F375716

General Info

Members Datasets Scaffolds Average Seq Length
268 201 536 201

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0001469|Ga0495651_0001469_11433_12158
Length 241
Sequence LAEPESHFILIPANYTGVLKAPMHLTDHEVIAMSQQLSEDGLDLLFFKARTHNAWLEKPVGDDILRRLYDVMKWGPTSANCSPARILFLRTPEAKERLRPALAPGNVDKTMAAPVTAIIGYDGKFYEQLPKLFPHADARAWFADTPELAEVTARRNSSLQGAYFMLAARALGLDCGPMSGFDQVKVDHEFFPVTKPLNFEYEYFPDSHIKTNFLCNLGYGDPDKLFPRSPRLDFDEACKLL

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
194 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
195 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
196 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
197 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
198 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
199 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
200 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
201 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 0.37
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 1.12
Rhizoplane 1.12
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0001469 3300046462 Bacteria 18227
2 rootH2_10144902 3300003320 Bacteria 3227
3 Ga0007409J51694_1103739 3300003575 Bacteria 830
4 Ga0070666_10000688 3300005335 Bacteria 20504
5 Ga0070680_100143152 3300005336 Bacteria 2005
6 Ga0068868_100701906 3300005338 Bacteria 905
7 Ga0070661_100045087 3300005344 Bacteria 3223
8 Ga0070667_100010970 3300005367 Bacteria 7491
9 Ga0070709_10031499 3300005434 Bacteria 3190
10 Ga0070713_100263215 3300005436 Bacteria 1576
11 Ga0070711_100005665 3300005439 Bacteria 7483
12 Ga0070711_100418625 3300005439 Bacteria 1091
13 Ga0070662_100009659 3300005457 Bacteria 6311
14 Ga0068853_100152689 3300005539 Bacteria 2079
15 Ga0070672_100004136 3300005543 Bacteria 9470
16 Ga0070665_100139921 3300005548 Bacteria 2424
17 Ga0070665_100947328 3300005548 Bacteria 873
18 Ga0070704_100533491 3300005549 Bacteria 1023
19 Ga0068855_100003662 3300005563 Bacteria 18790
20 Ga0068855_100245473 3300005563 Bacteria 1999
21 Ga0068857_100012909 3300005577 Bacteria 7278
22 Ga0068854_100002522 3300005578 Bacteria 11340
23 Ga0068856_100053587 3300005614 Bacteria 3977
24 Ga0068851_10012403 3300005834 Bacteria 4017
25 Ga0070717_10111972 3300006028 Bacteria 2329
26 Ga0075365_10044016 3300006038 Bacteria 2924
27 Ga0075435_100843920 3300007076 Bacteria 798
28 Ga0105240_10000055 3300009093 Bacteria 225380
29 Ga0105240_10001159 3300009093 Bacteria 46178
30 Ga0105240_10004926 3300009093 Bacteria 20074
31 Ga0105240_10084114 3300009093 Bacteria 3902
32 Ga0105240_10094861 3300009093 Bacteria 3639
33 Ga0111539_10743760 3300009094 Bacteria 1141
34 Ga0105247_11057276 3300009101 Bacteria 638
35 Ga0105243_10000294 3300009148 Bacteria 55103
36 Ga0105248_10012231 3300009177 Bacteria 9463
37 Ga0105248_10430804 3300009177 Bacteria 1485
38 Ga0105248_10456772 3300009177 Bacteria 1440
39 Ga0105237_10043063 3300009545 Bacteria 4550
40 Ga0105238_10011994 3300009551 Bacteria 8730
41 Ga0105238_10031939 3300009551 Bacteria 5357
42 Ga0105238_10065565 3300009551 Bacteria 3633
43 Ga0105249_11479242 3300009553 Unclassified 751
44 Ga0105239_10016401 3300010375 Bacteria 8193
45 Ga0105239_10081424 3300010375 Bacteria 3564
46 Ga0105239_10560837 3300010375 Bacteria 1301
47 Ga0157373_10034877 3300013100 Bacteria 3614
48 Ga0157370_10216381 3300013104 Bacteria 1775
49 Ga0157369_10007696 3300013105 Bacteria 12397
50 Ga0157374_10147675 3300013296 Bacteria 2284
51 Ga0157378_10130508 3300013297 Bacteria 2326
52 Ga0157379_10052705 3300014968 Bacteria 3634
53 Ga0182007_10004786 3300015262 Bacteria 6077
54 Ga0213872_10000234 3300021361 Bacteria 48837
55 Ga0213876_10004730 3300021384 Bacteria 7569
56 Ga0213875_10013271 3300021388 Bacteria 4051
57 Ga0209129_1030876 3300025258 Bacteria 895
58 Ga0209564_1045659 3300025295 Bacteria 1125
59 Ga0209758_1020531 3300025297 Bacteria 3121
60 Ga0209051_1028457 3300025303 Bacteria 2206
61 Ga0207680_10008577 3300025903 Bacteria 5027
62 Ga0207699_10090962 3300025906 Bacteria 1915
63 Ga0207699_10350536 3300025906 Bacteria 1042
64 Ga0207654_10000811 3300025911 Bacteria 17219
65 Ga0207695_10000012 3300025913 Bacteria 840961
66 Ga0207695_10004350 3300025913 Bacteria 19398
67 Ga0207695_10010357 3300025913 Bacteria 11410
68 Ga0207695_10018535 3300025913 Bacteria 8043
69 Ga0207695_10172304 3300025913 Bacteria 2089
70 Ga0207671_10037907 3300025914 Bacteria 3574
71 Ga0207663_10022761 3300025916 Bacteria 3587
72 Ga0207649_10014906 3300025920 Bacteria 4361
73 Ga0207694_10000006 3300025924 Bacteria 631109
74 Ga0207694_10001415 3300025924 Bacteria 20567
75 Ga0207694_10251621 3300025924 Bacteria 1446
76 Ga0207700_10144781 3300025928 Bacteria 1957
77 Ga0207700_10594603 3300025928 Bacteria 984
78 Ga0207706_10000499 3300025933 Bacteria 41776
79 Ga0207709_10000180 3300025935 Bacteria 84481
80 Ga0207691_10029217 3300025940 Bacteria 5157
81 Ga0207711_10011682 3300025941 Bacteria 7296
82 Ga0207689_10066694 3300025942 Bacteria 2958
83 Ga0207667_10000026 3300025949 Bacteria 343713
84 Ga0207667_10011741 3300025949 Bacteria 10158
85 Ga0207667_11095801 3300025949 Bacteria 780
86 Ga0207658_10037608 3300025986 Bacteria 3479
87 Ga0207639_10191244 3300026041 Bacteria 1748
88 Ga0207678_10214185 3300026067 Bacteria 1648
89 Ga0207702_10000003 3300026078 Bacteria 434196
90 Ga0207674_10009035 3300026116 Bacteria 11446
91 Ga0207698_10021288 3300026142 Bacteria 4481
92 Ga0209588_1012718 3300027671 Bacteria 2558
93 Ga0209974_10118070 3300027876 Bacteria 938
94 Ga0268266_10129625 3300028379 Bacteria 2254
95 Ga0268266_10787246 3300028379 Bacteria 918
96 Ga0265338_10506234 3300028800 Bacteria 850
97 Ga0265330_10113075 3300031235 Bacteria 1159
98 Ga0265325_10045089 3300031241 Bacteria 2292
99 Ga0265340_10054939 3300031247 Bacteria 1920
100 Ga0265339_10001920 3300031249 Bacteria 15256
101 Ga0265339_10037479 3300031249 Bacteria 2709
102 Ga0265331_10111028 3300031250 Bacteria 1257
103 Ga0265327_10004841 3300031251 Bacteria 11669
104 Ga0265313_10004154 3300031595 Bacteria 11251
105 Ga0265313_10125688 3300031595 Bacteria 1115
106 Ga0265314_10006177 3300031711 Bacteria 10639
107 Ga0265314_10218055 3300031711 Bacteria 1115
108 Ga0307516_10058198 3300031730 Bacteria 3763
109 Ga0307516_10737696 3300031730 Bacteria 644
110 Ga0307413_10694238 3300031824 Bacteria 845
111 Ga0307412_10364871 3300031911 Bacteria 1164
112 Ga0307416_100483578 3300032002 Bacteria 1299
113 Ga0316583_10054049 3300032133 Bacteria 1412
114 Ga0373923_0028002 3300035111 Bacteria 2252
115 Ga0373953_0346117 3300035117 Bacteria 651
116 Ga0373954_0144543 3300035118 Bacteria 1161
117 Ga0373956_0054492 3300035119 Bacteria 1802
118 Ga0373957_0042734 3300035120 Bacteria 1711
119 Ga0373955_0150708 3300035172 Bacteria 1369
120 Ga0373935_0280367 3300035692 Bacteria 1173
121 Ga0373927_0017379 3300035695 Bacteria 4733
122 Ga0373933_0238246 3300035724 Bacteria 1170
123 Ga0373937_0032478 3300036401 Bacteria 4735
124 Ga0373937_0243856 3300036401 Bacteria 1693
125 Ga0373937_0321218 3300036401 Bacteria 1465
126 Ga0373925_0019751 3300037068 Bacteria 4904
127 Ga0373925_0197976 3300037068 Bacteria 1597
128 Ga0395899_0028345 3300037312 Bacteria 4218
129 Ga0395900_0033400 3300037418 Bacteria 5295
130 Ga0395900_0087799 3300037418 Bacteria 3196
131 Ga0395898_0179516 3300037466 Bacteria 2023
132 Ga0395898_0227720 3300037466 Bacteria 1778
133 Ga0395898_0633555 3300037466 Bacteria 1012
134 Ga0395905_0000455 3300037471 Bacteria 57161
135 Ga0395905_0099672 3300037471 Bacteria 2728
136 Ga0436364_1264487 3300037853 Bacteria 2161
137 Ga0395901_0003454 3300038443 Bacteria 15926
138 Ga0395901_0014901 3300038443 Bacteria 7899
139 Ga0395901_0107036 3300038443 Bacteria 2935
140 Ga0436365_1798326 3300039437 Bacteria 9165
141 Ga0436362_1026695 3300039453 Bacteria 729
142 Ga0439436_0002965 3300041404 Bacteria 5144
143 Ga0439438_002103 3300041405 Bacteria 8588
144 Ga0439447_004532 3300041407 Bacteria 4755
145 Ga0439466_0004409 3300041411 Bacteria 5421
146 Ga0439431_0018041 3300041997 Bacteria 1666
147 Ga0439432_050486 3300042006 Bacteria 1298
148 Ga0439446_0032615 3300042156 Bacteria 1511
149 Ga0439434_0022968 3300042435 Bacteria 1876
150 Ga0439444_0008884 3300042437 Bacteria 1574
151 Ga0439460_0004104 3300042461 Bacteria 3539
152 Ga0466972_0037044 3300044658 Bacteria 2384
153 Ga0466966_0000687 3300044684 Bacteria 21520
154 Ga0466963_0014486 3300044694 Bacteria 4862
155 Ga0466964_0327289 3300044706 Bacteria 780
156 Ga0466971_0009479 3300044719 Bacteria 4250
157 Ga0466968_0387118 3300044735 Bacteria 684
158 Ga0466970_0005981 3300044765 Bacteria 6061
159 Ga0466957_0127096 3300044842 Bacteria 1629
160 Ga0466959_0000287 3300045049 Bacteria 30550
161 Ga0466967_0075043 3300045976 Bacteria 3038
162 Ga0495592_0018724 3300046454 Bacteria 5270
163 Ga0495603_0001359 3300046455 Bacteria 14209
164 Ga0495638_0194415 3300046460 Bacteria 1149
165 Ga0495641_0005981 3300046461 Bacteria 8017
166 Ga0495641_0124496 3300046461 Bacteria 1150
167 Ga0495580_0001360 3300046472 Bacteria 21507
168 Ga0495580_0004454 3300046472 Bacteria 11770
169 Ga0495580_0007757 3300046472 Bacteria 8602
170 Ga0495582_0009737 3300046473 Bacteria 5293
171 Ga0495662_0003877 3300046476 Bacteria 7545
172 Ga0495594_0114738 3300046499 Bacteria 1520
173 Ga0495583_0000247 3300046506 Bacteria 89254
174 Ga0495606_0006132 3300046507 Bacteria 11216
175 Ga0495606_0007056 3300046507 Bacteria 10175
176 Ga0495618_0001711 3300046514 Bacteria 14562
177 Ga0495628_0000750 3300046516 Bacteria 29958
178 Ga0495628_0008784 3300046516 Bacteria 8646
179 Ga0495630_0013697 3300046517 Bacteria 5895
180 Ga0495643_0154917 3300046522 Bacteria 1132
181 Ga0495648_0017131 3300046524 Bacteria 5191
182 Ga0495648_0078261 3300046524 Bacteria 1892
183 Ga0495666_0001217 3300046526 Bacteria 12437
184 Ga0495666_0006958 3300046526 Bacteria 5683
185 Ga0495652_0012363 3300046529 Bacteria 7703
186 Ga0495652_0058269 3300046529 Bacteria 3271
187 Ga0495652_0152745 3300046529 Bacteria 1801
188 Ga0495665_0009512 3300046531 Bacteria 5263
189 Ga0495665_0012417 3300046531 Bacteria 4609
190 Ga0495640_0004292 3300046533 Bacteria 11381
191 Ga0495586_0000966 3300046535 Bacteria 16281
192 Ga0495586_0068355 3300046535 Bacteria 1938
193 Ga0495587_0000560 3300046536 Bacteria 25628
194 Ga0495645_0030027 3300046543 Bacteria 3959
195 Ga0495645_0031730 3300046543 Bacteria 3850
196 Ga0495622_0101876 3300046557 Bacteria 1316
197 Ga0495622_0249612 3300046557 Bacteria 781
198 Ga0495656_0160371 3300046615 Bacteria 1093
199 Ga0495634_0000146 3300046642 Bacteria 63192
200 Ga0495611_0003524 3300046648 Bacteria 6892
201 Ga0495611_0041759 3300046648 Bacteria 2046
202 Ga0495625_0001000 3300046660 Bacteria 37446
203 Ga0495635_0325110 3300046663 Bacteria 1029
204 Ga0495661_0009799 3300046665 Bacteria 6555
205 Ga0495623_0010551 3300046679 Bacteria 5978
206 Ga0495623_0063057 3300046679 Bacteria 2322
207 Ga0495646_0022198 3300046680 Bacteria 4004
208 Ga0495646_0028389 3300046680 Bacteria 3503
209 Ga0495613_0052500 3300046689 Bacteria 3002
210 Ga0495581_0008431 3300047315 Bacteria 5976
211 Ga0495604_0003360 3300047317 Bacteria 12762
212 Ga0495604_0080882 3300047317 Bacteria 2433
213 Ga0495636_0150326 3300047318 Bacteria 1045
214 Ga0495674_0012277 3300047319 Bacteria 8074
215 Ga0495674_0012740 3300047319 Bacteria 7922
216 Ga0495676_0114539 3300047321 Bacteria 1972
217 Ga0495680_0015585 3300047322 Bacteria 6555
218 Ga0495680_0041192 3300047322 Bacteria 3674
219 Ga0495675_0025107 3300047444 Bacteria 3800
220 Ga0495679_002873 3300047446 Bacteria 8536
221 Ga0495684_0008525 3300047471 Bacteria 7937
222 Ga0495684_0063264 3300047471 Bacteria 2813
223 Ga0495684_0201194 3300047471 Bacteria 1468
224 Ga0495602_0005099 3300048088 Bacteria 13757
225 Ga0495602_0244917 3300048088 Bacteria 1339
226 Ga0495602_0310471 3300048088 Bacteria 1151
227 Ga0495602_0466947 3300048088 Bacteria 888
228 Ga0495614_0018666 3300048089 Bacteria 3003
229 Ga0495626_0037455 3300048091 Bacteria 2305
230 Ga0496102_0037836 3300048905 Bacteria 4353
231 Ga0496105_0085513 3300048908 Bacteria 2606
232 Ga0496115_0105091 3300048918 Bacteria 2317
233 Ga0496118_0086470 3300048921 Bacteria 2178
234 Ga0496118_0107896 3300048921 Bacteria 1858
235 Ga0496121_0010568 3300048924 Bacteria 10377
236 Ga0496121_0036746 3300048924 Bacteria 4360
237 Ga0496122_0000351 3300048925 Bacteria 99357
238 Ga0496123_0000283 3300048926 Bacteria 99808
239 Ga0496124_0072460 3300048927 Bacteria 2853
240 Ga0496125_0004238 3300048928 Bacteria 16711
241 Ga0496126_0401714 3300048929 Bacteria 1111
242 Ga0495682_0007439 3300049460 Bacteria 4357
243 Ga0495682_0176588 3300049460 Bacteria 759
244 Ga0501075_0140226 3300049591 Bacteria 1842
245 nmdc:mga0rr50_567911_c1 3300050513 Bacteria 966
246 Ga0495601_0573177 3300053077 Bacteria 725
247 Ga0495612_0096232 3300053078 Bacteria 1258
248 Ga0500610_0234702 3300053079 Bacteria 858
249 Ga0500643_006226 3300053087 Bacteria 5015
250 Ga0500643_013224 3300053087 Bacteria 2922
251 Ga0500641_0093114 3300053096 Bacteria 1288
252 Ga0500555_008525 3300053103 Bacteria 2924
253 Ga0500555_012645 3300053103 Bacteria 2431
254 Ga0500595_005906 3300053119 Bacteria 5270
255 Ga0500595_017796 3300053119 Bacteria 2614
256 Ga0500642_0104293 3300053130 Bacteria 1321
257 Ga0500616_0000006 3300053153 Bacteria 944738
258 Ga0500637_0161669 3300053178 Bacteria 1290
259 Ga0530510_0603726 3300061734 Bacteria 835
260 2563062249 2562617112 Bacteria 10918404
261 2713477900 2711768613 Bacteria 11048459
262 2765570414 2765235838 Bacteria 5445269
263 2839097960 2839094727 Bacteria 5534556
264 2884811956 2884811622 Bacteria 5552861
265 2884840140 2884836552 Bacteria 5219991
266 2884857093 2884852848 Bacteria 5221161
267 2896157679 2896154374 Bacteria 5221518
268 8024490578 8024486573 Bacteria 6540512
269 Ga0495651_0001469
270 rootH2_10144902
271 Ga0007409J51694_1103739
272 Ga0070666_10000688
273 Ga0070680_100143152
274 Ga0068868_100701906
275 Ga0070661_100045087
276 Ga0070667_100010970
277 Ga0070709_10031499
278 Ga0070713_100263215
279 Ga0070711_100005665
280 Ga0070711_100418625
281 Ga0070662_100009659
282 Ga0068853_100152689
283 Ga0070672_100004136
284 Ga0070665_100139921
285 Ga0070665_100947328
286 Ga0070704_100533491
287 Ga0068855_100003662
288 Ga0068855_100245473
289 Ga0068857_100012909
290 Ga0068854_100002522
291 Ga0068856_100053587
292 Ga0068851_10012403
293 Ga0070717_10111972
294 Ga0075365_10044016
295 Ga0075435_100843920
296 Ga0105240_10000055
297 Ga0105240_10001159
298 Ga0105240_10004926
299 Ga0105240_10084114
300 Ga0105240_10094861
301 Ga0111539_10743760
302 Ga0105247_11057276
303 Ga0105243_10000294
304 Ga0105248_10012231
305 Ga0105248_10430804
306 Ga0105248_10456772
307 Ga0105237_10043063
308 Ga0105238_10011994
309 Ga0105238_10031939
310 Ga0105238_10065565
311 Ga0105249_11479242
312 Ga0105239_10016401
313 Ga0105239_10081424
314 Ga0105239_10560837
315 Ga0157373_10034877
316 Ga0157370_10216381
317 Ga0157369_10007696
318 Ga0157374_10147675
319 Ga0157378_10130508
320 Ga0157379_10052705
321 Ga0182007_10004786
322 Ga0213872_10000234
323 Ga0213876_10004730
324 Ga0213875_10013271
325 Ga0209129_1030876
326 Ga0209564_1045659
327 Ga0209758_1020531
328 Ga0209051_1028457
329 Ga0207680_10008577
330 Ga0207699_10090962
331 Ga0207699_10350536
332 Ga0207654_10000811
333 Ga0207695_10000012
334 Ga0207695_10004350
335 Ga0207695_10010357
336 Ga0207695_10018535
337 Ga0207695_10172304
338 Ga0207671_10037907
339 Ga0207663_10022761
340 Ga0207649_10014906
341 Ga0207694_10000006
342 Ga0207694_10001415
343 Ga0207694_10251621
344 Ga0207700_10144781
345 Ga0207700_10594603
346 Ga0207706_10000499
347 Ga0207709_10000180
348 Ga0207691_10029217
349 Ga0207711_10011682
350 Ga0207689_10066694
351 Ga0207667_10000026
352 Ga0207667_10011741
353 Ga0207667_11095801
354 Ga0207658_10037608
355 Ga0207639_10191244
356 Ga0207678_10214185
357 Ga0207702_10000003
358 Ga0207674_10009035
359 Ga0207698_10021288
360 Ga0209588_1012718
361 Ga0209974_10118070
362 Ga0268266_10129625
363 Ga0268266_10787246
364 Ga0265338_10506234
365 Ga0265330_10113075
366 Ga0265325_10045089
367 Ga0265340_10054939
368 Ga0265339_10001920
369 Ga0265339_10037479
370 Ga0265331_10111028
371 Ga0265327_10004841
372 Ga0265313_10004154
373 Ga0265313_10125688
374 Ga0265314_10006177
375 Ga0265314_10218055
376 Ga0307516_10058198
377 Ga0307516_10737696
378 Ga0307413_10694238
379 Ga0307412_10364871
380 Ga0307416_100483578
381 Ga0316583_10054049
382 Ga0373923_0028002
383 Ga0373953_0346117
384 Ga0373954_0144543
385 Ga0373956_0054492
386 Ga0373957_0042734
387 Ga0373955_0150708
388 Ga0373935_0280367
389 Ga0373927_0017379
390 Ga0373933_0238246
391 Ga0373937_0032478
392 Ga0373937_0243856
393 Ga0373937_0321218
394 Ga0373925_0019751
395 Ga0373925_0197976
396 Ga0395899_0028345
397 Ga0395900_0033400
398 Ga0395900_0087799
399 Ga0395898_0179516
400 Ga0395898_0227720
401 Ga0395898_0633555
402 Ga0395905_0000455
403 Ga0395905_0099672
404 Ga0436364_1264487
405 Ga0395901_0003454
406 Ga0395901_0014901
407 Ga0395901_0107036
408 Ga0436365_1798326
409 Ga0436362_1026695
410 Ga0439436_0002965
411 Ga0439438_002103
412 Ga0439447_004532
413 Ga0439466_0004409
414 Ga0439431_0018041
415 Ga0439432_050486
416 Ga0439446_0032615
417 Ga0439434_0022968
418 Ga0439444_0008884
419 Ga0439460_0004104
420 Ga0466972_0037044
421 Ga0466966_0000687
422 Ga0466963_0014486
423 Ga0466964_0327289
424 Ga0466971_0009479
425 Ga0466968_0387118
426 Ga0466970_0005981
427 Ga0466957_0127096
428 Ga0466959_0000287
429 Ga0466967_0075043
430 Ga0495592_0018724
431 Ga0495603_0001359
432 Ga0495638_0194415
433 Ga0495641_0005981
434 Ga0495641_0124496
435 Ga0495580_0001360
436 Ga0495580_0004454
437 Ga0495580_0007757
438 Ga0495582_0009737
439 Ga0495662_0003877
440 Ga0495594_0114738
441 Ga0495583_0000247
442 Ga0495606_0006132
443 Ga0495606_0007056
444 Ga0495618_0001711
445 Ga0495628_0000750
446 Ga0495628_0008784
447 Ga0495630_0013697
448 Ga0495643_0154917
449 Ga0495648_0017131
450 Ga0495648_0078261
451 Ga0495666_0001217
452 Ga0495666_0006958
453 Ga0495652_0012363
454 Ga0495652_0058269
455 Ga0495652_0152745
456 Ga0495665_0009512
457 Ga0495665_0012417
458 Ga0495640_0004292
459 Ga0495586_0000966
460 Ga0495586_0068355
461 Ga0495587_0000560
462 Ga0495645_0030027
463 Ga0495645_0031730
464 Ga0495622_0101876
465 Ga0495622_0249612
466 Ga0495656_0160371
467 Ga0495634_0000146
468 Ga0495611_0003524
469 Ga0495611_0041759
470 Ga0495625_0001000
471 Ga0495635_0325110
472 Ga0495661_0009799
473 Ga0495623_0010551
474 Ga0495623_0063057
475 Ga0495646_0022198
476 Ga0495646_0028389
477 Ga0495613_0052500
478 Ga0495581_0008431
479 Ga0495604_0003360
480 Ga0495604_0080882
481 Ga0495636_0150326
482 Ga0495674_0012277
483 Ga0495674_0012740
484 Ga0495676_0114539
485 Ga0495680_0015585
486 Ga0495680_0041192
487 Ga0495675_0025107
488 Ga0495679_002873
489 Ga0495684_0008525
490 Ga0495684_0063264
491 Ga0495684_0201194
492 Ga0495602_0005099
493 Ga0495602_0244917
494 Ga0495602_0310471
495 Ga0495602_0466947
496 Ga0495614_0018666
497 Ga0495626_0037455
498 Ga0496102_0037836
499 Ga0496105_0085513
500 Ga0496115_0105091
501 Ga0496118_0086470
502 Ga0496118_0107896
503 Ga0496121_0010568
504 Ga0496121_0036746
505 Ga0496122_0000351
506 Ga0496123_0000283
507 Ga0496124_0072460
508 Ga0496125_0004238
509 Ga0496126_0401714
510 Ga0495682_0007439
511 Ga0495682_0176588
512 Ga0501075_0140226
513 nmdc:mga0rr50_567911_c1
514 Ga0495601_0573177
515 Ga0495612_0096232
516 Ga0500610_0234702
517 Ga0500643_006226
518 Ga0500643_013224
519 Ga0500641_0093114
520 Ga0500555_008525
521 Ga0500555_012645
522 Ga0500595_005906
523 Ga0500595_017796
524 Ga0500642_0104293
525 Ga0500616_0000006
526 Ga0500637_0161669
527 Ga0530510_0603726
528 2563062249
529 2713477900
530 2765570414
531 2839097960
532 2884811956
533 2884840140
534 2884857093
535 2896157679
536 8024490578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

48

200

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9614 3 196
7vqk-assembly1.cif.gz_B catalytic manifolds of a fmn-dependent oxidoreductase rube7, expanding the functional diversity of the flavoenzyme superfamily 0.9519 3 196
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.9032 6 196
3ge6-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (exig_2970) from exiguobacterium sibiricum 255-15 at 1.85 a resolution 0.8814 4 196
3bem-assembly1.cif.gz_A crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution 0.8772 6 196
ID Description Score Start End Superfamily
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9724 9 194 3.40.109.10
af_P75894_8_194_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.9622 9 194 3.40.109.10
3bemA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8687 13 195 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8405 17 195 3.40.109.10
1noxA00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8398 4 196 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A2V6ZR43-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase DME00_11260 (EC 1.-.-.-) 0.9817 3 196 GO:0016491
AF-A0A4R6AEN0-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase E2L05_20320 (EC 1.-.-.-) 0.9817 2 196 GO:0016491
AF-A0A523FXZ3-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase E2O89_03170 (EC 1.-.-.-) 0.9801 1 196 GO:0016491
AF-A0A522J036-F1-model_v4 Putative NADH dehydrogenase/NAD(P)H nitroreductase EPN72_13485 (EC 1.-.-.-) 0.98 3 196 GO:0016491
AF-A0A2V6UYS3-F1-model_v4 Malonic semialdehyde reductase 0.9787 1 182 GO:0016491

Map