ga0157375_10467457
328 Ga0157377_10000104
329 Ga0157377_10000546
330 Ga0213872_10000045
331 Ga0213872_10001196
332 Ga0209563_100088
333 Ga0207425_1001190
334 Ga0209129_1000481
335 Ga0209673_1005064
336 Ga0209673_1029679
337 Ga0209673_1038628
338 Ga0209564_1001182
339 Ga0209758_1000859
340 Ga0209758_1001201
341 Ga0209050_1000706
342 Ga0209050_1006687
343 Ga0209256_1036066
344 Ga0209051_1000833
345 Ga0209257_1000161
346 Ga0209257_1001107
347 Ga0209257_1024437
348 Ga0207692_10017293
349 Ga0207705_10153313
350 Ga0207684_10188210
351 Ga0207695_10013742
352 Ga0207695_10209599
353 Ga0207671_10036894
354 Ga0207693_10008099
355 Ga0207663_10061390
356 Ga0207657_10026339
357 Ga0207646_10001282
358 Ga0207664_10004507
359 Ga0207706_10002534
360 Ga0207706_10002795
361 Ga0207706_10172358
362 Ga0207706_10206469
363 Ga0207709_10000675
364 Ga0207709_10008364
365 Ga0207709_10078363
366 Ga0207704_10214226
367 Ga0207665_10015084
368 Ga0207665_10143701
369 Ga0207661_10123983
370 Ga0207712_10459618
371 Ga0207658_10001310
372 Ga0207677_10271385
373 Ga0207678_10045301
374 Ga0207648_10000243
375 Ga0207648_10003157
376 Ga0207674_10055677
377 Ga0207674_10075962
378 Ga0207683_10034605
379 Ga0207698_10032612
380 Ga0207698_10038392
381 Ga0207698_10121095
382 Ga0209813_10053953
383 Ga0268266_10241065
384 Ga0307517_10004774
385 Ga0307517_10081549
386 Ga0307517_10100404
387 Ga0307517_10184892
388 Ga0307515_10000093
389 Ga0307515_10000110
390 Ga0307515_10000521
391 Ga0307515_10014947
392 Ga0307515_10020162
393 Ga0307515_10026895
394 Ga0307515_10071573
395 Ga0307515_10110938
396 Ga0265331_10003373
397 Ga0265327_10000020
398 Ga0307513_10151172
399 Ga0307509_10001461
400 Ga0307509_10008460
401 Ga0307509_10064531
402 Ga0307509_10069865
403 Ga0307509_10071888
404 Ga0307509_10077041
405 Ga0307508_10000150
406 Ga0307508_10003770
407 Ga0307508_10005377
408 Ga0307508_10012427
409 Ga0307508_10095975
410 Ga0307514_10000780
411 Ga0307514_10003863
412 Ga0307514_10006326
413 Ga0307514_10097720
414 Ga0307516_10092122
415 Ga0307516_10164842
416 Ga0307516_10273970
417 Ga0307409_100168679
418 Ga0307411_10000368
419 Ga0307507_10029743
420 Ga0307507_10053118
421 Ga0307510_10000360
422 Ga0307510_10013533
423 Ga0307510_10078519
424 Ga0307510_10099867
425 Ga0307510_10128302
426 Ga0307510_10240009
427 Ga0373943_0030701
428 Ga0373924_0005011
429 Ga0373931_0021283
430 Ga0373927_0109513
431 Ga0373947_0059601
432 Ga0395900_0017145
433 Ga0395905_0002635
434 Ga0395905_0009501
435 Ga0395905_0025365
436 Ga0436361_0224989
437 Ga0436361_0694787
438 Ga0439449_0000524
439 Ga0450911_005505
440 Ga0450912_001836
441 Ga0450919_000919
442 Ga0450888_000044
443 Ga0450890_001995
444 Ga0450891_000948
445 Ga0450898_002163
446 Ga0450903_004970
447 Ga0450889_004449
448 Ga0439434_0031687
449 Ga0439464_0001135
450 Ga0450918_000028
451 Ga0451577_0000031
452 Ga0466969_0013317
453 Ga0466972_0001039
454 Ga0466972_0006603
455 Ga0466965_0005703
456 Ga0466966_0066790
457 Ga0466961_0047574
458 Ga0466961_0071848
459 Ga0466961_0174656
460 Ga0466963_0002273
461 Ga0466964_0020755
462 Ga0453684_0008697
463 Ga0453684_0030271
464 Ga0466971_0050975
465 Ga0466970_0013279
466 Ga0466959_0000197
467 Ga0466959_0043460
468 Ga0451576_0065465
469 Ga0451576_0318744
470 Ga0451576_0442951
471 Ga0466967_0082490
472 Ga0495592_0000145
473 Ga0495632_0009866
474 Ga0495632_0027994
475 Ga0495645_0013857
476 Ga0495625_0035048
477 Ga0495624_0048260
478 Ga0495649_0016275
479 Ga0495660_0050618
480 Ga0495687_001992
481 Ga0495687_012487
482 Ga0495687_013191
483 Ga0496102_0077260
484 Ga0496103_0075523
485 Ga0496107_0188500
486 Ga0496112_0362344
487 Ga0501047_0112563
488 Ga0501211_001515
489 Ga0501221_000227
490 Ga0501229_002005
491 nmdc:mga03683_13182_c1
492 nmdc:mga00v17_36808_c1
493 nmdc:mga0yw44_32996_c1
494 nmdc:mga0k408_146058_c1
495 nmdc:mga0k408_29244_c1
496 nmdc:mga0k408_31269_c2
497 nmdc:mga0k408_4153_c1
498 nmdc:mga0k408_6734_c1
499 nmdc:mga0k408_7545_c1
500 nmdc:mga0k408_7844_c1
501 nmdc:mga06z11_70817_c1
502 nmdc:mga07m45_11786_c1
503 nmdc:mga07m45_16713_c1
504 nmdc:mga07m45_3213_c1
505 nmdc:mga07m45_34888_c1
506 nmdc:mga07m45_6636_c1
507 nmdc:mga07m45_6934_c1
508 nmdc:mga07m45_8791_c1
509 nmdc:mga07m45_9371_c1
510 nmdc:mga09592_22946_c1
511 nmdc:mga0n895_240284_c1
512 nmdc:mga08x19_23043_c1
513 nmdc:mga0a205_42228_c1
514 Ga0500578_0085248
515 Ga0500644_0014861
516 Ga0500651_0012909
517 Ga0500650_0074056
518 Ga0500628_001689
519 Ga0500652_000630
520 Ga0500655_010612
521 Ga0500559_0000107
522 Ga0500622_0003559
523 Ga0500622_0034687
524 Ga0500587_003639
525 2587725442
526 2587737027
527 2588294317
528 2643746732
529 2643933825
530 2643968563
531 2644140645
532 2644218822
533 2644272835
534 2644315319
535 3007867657
536 8057163825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

56

179

0.96

PF01380

SIS

SIS domain

219

310

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fj1-assembly2.cif.gz_C crystal structure of putative phosphosugar isomerase (yp_167080.1) from silicibacter pomeroyi dss-3 at 1.75 a resolution 0.9306 9 313
7kqa-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia 0.9122 8 321
8fdb-assembly1.cif.gz_B crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. 0.8938 8 325
7kqa-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deanimase from strenotrophomonas maltophilia 0.8798 8 321
7dnr-assembly1.cif.gz_B crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. coli 0.875 11 313
ID Description Score Start End Superfamily
3fj1C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9135 10 171 3.40.50.10490
3hbaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.901 183 309 3.40.50.10490
3hbaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8827 10 175 3.40.50.10490
3euaH03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.882 188 275 3.40.50.12570
af_Q19699_551_710_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8789 178 325 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A326KCL7-F1-model_v4 deleted 0.9589 8 129
AF-A0A6L8CZQ2-F1-model_v4 deleted 0.9466 12 325
AF-A0A529Y4G8-F1-model_v4 SIS domain-containing protein 0.9442 5 142 GO:0008483
GO:0097367
GO:1901135
AF-A0A4R7WZ33-F1-model_v4 deleted 0.9428 9 325
AF-A0A525I6I2-F1-model_v4 SIS domain-containing protein 0.9421 9 325 GO:0008483
GO:0097367
GO:1901135

Map