F375732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 189 | 251 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300046513|Ga0495616_0000703|Ga0495616_0000703_14685_15017 |
| Length | 110 |
| Sequence | VEVGVEANVARGEAALRVAGEVLVLRPTFAALVAAEAELGPLFALVERAAAGEMRLSEMAALFWHCIDARPEELTREAVGEAVVAMGLAKASPVLKCVIGQVLMGEAASG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 7 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 8 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 9 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 10 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 11 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 12 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 13 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 14 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 15 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 16 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 17 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 119 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 153 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 154 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 155 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 156 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 157 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 181 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 182 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 183 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 184 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 187 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 188 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 189 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.66 |
| Metatranscriptomes | 0 |
| Isolates | 6.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.75 |
| Bulb | 0 |
| Endosphere | 14.55 |
| Nodule | 0.37 |
| Rhizoplane | 3.73 |
| Rhizosphere | 72.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_763086 | 2162886007 | Bacteria | 3451 |
| 2 | Ga0055536_1019933 | 3300003781 | Bacteria | 2090 |
| 3 | Ga0055534_1015115 | 3300003784 | Bacteria | 1423 |
| 4 | Ga0055530_10000187 | 3300003791 | Bacteria | 55610 |
| 5 | Ga0055530_10093363 | 3300003791 | Bacteria | 613 |
| 6 | Ga0055531_10002656 | 3300003794 | Bacteria | 11794 |
| 7 | Ga0065704_10000316 | 3300005289 | Bacteria | 45883 |
| 8 | Ga0065704_10806406 | 3300005289 | Bacteria | 523 |
| 9 | Ga0065707_10099685 | 3300005295 | Bacteria | 2987 |
| 10 | Ga0070676_10158183 | 3300005328 | Bacteria | 1456 |
| 11 | Ga0070670_100308835 | 3300005331 | Bacteria | 1384 |
| 12 | Ga0070670_100529081 | 3300005331 | Bacteria | 1050 |
| 13 | Ga0070670_100615891 | 3300005331 | Bacteria | 972 |
| 14 | Ga0070677_10000188 | 3300005333 | Bacteria | 21409 |
| 15 | Ga0068869_100471899 | 3300005334 | Bacteria | 1043 |
| 16 | Ga0070666_10007589 | 3300005335 | Bacteria | 6691 |
| 17 | Ga0070682_100197581 | 3300005337 | Bacteria | 1417 |
| 18 | Ga0068868_100000005 | 3300005338 | Bacteria | 132403 |
| 19 | Ga0070660_100001053 | 3300005339 | Bacteria | 18565 |
| 20 | Ga0070668_100001142 | 3300005347 | Bacteria | 18686 |
| 21 | Ga0070668_100251921 | 3300005347 | Bacteria | 1466 |
| 22 | Ga0070675_100001812 | 3300005354 | Bacteria | 15802 |
| 23 | Ga0070671_100020281 | 3300005355 | Bacteria | 5420 |
| 24 | Ga0070673_100522036 | 3300005364 | Bacteria | 1076 |
| 25 | Ga0070659_100000011 | 3300005366 | Bacteria | 185903 |
| 26 | Ga0070667_100000784 | 3300005367 | Bacteria | 29862 |
| 27 | Ga0070667_100878354 | 3300005367 | Bacteria | 834 |
| 28 | Ga0068867_101765692 | 3300005459 | Bacteria | 581 |
| 29 | Ga0068853_100517572 | 3300005539 | Bacteria | 1128 |
| 30 | Ga0070665_100001902 | 3300005548 | Bacteria | 23603 |
| 31 | Ga0070665_101863332 | 3300005548 | Bacteria | 607 |
| 32 | Ga0068855_101262346 | 3300005563 | Bacteria | 766 |
| 33 | Ga0068854_100008452 | 3300005578 | Bacteria | 6619 |
| 34 | Ga0068856_100105374 | 3300005614 | Bacteria | 2814 |
| 35 | Ga0068852_100023347 | 3300005616 | Bacteria | 4977 |
| 36 | Ga0068852_100463128 | 3300005616 | Bacteria | 1257 |
| 37 | Ga0068852_101123298 | 3300005616 | Bacteria | 806 |
| 38 | Ga0068859_100012435 | 3300005617 | Bacteria | 8565 |
| 39 | Ga0068863_100000202 | 3300005841 | Bacteria | 63514 |
| 40 | Ga0068858_100002723 | 3300005842 | Bacteria | 17807 |
| 41 | Ga0068858_100019342 | 3300005842 | Bacteria | 6368 |
| 42 | Ga0068860_100074223 | 3300005843 | Bacteria | 3234 |
| 43 | Ga0068862_100066281 | 3300005844 | Bacteria | 3111 |
| 44 | Ga0075368_10003106 | 3300006042 | Bacteria | 5509 |
| 45 | Ga0075364_10749321 | 3300006051 | Bacteria | 666 |
| 46 | Ga0075432_10003204 | 3300006058 | Bacteria | 5522 |
| 47 | Ga0075367_10000330 | 3300006178 | Bacteria | 16782 |
| 48 | Ga0075369_10287637 | 3300006186 | Bacteria | 766 |
| 49 | Ga0075366_10003170 | 3300006195 | Bacteria | 8614 |
| 50 | Ga0075366_10423496 | 3300006195 | Bacteria | 820 |
| 51 | Ga0075370_10095407 | 3300006353 | Bacteria | 1718 |
| 52 | Ga0097620_100012435 | 3300006931 | Bacteria | 8565 |
| 53 | Ga0079104_1073437 | 3300006946 | Bacteria | 714 |
| 54 | Ga0105240_11771053 | 3300009093 | Bacteria | 644 |
| 55 | Ga0105245_10612183 | 3300009098 | Bacteria | 1117 |
| 56 | Ga0105245_10849610 | 3300009098 | Bacteria | 953 |
| 57 | Ga0105243_10235137 | 3300009148 | Bacteria | 1628 |
| 58 | Ga0105248_10059350 | 3300009177 | Bacteria | 4297 |
| 59 | Ga0105248_11104493 | 3300009177 | Bacteria | 896 |
| 60 | Ga0105237_10021914 | 3300009545 | Bacteria | 6562 |
| 61 | Ga0105249_10070398 | 3300009553 | Bacteria | 3229 |
| 62 | Ga0157378_10337378 | 3300013297 | Bacteria | 1469 |
| 63 | Ga0163162_10033538 | 3300013306 | Bacteria | 5102 |
| 64 | Ga0157375_10233600 | 3300013308 | Bacteria | 1998 |
| 65 | Ga0209565_1060578 | 3300025263 | Bacteria | 657 |
| 66 | Ga0209675_1000754 | 3300025291 | Bacteria | 21760 |
| 67 | Ga0209676_1000273 | 3300025292 | Bacteria | 107724 |
| 68 | Ga0209676_1000569 | 3300025292 | Bacteria | 55557 |
| 69 | Ga0209676_1071520 | 3300025292 | Bacteria | 823 |
| 70 | Ga0209025_1012209 | 3300025294 | Bacteria | 5537 |
| 71 | Ga0209758_1177739 | 3300025297 | Bacteria | 514 |
| 72 | Ga0209050_1000218 | 3300025298 | Bacteria | 128776 |
| 73 | Ga0209050_1010491 | 3300025298 | Bacteria | 4557 |
| 74 | Ga0209050_1047785 | 3300025298 | Bacteria | 1112 |
| 75 | Ga0209257_1000248 | 3300025304 | Bacteria | 125170 |
| 76 | Ga0209257_1000912 | 3300025304 | Bacteria | 41182 |
| 77 | Ga0209257_1003677 | 3300025304 | Bacteria | 12813 |
| 78 | Ga0207697_10454848 | 3300025315 | Bacteria | 567 |
| 79 | Ga0207682_10001435 | 3300025893 | Bacteria | 10998 |
| 80 | Ga0207680_10004406 | 3300025903 | Bacteria | 6677 |
| 81 | Ga0207645_10509799 | 3300025907 | Bacteria | 815 |
| 82 | Ga0207695_10161437 | 3300025913 | Bacteria | 2172 |
| 83 | Ga0207671_10013955 | 3300025914 | Bacteria | 6375 |
| 84 | Ga0207657_10004726 | 3300025919 | Bacteria | 14376 |
| 85 | Ga0207649_10431907 | 3300025920 | Bacteria | 991 |
| 86 | Ga0207650_10266969 | 3300025925 | Bacteria | 1390 |
| 87 | Ga0207650_10281611 | 3300025925 | Bacteria | 1354 |
| 88 | Ga0207650_10370911 | 3300025925 | Bacteria | 1181 |
| 89 | Ga0207659_10001126 | 3300025926 | Bacteria | 15848 |
| 90 | Ga0207687_10054329 | 3300025927 | Bacteria | 2801 |
| 91 | Ga0207687_10077333 | 3300025927 | Bacteria | 2393 |
| 92 | Ga0207644_10009998 | 3300025931 | Bacteria | 6247 |
| 93 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 94 | Ga0207691_10413019 | 3300025940 | Bacteria | 1150 |
| 95 | Ga0207711_10247837 | 3300025941 | Bacteria | 1635 |
| 96 | Ga0207689_10419561 | 3300025942 | Bacteria | 1116 |
| 97 | Ga0207668_10010595 | 3300025972 | Bacteria | 5576 |
| 98 | Ga0207668_11212137 | 3300025972 | Bacteria | 678 |
| 99 | Ga0207640_10328831 | 3300025981 | Bacteria | 1220 |
| 100 | Ga0207658_10000199 | 3300025986 | Bacteria | 62791 |
| 101 | Ga0207677_10000150 | 3300026023 | Bacteria | 55710 |
| 102 | Ga0207703_10004226 | 3300026035 | Bacteria | 11837 |
| 103 | Ga0207703_10110237 | 3300026035 | Bacteria | 2348 |
| 104 | Ga0207639_10250315 | 3300026041 | Bacteria | 1545 |
| 105 | Ga0207708_10269100 | 3300026075 | Bacteria | 1378 |
| 106 | Ga0207641_10000285 | 3300026088 | Bacteria | 63539 |
| 107 | Ga0207641_10010204 | 3300026088 | Bacteria | 7725 |
| 108 | Ga0207648_11587161 | 3300026089 | Bacteria | 615 |
| 109 | Ga0207674_10049549 | 3300026116 | Bacteria | 4295 |
| 110 | Ga0207698_10017064 | 3300026142 | Bacteria | 4916 |
| 111 | Ga0207698_10335514 | 3300026142 | Bacteria | 1422 |
| 112 | Ga0209813_10000182 | 3300027866 | Bacteria | 20378 |
| 113 | Ga0209974_10001446 | 3300027876 | Bacteria | 8616 |
| 114 | Ga0207428_10048487 | 3300027907 | Bacteria | 3407 |
| 115 | Ga0268266_10000566 | 3300028379 | Bacteria | 51401 |
| 116 | Ga0268266_11112741 | 3300028379 | Bacteria | 764 |
| 117 | Ga0268265_10059565 | 3300028380 | Bacteria | 2922 |
| 118 | Ga0268265_11420920 | 3300028380 | Bacteria | 696 |
| 119 | Ga0268264_10055848 | 3300028381 | Bacteria | 3300 |
| 120 | Ga0307405_10019198 | 3300031731 | Bacteria | 3791 |
| 121 | Ga0307405_10243224 | 3300031731 | Bacteria | 1334 |
| 122 | Ga0307405_10618330 | 3300031731 | Bacteria | 886 |
| 123 | Ga0307413_12163633 | 3300031824 | Bacteria | 504 |
| 124 | Ga0307410_10261180 | 3300031852 | Bacteria | 1351 |
| 125 | Ga0307410_10506493 | 3300031852 | Bacteria | 994 |
| 126 | Ga0307407_10350471 | 3300031903 | Bacteria | 1045 |
| 127 | Ga0307412_10002730 | 3300031911 | Bacteria | 9815 |
| 128 | Ga0307412_10004344 | 3300031911 | Bacteria | 7904 |
| 129 | Ga0307412_10051415 | 3300031911 | Bacteria | 2723 |
| 130 | Ga0307412_10720557 | 3300031911 | Bacteria | 858 |
| 131 | Ga0307416_100352282 | 3300032002 | Bacteria | 1490 |
| 132 | Ga0307414_10000148 | 3300032004 | Bacteria | 47023 |
| 133 | Ga0307414_10111149 | 3300032004 | Bacteria | 2086 |
| 134 | Ga0307414_10539751 | 3300032004 | Bacteria | 1038 |
| 135 | Ga0307414_10584925 | 3300032004 | Bacteria | 999 |
| 136 | Ga0307414_11460228 | 3300032004 | Bacteria | 636 |
| 137 | Ga0307414_12013081 | 3300032004 | Bacteria | 539 |
| 138 | Ga0307411_10131459 | 3300032005 | Bacteria | 1830 |
| 139 | Ga0307411_10276239 | 3300032005 | Bacteria | 1335 |
| 140 | Ga0307411_11988955 | 3300032005 | Bacteria | 542 |
| 141 | Ga0307415_100058575 | 3300032126 | Bacteria | 2652 |
| 142 | Ga0373948_0057102 | 3300034817 | Bacteria | 850 |
| 143 | Ga0373939_0150441 | 3300035114 | Bacteria | 847 |
| 144 | Ga0373931_0331980 | 3300035691 | Bacteria | 947 |
| 145 | Ga0451797_0048970 | 3300041453 | Bacteria | 554 |
| 146 | Ga0451576_0018854 | 3300045051 | Bacteria | 7543 |
| 147 | Ga0451576_1065508 | 3300045051 | Bacteria | 846 |
| 148 | Ga0495627_001020 | 3300046453 | Bacteria | 18755 |
| 149 | Ga0495650_0000597 | 3300046471 | Bacteria | 49626 |
| 150 | Ga0495650_0001697 | 3300046471 | Bacteria | 20282 |
| 151 | Ga0495650_0153318 | 3300046471 | Bacteria | 826 |
| 152 | Ga0495596_0000153 | 3300046500 | Bacteria | 47822 |
| 153 | Ga0495607_0050260 | 3300046501 | Bacteria | 2428 |
| 154 | Ga0495583_0354690 | 3300046506 | Bacteria | 578 |
| 155 | Ga0495606_0006535 | 3300046507 | Bacteria | 10723 |
| 156 | Ga0495606_0257184 | 3300046507 | Bacteria | 966 |
| 157 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 158 | Ga0495610_0004210 | 3300046512 | Bacteria | 10735 |
| 159 | Ga0495616_0000703 | 3300046513 | Bacteria | 24798 |
| 160 | Ga0495620_0024364 | 3300046515 | Bacteria | 2878 |
| 161 | Ga0495620_0110174 | 3300046515 | Bacteria | 1091 |
| 162 | Ga0495632_0000039 | 3300046519 | Bacteria | 150268 |
| 163 | Ga0495632_0001085 | 3300046519 | Bacteria | 23323 |
| 164 | Ga0495632_0008546 | 3300046519 | Bacteria | 6266 |
| 165 | Ga0495632_0031269 | 3300046519 | Bacteria | 2754 |
| 166 | Ga0495632_0143423 | 3300046519 | Bacteria | 1107 |
| 167 | Ga0495637_0001499 | 3300046520 | Bacteria | 13692 |
| 168 | Ga0495643_0000162 | 3300046522 | Bacteria | 106672 |
| 169 | Ga0495643_0043477 | 3300046522 | Bacteria | 2444 |
| 170 | Ga0495643_0061284 | 3300046522 | Bacteria | 1995 |
| 171 | Ga0495643_0190902 | 3300046522 | Bacteria | 989 |
| 172 | Ga0495648_0165752 | 3300046524 | Bacteria | 1137 |
| 173 | Ga0495663_0000006 | 3300046525 | Bacteria | 306938 |
| 174 | Ga0495609_0125950 | 3300046538 | Bacteria | 1099 |
| 175 | Ga0495633_0000600 | 3300046558 | Bacteria | 34616 |
| 176 | Ga0495633_0000724 | 3300046558 | Bacteria | 29905 |
| 177 | Ga0495668_0126938 | 3300046616 | Bacteria | 1396 |
| 178 | Ga0495611_0188489 | 3300046648 | Bacteria | 963 |
| 179 | Ga0495625_0000528 | 3300046660 | Bacteria | 56251 |
| 180 | Ga0495625_0005379 | 3300046660 | Bacteria | 11710 |
| 181 | Ga0495625_0661034 | 3300046660 | Bacteria | 621 |
| 182 | Ga0495671_0000062 | 3300046692 | Bacteria | 106672 |
| 183 | Ga0495671_0078279 | 3300046692 | Bacteria | 1621 |
| 184 | Ga0495649_0564417 | 3300046694 | Bacteria | 563 |
| 185 | Ga0495681_0000062 | 3300047470 | Bacteria | 99851 |
| 186 | Ga0495686_0618257 | 3300047472 | Bacteria | 559 |
| 187 | Ga0495626_0000459 | 3300048091 | Bacteria | 41540 |
| 188 | Ga0496102_0523556 | 3300048905 | Bacteria | 1108 |
| 189 | Ga0496102_0773051 | 3300048905 | Bacteria | 883 |
| 190 | Ga0496104_0707673 | 3300048907 | Bacteria | 915 |
| 191 | Ga0496108_0859723 | 3300048911 | Bacteria | 780 |
| 192 | Ga0496109_0048286 | 3300048912 | Bacteria | 3873 |
| 193 | Ga0496110_0105773 | 3300048913 | Bacteria | 2525 |
| 194 | Ga0496113_0760919 | 3300048916 | Bacteria | 771 |
| 195 | Ga0496117_0491609 | 3300048920 | Bacteria | 597 |
| 196 | Ga0496119_0112938 | 3300048922 | Bacteria | 1505 |
| 197 | Ga0496120_0055287 | 3300048923 | Bacteria | 2245 |
| 198 | Ga0496120_0210445 | 3300048923 | Bacteria | 935 |
| 199 | Ga0496122_0015988 | 3300048925 | Bacteria | 7136 |
| 200 | Ga0496122_0464320 | 3300048925 | Bacteria | 624 |
| 201 | Ga0496123_0001199 | 3300048926 | Bacteria | 37943 |
| 202 | Ga0496123_0090009 | 3300048926 | Bacteria | 1826 |
| 203 | Ga0496123_0243525 | 3300048926 | Bacteria | 891 |
| 204 | Ga0496123_0326273 | 3300048926 | Bacteria | 722 |
| 205 | Ga0496124_0000648 | 3300048927 | Bacteria | 57426 |
| 206 | Ga0496124_0014953 | 3300048927 | Bacteria | 7472 |
| 207 | Ga0496124_0015075 | 3300048927 | Bacteria | 7432 |
| 208 | Ga0496124_0018190 | 3300048927 | Bacteria | 6592 |
| 209 | Ga0496125_0318975 | 3300048928 | Bacteria | 943 |
| 210 | Ga0496126_0003221 | 3300048929 | Bacteria | 20886 |
| 211 | Ga0496126_0010218 | 3300048929 | Bacteria | 9868 |
| 212 | Ga0496126_0052884 | 3300048929 | Bacteria | 3688 |
| 213 | Ga0501031_0159763 | 3300049568 | Bacteria | 1473 |
| 214 | Ga0501032_0075036 | 3300049569 | Bacteria | 2252 |
| 215 | Ga0501032_0280186 | 3300049569 | Bacteria | 1079 |
| 216 | Ga0501032_0868146 | 3300049569 | Bacteria | 569 |
| 217 | Ga0501033_0001566 | 3300049570 | Bacteria | 20182 |
| 218 | Ga0501034_0103825 | 3300049571 | Bacteria | 2835 |
| 219 | Ga0501034_0319651 | 3300049571 | Bacteria | 1485 |
| 220 | Ga0501034_1239910 | 3300049571 | Bacteria | 624 |
| 221 | Ga0501036_0710120 | 3300049572 | Bacteria | 830 |
| 222 | Ga0501037_0137534 | 3300049573 | Bacteria | 1749 |
| 223 | Ga0501037_0990603 | 3300049573 | Bacteria | 548 |
| 224 | Ga0501038_0200301 | 3300049574 | Bacteria | 1602 |
| 225 | Ga0501039_0224206 | 3300049575 | Bacteria | 1477 |
| 226 | Ga0501042_0942417 | 3300049578 | Bacteria | 629 |
| 227 | Ga0501043_0113886 | 3300049579 | Bacteria | 2123 |
| 228 | Ga0501043_0495595 | 3300049579 | Bacteria | 913 |
| 229 | Ga0501046_0489637 | 3300049580 | Bacteria | 882 |
| 230 | Ga0501047_0014213 | 3300049581 | Bacteria | 7566 |
| 231 | Ga0501069_0066582 | 3300049585 | Bacteria | 2014 |
| 232 | Ga0501070_0103601 | 3300049586 | Bacteria | 2353 |
| 233 | Ga0501035_0037057 | 3300049822 | Bacteria | 4417 |
| 234 | Ga0501035_0257756 | 3300049822 | Bacteria | 1479 |
| 235 | Ga0501044_0010376 | 3300049823 | Bacteria | 10107 |
| 236 | Ga0501044_0387204 | 3300049823 | Bacteria | 1312 |
| 237 | Ga0501044_0462032 | 3300049823 | Bacteria | 1175 |
| 238 | Ga0501044_1088463 | 3300049823 | Bacteria | 669 |
| 239 | nmdc:mga0k408_2924_c1 | 3300050493 | Bacteria | 6857 |
| 240 | nmdc:mga06z11_443_c1 | 3300050494 | Bacteria | 15505 |
| 241 | nmdc:mga04h51_151_c1 | 3300050495 | Bacteria | 20376 |
| 242 | nmdc:mga07m45_122180_c1 | 3300050496 | Bacteria | 1504 |
| 243 | Ga0500646_0037808 | 3300053090 | Bacteria | 1349 |
| 244 | Ga0500592_024042 | 3300053116 | Bacteria | 982 |
| 245 | Ga0500642_0203853 | 3300053130 | Bacteria | 920 |
| 246 | Ga0500568_0001916 | 3300053139 | Bacteria | 12763 |
| 247 | Ga0500588_0022519 | 3300053146 | Bacteria | 1717 |
| 248 | Ga0500616_0000101 | 3300053153 | Bacteria | 172722 |
| 249 | Ga0500611_048984 | 3300053727 | Bacteria | 960 |
| 250 | Ga0500645_009736 | 3300053730 | Bacteria | 3217 |
| 251 | Ga0500661_000095 | 3300055283 | Bacteria | 14070 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100001142 | Ga0070668_10000114216 | 89 |
| 2 | 3300005367 | Ga0070667_100000784 | Ga0070667_1000007844 | 89 |
| 3 | 3300005841 | Ga0068863_100000202 | Ga0068863_10000020266 | 89 |
| 4 | 3300025903 | Ga0207680_10004406 | Ga0207680_100044068 | 89 |
| 5 | 3300025925 | Ga0207650_10281611 | Ga0207650_102816112 | 89 |
| 6 | 3300025972 | Ga0207668_10010595 | Ga0207668_100105959 | 89 |
| 7 | 3300025986 | Ga0207658_10000199 | Ga0207658_1000019965 | 89 |
| 8 | 3300026088 | Ga0207641_10000285 | Ga0207641_1000028561 | 89 |
| 9 | 3300045051 | Ga0451576_0018854 | Ga0451576_0018854_5009_5341 | 89 |
| 10 | iso_pu_bacteria | 2643221563 | 2643834377 | 93 |
| 11 | iso_pu_bacteria | 2643221608 | 2644055302 | 93 |
| 12 | 3300048929 | Ga0496126_0052884 | Ga0496126_0052884_373_666 | 96 |
| 13 | iso_pu_bacteria | 2885429604 | 2885432626 | 96 |
| 14 | 3300031824 | Ga0307413_12163633 | Ga0307413_121636332 | 97 |
| 15 | 3300013297 | Ga0157378_10337378 | Ga0157378_103373783 | 99 |
| 16 | 3300025940 | Ga0207691_10413019 | Ga0207691_104130192 | 99 |
| 17 | 3300045051 | Ga0451576_1065508 | Ga0451576_1065508_531_833 | 99 |
| 18 | iso_pu_bacteria | 2599185354 | 2600203442 | 99 |
| 19 | iso_pu_bacteria | 2599185359 | 2600228094 | 99 |
| 20 | iso_pu_bacteria | 2818991466 | 2819715098 | 99 |
| 21 | iso_pu_bacteria | 2928526807 | 2928531114 | 99 |
| 22 | iso_pu_bacteria | 2928968154 | 2928972290 | 99 |
| 23 | iso_pu_bacteria | 2990265787 | 2990267887 | 99 |
| 24 | iso_pu_bacteria | 2993693658 | 2993697095 | 99 |
| 25 | 3300005337 | Ga0070682_100197581 | Ga0070682_1001975812 | 100 |
| 26 | 3300005844 | Ga0068862_100066281 | Ga0068862_1000662813 | 100 |
| 27 | 3300006195 | Ga0075366_10003170 | Ga0075366_100031709 | 100 |
| 28 | 3300013308 | Ga0157375_10233600 | Ga0157375_102336001 | 100 |
| 29 | 3300028380 | Ga0268265_10059565 | Ga0268265_100595653 | 100 |
| 30 | 3300032004 | Ga0307414_12013081 | Ga0307414_120130812 | 100 |
| 31 | 3300046648 | Ga0495611_0188489 | Ga0495611_0188489_278_586 | 100 |
| 32 | 3300050493 | nmdc:mga0k408_2924_c1 | nmdc:mga0k408_2924_c1_2087_2392 | 100 |
| 33 | 3300053730 | Ga0500645_009736 | Ga0500645_009736_701_1009 | 100 |
| 34 | 3300055283 | Ga0500661_000095 | Ga0500661_000095_3761_4069 | 100 |
| 35 | iso_pu_bacteria | 2896184354 | 2896186003 | 100 |
| 36 | iso_pu_bacteria | 3000865235 | 3000867851 | 100 |
| 37 | 3300005328 | Ga0070676_10158183 | Ga0070676_101581833 | 101 |
| 38 | 3300005331 | Ga0070670_100615891 | Ga0070670_1006158912 | 101 |
| 39 | 3300005333 | Ga0070677_10000188 | Ga0070677_1000018810 | 101 |
| 40 | 3300005335 | Ga0070666_10007589 | Ga0070666_100075895 | 101 |
| 41 | 3300005338 | Ga0068868_100000005 | Ga0068868_10000000594 | 101 |
| 42 | 3300005339 | Ga0070660_100001053 | Ga0070660_10000105311 | 101 |
| 43 | 3300005354 | Ga0070675_100001812 | Ga0070675_10000181211 | 101 |
| 44 | 3300005364 | Ga0070673_100522036 | Ga0070673_1005220361 | 101 |
| 45 | 3300005366 | Ga0070659_100000011 | Ga0070659_100000011150 | 101 |
| 46 | 3300005459 | Ga0068867_101765692 | Ga0068867_1017656922 | 101 |
| 47 | 3300009098 | Ga0105245_10612183 | Ga0105245_106121832 | 101 |
| 48 | 3300009098 | Ga0105245_10849610 | Ga0105245_108496102 | 101 |
| 49 | 3300009553 | Ga0105249_10070398 | Ga0105249_100703984 | 101 |
| 50 | 3300025893 | Ga0207682_10001435 | Ga0207682_100014353 | 101 |
| 51 | 3300025907 | Ga0207645_10509799 | Ga0207645_105097992 | 101 |
| 52 | 3300025919 | Ga0207657_10004726 | Ga0207657_1000472617 | 101 |
| 53 | 3300025926 | Ga0207659_10001126 | Ga0207659_1000112613 | 101 |
| 54 | 3300025927 | Ga0207687_10054329 | Ga0207687_100543292 | 101 |
| 55 | 3300025927 | Ga0207687_10077333 | Ga0207687_100773332 | 101 |
| 56 | 3300025932 | Ga0207690_10000005 | Ga0207690_1000000559 | 101 |
| 57 | 3300026023 | Ga0207677_10000150 | Ga0207677_1000015047 | 101 |
| 58 | 3300026075 | Ga0207708_10269100 | Ga0207708_102691002 | 101 |
| 59 | 3300026089 | Ga0207648_11587161 | Ga0207648_115871612 | 101 |
| 60 | 3300031731 | Ga0307405_10019198 | Ga0307405_100191984 | 101 |
| 61 | 3300031731 | Ga0307405_10618330 | Ga0307405_106183302 | 101 |
| 62 | 3300031852 | Ga0307410_10506493 | Ga0307410_105064931 | 101 |
| 63 | 3300031903 | Ga0307407_10350471 | Ga0307407_103504712 | 101 |
| 64 | 3300031911 | Ga0307412_10051415 | Ga0307412_100514156 | 101 |
| 65 | 3300032002 | Ga0307416_100352282 | Ga0307416_1003522824 | 101 |
| 66 | 3300032004 | Ga0307414_10539751 | Ga0307414_105397513 | 101 |
| 67 | 3300032005 | Ga0307411_10131459 | Ga0307411_101314594 | 101 |
| 68 | 3300032126 | Ga0307415_100058575 | Ga0307415_1000585754 | 101 |
| 69 | 3300046453 | Ga0495627_001020 | Ga0495627_001020_8037_8345 | 101 |
| 70 | 3300046471 | Ga0495650_0000597 | Ga0495650_0000597_25129_25437 | 101 |
| 71 | 3300046512 | Ga0495610_0000015 | Ga0495610_0000015_278139_278447 | 101 |
| 72 | 3300046515 | Ga0495620_0024364 | Ga0495620_0024364_1726_2034 | 101 |
| 73 | 3300046515 | Ga0495620_0110174 | Ga0495620_0110174_20_328 | 101 |
| 74 | 3300046519 | Ga0495632_0001085 | Ga0495632_0001085_12976_13284 | 101 |
| 75 | 3300047470 | Ga0495681_0000062 | Ga0495681_0000062_40454_40762 | 101 |
| 76 | 3300048925 | Ga0496122_0015988 | Ga0496122_0015988_4829_5137 | 101 |
| 77 | 3300048926 | Ga0496123_0001199 | Ga0496123_0001199_30251_30559 | 101 |
| 78 | iso_pu_bacteria | 8054302542 | 8054305438 | 101 |
| 79 | 3300003781 | Ga0055536_1019933 | Ga0055536_10199333 | 102 |
| 80 | 3300003784 | Ga0055534_1015115 | Ga0055534_10151154 | 102 |
| 81 | 3300003791 | Ga0055530_10000187 | Ga0055530_1000018717 | 102 |
| 82 | 3300003791 | Ga0055530_10093363 | Ga0055530_100933632 | 102 |
| 83 | 3300003794 | Ga0055531_10002656 | Ga0055531_100026569 | 102 |
| 84 | 3300005355 | Ga0070671_100020281 | Ga0070671_1000202813 | 102 |
| 85 | 3300005578 | Ga0068854_100008452 | Ga0068854_1000084523 | 102 |
| 86 | 3300005843 | Ga0068860_100074223 | Ga0068860_1000742236 | 102 |
| 87 | 3300006042 | Ga0075368_10003106 | Ga0075368_100031062 | 102 |
| 88 | 3300006178 | Ga0075367_10000330 | Ga0075367_1000033018 | 102 |
| 89 | 3300006353 | Ga0075370_10095407 | Ga0075370_100954075 | 102 |
| 90 | 3300009093 | Ga0105240_11771053 | Ga0105240_117710532 | 102 |
| 91 | 3300009545 | Ga0105237_10021914 | Ga0105237_100219145 | 102 |
| 92 | 3300025263 | Ga0209565_1060578 | Ga0209565_10605782 | 102 |
| 93 | 3300025291 | Ga0209675_1000754 | Ga0209675_100075416 | 102 |
| 94 | 3300025292 | Ga0209676_1000273 | Ga0209676_100027343 | 102 |
| 95 | 3300025292 | Ga0209676_1000569 | Ga0209676_100056929 | 102 |
| 96 | 3300025292 | Ga0209676_1071520 | Ga0209676_10715202 | 102 |
| 97 | 3300025294 | Ga0209025_1012209 | Ga0209025_10122091 | 102 |
| 98 | 3300025297 | Ga0209758_1177739 | Ga0209758_11777391 | 102 |
| 99 | 3300025298 | Ga0209050_1000218 | Ga0209050_100021841 | 102 |
| 100 | 3300025298 | Ga0209050_1010491 | Ga0209050_10104914 | 102 |
| 101 | 3300025298 | Ga0209050_1047785 | Ga0209050_10477853 | 102 |
| 102 | 3300025304 | Ga0209257_1000248 | Ga0209257_100024815 | 102 |
| 103 | 3300025304 | Ga0209257_1000912 | Ga0209257_100091211 | 102 |
| 104 | 3300025304 | Ga0209257_1003677 | Ga0209257_10036778 | 102 |
| 105 | 3300025315 | Ga0207697_10454848 | Ga0207697_104548481 | 102 |
| 106 | 3300025913 | Ga0207695_10161437 | Ga0207695_101614375 | 102 |
| 107 | 3300025914 | Ga0207671_10013955 | Ga0207671_100139557 | 102 |
| 108 | 3300025931 | Ga0207644_10009998 | Ga0207644_100099984 | 102 |
| 109 | 3300025981 | Ga0207640_10328831 | Ga0207640_103288312 | 102 |
| 110 | 3300026088 | Ga0207641_10010204 | Ga0207641_100102044 | 102 |
| 111 | 3300026116 | Ga0207674_10049549 | Ga0207674_100495491 | 102 |
| 112 | 3300027866 | Ga0209813_10000182 | Ga0209813_1000018210 | 102 |
| 113 | 3300027876 | Ga0209974_10001446 | Ga0209974_100014469 | 102 |
| 114 | 3300028380 | Ga0268265_11420920 | Ga0268265_114209201 | 102 |
| 115 | 3300028381 | Ga0268264_10055848 | Ga0268264_100558486 | 102 |
| 116 | 3300031911 | Ga0307412_10002730 | Ga0307412_100027303 | 102 |
| 117 | 3300031911 | Ga0307412_10004344 | Ga0307412_100043444 | 102 |
| 118 | 3300032004 | Ga0307414_10000148 | Ga0307414_1000014814 | 102 |
| 119 | 3300032004 | Ga0307414_10111149 | Ga0307414_101111493 | 102 |
| 120 | 3300032004 | Ga0307414_10584925 | Ga0307414_105849252 | 102 |
| 121 | 3300032004 | Ga0307414_11460228 | Ga0307414_114602282 | 102 |
| 122 | 3300032005 | Ga0307411_10276239 | Ga0307411_102762392 | 102 |
| 123 | 3300032005 | Ga0307411_11988955 | Ga0307411_119889552 | 102 |
| 124 | 3300046471 | Ga0495650_0001697 | Ga0495650_0001697_1605_1922 | 102 |
| 125 | 3300046500 | Ga0495596_0000153 | Ga0495596_0000153_37274_37585 | 102 |
| 126 | 3300046501 | Ga0495607_0050260 | Ga0495607_0050260_1851_2162 | 102 |
| 127 | 3300046506 | Ga0495583_0354690 | Ga0495583_0354690_160_471 | 102 |
| 128 | 3300046507 | Ga0495606_0006535 | Ga0495606_0006535_8698_9009 | 102 |
| 129 | 3300046519 | Ga0495632_0000039 | Ga0495632_0000039_70810_71124 | 102 |
| 130 | 3300046519 | Ga0495632_0008546 | Ga0495632_0008546_1018_1329 | 102 |
| 131 | 3300046520 | Ga0495637_0001499 | Ga0495637_0001499_3665_3979 | 102 |
| 132 | 3300046522 | Ga0495643_0000162 | Ga0495643_0000162_70090_70404 | 102 |
| 133 | 3300046522 | Ga0495643_0043477 | Ga0495643_0043477_553_864 | 102 |
| 134 | 3300046522 | Ga0495643_0061284 | Ga0495643_0061284_1519_1830 | 102 |
| 135 | 3300046524 | Ga0495648_0165752 | Ga0495648_0165752_747_1061 | 102 |
| 136 | 3300046525 | Ga0495663_0000006 | Ga0495663_0000006_70893_71207 | 102 |
| 137 | 3300046538 | Ga0495609_0125950 | Ga0495609_0125950_133_444 | 102 |
| 138 | 3300046558 | Ga0495633_0000600 | Ga0495633_0000600_17905_18219 | 102 |
| 139 | 3300046558 | Ga0495633_0000724 | Ga0495633_0000724_10849_11163 | 102 |
| 140 | 3300046616 | Ga0495668_0126938 | Ga0495668_0126938_199_510 | 102 |
| 141 | 3300046660 | Ga0495625_0000528 | Ga0495625_0000528_33968_34279 | 102 |
| 142 | 3300046660 | Ga0495625_0005379 | Ga0495625_0005379_7863_8174 | 102 |
| 143 | 3300046660 | Ga0495625_0661034 | Ga0495625_0661034_206_520 | 102 |
| 144 | 3300046692 | Ga0495671_0000062 | Ga0495671_0000062_70090_70404 | 102 |
| 145 | 3300046692 | Ga0495671_0078279 | Ga0495671_0078279_1234_1545 | 102 |
| 146 | 3300047472 | Ga0495686_0618257 | Ga0495686_0618257_84_398 | 102 |
| 147 | 3300048905 | Ga0496102_0523556 | Ga0496102_0523556_446_760 | 102 |
| 148 | 3300048920 | Ga0496117_0491609 | Ga0496117_0491609_169_483 | 102 |
| 149 | 3300048922 | Ga0496119_0112938 | Ga0496119_0112938_579_890 | 102 |
| 150 | 3300048923 | Ga0496120_0055287 | Ga0496120_0055287_665_979 | 102 |
| 151 | 3300048923 | Ga0496120_0210445 | Ga0496120_0210445_78_389 | 102 |
| 152 | 3300048925 | Ga0496122_0464320 | Ga0496122_0464320_48_362 | 102 |
| 153 | 3300048926 | Ga0496123_0090009 | Ga0496123_0090009_1280_1594 | 102 |
| 154 | 3300048926 | Ga0496123_0243525 | Ga0496123_0243525_220_534 | 102 |
| 155 | 3300048926 | Ga0496123_0326273 | Ga0496123_0326273_107_421 | 102 |
| 156 | 3300048927 | Ga0496124_0000648 | Ga0496124_0000648_17636_17950 | 102 |
| 157 | 3300048927 | Ga0496124_0014953 | Ga0496124_0014953_3398_3709 | 102 |
| 158 | 3300048927 | Ga0496124_0015075 | Ga0496124_0015075_1534_1848 | 102 |
| 159 | 3300048927 | Ga0496124_0018190 | Ga0496124_0018190_3165_3479 | 102 |
| 160 | 3300048928 | Ga0496125_0318975 | Ga0496125_0318975_425_739 | 102 |
| 161 | 3300048929 | Ga0496126_0010218 | Ga0496126_0010218_2814_3125 | 102 |
| 162 | 3300049568 | Ga0501031_0159763 | Ga0501031_0159763_685_996 | 102 |
| 163 | 3300049569 | Ga0501032_0075036 | Ga0501032_0075036_350_664 | 102 |
| 164 | 3300049569 | Ga0501032_0280186 | Ga0501032_0280186_665_976 | 102 |
| 165 | 3300049570 | Ga0501033_0001566 | Ga0501033_0001566_14981_15295 | 102 |
| 166 | 3300049571 | Ga0501034_0103825 | Ga0501034_0103825_775_1086 | 102 |
| 167 | 3300049572 | Ga0501036_0710120 | Ga0501036_0710120_373_687 | 102 |
| 168 | 3300049573 | Ga0501037_0137534 | Ga0501037_0137534_562_873 | 102 |
| 169 | 3300049574 | Ga0501038_0200301 | Ga0501038_0200301_1268_1582 | 102 |
| 170 | 3300049575 | Ga0501039_0224206 | Ga0501039_0224206_527_841 | 102 |
| 171 | 3300049578 | Ga0501042_0942417 | Ga0501042_0942417_144_455 | 102 |
| 172 | 3300049579 | Ga0501043_0113886 | Ga0501043_0113886_479_793 | 102 |
| 173 | 3300049580 | Ga0501046_0489637 | Ga0501046_0489637_361_675 | 102 |
| 174 | 3300049581 | Ga0501047_0014213 | Ga0501047_0014213_1859_2173 | 102 |
| 175 | 3300049822 | Ga0501035_0037057 | Ga0501035_0037057_157_471 | 102 |
| 176 | 3300049822 | Ga0501035_0257756 | Ga0501035_0257756_886_1197 | 102 |
| 177 | 3300049823 | Ga0501044_0010376 | Ga0501044_0010376_6163_6477 | 102 |
| 178 | 3300049823 | Ga0501044_0387204 | Ga0501044_0387204_533_844 | 102 |
| 179 | 3300050494 | nmdc:mga06z11_443_c1 | nmdc:mga06z11_443_c1_7292_7606 | 102 |
| 180 | 3300050495 | nmdc:mga04h51_151_c1 | nmdc:mga04h51_151_c1_12771_13085 | 102 |
| 181 | 3300050496 | nmdc:mga07m45_122180_c1 | nmdc:mga07m45_122180_c1_383_697 | 102 |
| 182 | 3300053130 | Ga0500642_0203853 | Ga0500642_0203853_494_805 | 102 |
| 183 | 3300053146 | Ga0500588_0022519 | Ga0500588_0022519_582_893 | 102 |
| 184 | iso_pu_bacteria | 2808606401 | 2809061937 | 102 |
| 185 | iso_pu_bacteria | 2808606404 | 2809077901 | 102 |
| 186 | iso_pu_bacteria | 2808606405 | 2809082391 | 102 |
| 187 | iso_pu_bacteria | 2880518877 | 2880519879 | 102 |
| 188 | 2162886007 | SwRhRL2b_contig_763086 | SwRhRL2b_0749.00007130 | 103 |
| 189 | 3300005289 | Ga0065704_10000316 | Ga0065704_100003169 | 103 |
| 190 | 3300005289 | Ga0065704_10806406 | Ga0065704_108064061 | 103 |
| 191 | 3300005295 | Ga0065707_10099685 | Ga0065707_100996852 | 103 |
| 192 | 3300005331 | Ga0070670_100308835 | Ga0070670_1003088354 | 103 |
| 193 | 3300005331 | Ga0070670_100529081 | Ga0070670_1005290812 | 103 |
| 194 | 3300005334 | Ga0068869_100471899 | Ga0068869_1004718992 | 103 |
| 195 | 3300005347 | Ga0070668_100251921 | Ga0070668_1002519213 | 103 |
| 196 | 3300005367 | Ga0070667_100878354 | Ga0070667_1008783542 | 103 |
| 197 | 3300005539 | Ga0068853_100517572 | Ga0068853_1005175722 | 103 |
| 198 | 3300005548 | Ga0070665_100001902 | Ga0070665_10000190229 | 103 |
| 199 | 3300005548 | Ga0070665_101863332 | Ga0070665_1018633322 | 103 |
| 200 | 3300005563 | Ga0068855_101262346 | Ga0068855_1012623463 | 103 |
| 201 | 3300005614 | Ga0068856_100105374 | Ga0068856_1001053743 | 103 |
| 202 | 3300005616 | Ga0068852_100023347 | Ga0068852_1000233476 | 103 |
| 203 | 3300005616 | Ga0068852_100463128 | Ga0068852_1004631283 | 103 |
| 204 | 3300005616 | Ga0068852_101123298 | Ga0068852_1011232982 | 103 |
| 205 | 3300005617 | Ga0068859_100012435 | Ga0068859_1000124354 | 103 |
| 206 | 3300005842 | Ga0068858_100002723 | Ga0068858_10000272323 | 103 |
| 207 | 3300005842 | Ga0068858_100019342 | Ga0068858_1000193429 | 103 |
| 208 | 3300006051 | Ga0075364_10749321 | Ga0075364_107493212 | 103 |
| 209 | 3300006058 | Ga0075432_10003204 | Ga0075432_100032044 | 103 |
| 210 | 3300006186 | Ga0075369_10287637 | Ga0075369_102876372 | 103 |
| 211 | 3300006195 | Ga0075366_10423496 | Ga0075366_104234962 | 103 |
| 212 | 3300006931 | Ga0097620_100012435 | Ga0097620_10001243512 | 103 |
| 213 | 3300006946 | Ga0079104_1073437 | Ga0079104_10734372 | 103 |
| 214 | 3300009148 | Ga0105243_10235137 | Ga0105243_102351371 | 103 |
| 215 | 3300009177 | Ga0105248_10059350 | Ga0105248_100593506 | 103 |
| 216 | 3300009177 | Ga0105248_11104493 | Ga0105248_111044931 | 103 |
| 217 | 3300013306 | Ga0163162_10033538 | Ga0163162_100335384 | 103 |
| 218 | 3300025920 | Ga0207649_10431907 | Ga0207649_104319072 | 103 |
| 219 | 3300025925 | Ga0207650_10266969 | Ga0207650_102669692 | 103 |
| 220 | 3300025925 | Ga0207650_10370911 | Ga0207650_103709112 | 103 |
| 221 | 3300025941 | Ga0207711_10247837 | Ga0207711_102478372 | 103 |
| 222 | 3300025942 | Ga0207689_10419561 | Ga0207689_104195612 | 103 |
| 223 | 3300025972 | Ga0207668_11212137 | Ga0207668_112121373 | 103 |
| 224 | 3300026035 | Ga0207703_10004226 | Ga0207703_1000422615 | 103 |
| 225 | 3300026035 | Ga0207703_10110237 | Ga0207703_101102373 | 103 |
| 226 | 3300026041 | Ga0207639_10250315 | Ga0207639_102503153 | 103 |
| 227 | 3300026142 | Ga0207698_10017064 | Ga0207698_100170646 | 103 |
| 228 | 3300026142 | Ga0207698_10335514 | Ga0207698_103355142 | 103 |
| 229 | 3300027907 | Ga0207428_10048487 | Ga0207428_100484872 | 103 |
| 230 | 3300028379 | Ga0268266_10000566 | Ga0268266_100005664 | 103 |
| 231 | 3300028379 | Ga0268266_11112741 | Ga0268266_111127412 | 103 |
| 232 | 3300031731 | Ga0307405_10243224 | Ga0307405_102432243 | 103 |
| 233 | 3300031852 | Ga0307410_10261180 | Ga0307410_102611802 | 103 |
| 234 | 3300031911 | Ga0307412_10720557 | Ga0307412_107205572 | 103 |
| 235 | 3300034817 | Ga0373948_0057102 | Ga0373948_0057102_105_419 | 103 |
| 236 | 3300035114 | Ga0373939_0150441 | Ga0373939_0150441_499_813 | 103 |
| 237 | 3300035691 | Ga0373931_0331980 | Ga0373931_0331980_349_663 | 103 |
| 238 | 3300041453 | Ga0451797_0048970 | Ga0451797_0048970_185_499 | 103 |
| 239 | 3300046471 | Ga0495650_0153318 | Ga0495650_0153318_384_710 | 103 |
| 240 | 3300046507 | Ga0495606_0257184 | Ga0495606_0257184_509_838 | 103 |
| 241 | 3300046512 | Ga0495610_0004210 | Ga0495610_0004210_8775_9104 | 103 |
| 242 | 3300046513 | Ga0495616_0000703 | Ga0495616_0000703_14685_15017 | 103 |
| 243 | 3300046519 | Ga0495632_0031269 | Ga0495632_0031269_1253_1579 | 103 |
| 244 | 3300046519 | Ga0495632_0143423 | Ga0495632_0143423_576_905 | 103 |
| 245 | 3300046522 | Ga0495643_0190902 | Ga0495643_0190902_477_806 | 103 |
| 246 | 3300046694 | Ga0495649_0564417 | Ga0495649_0564417_220_546 | 103 |
| 247 | 3300048091 | Ga0495626_0000459 | Ga0495626_0000459_1684_2013 | 103 |
| 248 | 3300048905 | Ga0496102_0773051 | Ga0496102_0773051_284_598 | 103 |
| 249 | 3300048907 | Ga0496104_0707673 | Ga0496104_0707673_464_778 | 103 |
| 250 | 3300048911 | Ga0496108_0859723 | Ga0496108_0859723_106_420 | 103 |
| 251 | 3300048912 | Ga0496109_0048286 | Ga0496109_0048286_2279_2593 | 103 |
| 252 | 3300048913 | Ga0496110_0105773 | Ga0496110_0105773_583_897 | 103 |
| 253 | 3300048916 | Ga0496113_0760919 | Ga0496113_0760919_122_436 | 103 |
| 254 | 3300048929 | Ga0496126_0003221 | Ga0496126_0003221_9642_9956 | 103 |
| 255 | 3300049569 | Ga0501032_0868146 | Ga0501032_0868146_31_351 | 103 |
| 256 | 3300049571 | Ga0501034_0319651 | Ga0501034_0319651_1014_1343 | 103 |
| 257 | 3300049571 | Ga0501034_1239910 | Ga0501034_1239910_107_439 | 103 |
| 258 | 3300049573 | Ga0501037_0990603 | Ga0501037_0990603_46_366 | 103 |
| 259 | 3300049579 | Ga0501043_0495595 | Ga0501043_0495595_55_387 | 103 |
| 260 | 3300049585 | Ga0501069_0066582 | Ga0501069_0066582_44_373 | 103 |
| 261 | 3300049586 | Ga0501070_0103601 | Ga0501070_0103601_1663_1992 | 103 |
| 262 | 3300049823 | Ga0501044_0462032 | Ga0501044_0462032_238_567 | 103 |
| 263 | 3300049823 | Ga0501044_1088463 | Ga0501044_1088463_21_338 | 103 |
| 264 | 3300053090 | Ga0500646_0037808 | Ga0500646_0037808_558_872 | 103 |
| 265 | 3300053116 | Ga0500592_024042 | Ga0500592_024042_221_535 | 103 |
| 266 | 3300053139 | Ga0500568_0001916 | Ga0500568_0001916_9293_9607 | 103 |
| 267 | 3300053153 | Ga0500616_0000101 | Ga0500616_0000101_59605_59919 | 103 |
| 268 | 3300053727 | Ga0500611_048984 | Ga0500611_048984_452_766 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2mfk-assembly1.cif.gz_A | nmr solution structure of chitin-binding domain from dust mite group xii allergen blo t 12 | 0.6885 | 5 | 22 |
| 4af2-assembly1.cif.gz_A | c61s mutant of thiol peroxidase form e. coli. | 0.6051 | 2 | 23 |
| 3kvy-assembly1.cif.gz_A | trapping of an oxocarbenium ion intermediate in up crystals | 0.4575 | 4 | 38 |
| 3ku4-assembly2.cif.gz_C | trapping of an oxocarbenium ion intermediate in up crystals | 0.4555 | 4 | 37 |
| 3fgx-assembly1.cif.gz_A | structure of uncharacterised protein rbstp2171 from bacillus stearothermophilus | 0.4531 | 10 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33229_243_386_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.6293 | 27 | 63 | 1.20.140.10 |
| 2y3cA00 | Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) | 0.6051 | 10 | 23 | 3.90.1580.10 |
| 4af2A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.6051 | 2 | 23 | 3.40.30.10 |
| af_B4FL28_243_386_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.5755 | 24 | 63 | 1.20.140.10 |
| af_K7V5S9_412_555_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.5752 | 24 | 63 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8VZY7-F1-model_v4 | deleted | 0.9717 | 1 | 101 |
|
| AF-A0A2P0B524-F1-model_v4 | Gene transfer agent family protein | 0.9631 | 4 | 101 |
|
| AF-A0A369VSG5-F1-model_v4 | Gene transfer agent family protein | 0.9589 | 4 | 101 |
|
| AF-A0A7X1KRL0-F1-model_v4 | Gene transfer agent family protein | 0.9528 | 4 | 101 |
|
| AF-A0A5C6U617-F1-model_v4 | Gene transfer agent family protein | 0.9526 | 4 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar