F375732

General Info

Members Datasets Scaffolds Average Seq Length
268 189 251 103

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0000703|Ga0495616_0000703_14685_15017
Length 110
Sequence VEVGVEANVARGEAALRVAGEVLVLRPTFAALVAAEAELGPLFALVERAAAGEMRLSEMAALFWHCIDARPEELTREAVGEAVVAMGLAKASPVLKCVIGQVLMGEAASG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
11 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
12 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
13 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
14 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
17 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
189 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 14.55
Nodule 0.37
Rhizoplane 3.73
Rhizosphere 72.39
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_763086 2162886007 Bacteria 3451
2 Ga0055536_1019933 3300003781 Bacteria 2090
3 Ga0055534_1015115 3300003784 Bacteria 1423
4 Ga0055530_10000187 3300003791 Bacteria 55610
5 Ga0055530_10093363 3300003791 Bacteria 613
6 Ga0055531_10002656 3300003794 Bacteria 11794
7 Ga0065704_10000316 3300005289 Bacteria 45883
8 Ga0065704_10806406 3300005289 Bacteria 523
9 Ga0065707_10099685 3300005295 Bacteria 2987
10 Ga0070676_10158183 3300005328 Bacteria 1456
11 Ga0070670_100308835 3300005331 Bacteria 1384
12 Ga0070670_100529081 3300005331 Bacteria 1050
13 Ga0070670_100615891 3300005331 Bacteria 972
14 Ga0070677_10000188 3300005333 Bacteria 21409
15 Ga0068869_100471899 3300005334 Bacteria 1043
16 Ga0070666_10007589 3300005335 Bacteria 6691
17 Ga0070682_100197581 3300005337 Bacteria 1417
18 Ga0068868_100000005 3300005338 Bacteria 132403
19 Ga0070660_100001053 3300005339 Bacteria 18565
20 Ga0070668_100001142 3300005347 Bacteria 18686
21 Ga0070668_100251921 3300005347 Bacteria 1466
22 Ga0070675_100001812 3300005354 Bacteria 15802
23 Ga0070671_100020281 3300005355 Bacteria 5420
24 Ga0070673_100522036 3300005364 Bacteria 1076
25 Ga0070659_100000011 3300005366 Bacteria 185903
26 Ga0070667_100000784 3300005367 Bacteria 29862
27 Ga0070667_100878354 3300005367 Bacteria 834
28 Ga0068867_101765692 3300005459 Bacteria 581
29 Ga0068853_100517572 3300005539 Bacteria 1128
30 Ga0070665_100001902 3300005548 Bacteria 23603
31 Ga0070665_101863332 3300005548 Bacteria 607
32 Ga0068855_101262346 3300005563 Bacteria 766
33 Ga0068854_100008452 3300005578 Bacteria 6619
34 Ga0068856_100105374 3300005614 Bacteria 2814
35 Ga0068852_100023347 3300005616 Bacteria 4977
36 Ga0068852_100463128 3300005616 Bacteria 1257
37 Ga0068852_101123298 3300005616 Bacteria 806
38 Ga0068859_100012435 3300005617 Bacteria 8565
39 Ga0068863_100000202 3300005841 Bacteria 63514
40 Ga0068858_100002723 3300005842 Bacteria 17807
41 Ga0068858_100019342 3300005842 Bacteria 6368
42 Ga0068860_100074223 3300005843 Bacteria 3234
43 Ga0068862_100066281 3300005844 Bacteria 3111
44 Ga0075368_10003106 3300006042 Bacteria 5509
45 Ga0075364_10749321 3300006051 Bacteria 666
46 Ga0075432_10003204 3300006058 Bacteria 5522
47 Ga0075367_10000330 3300006178 Bacteria 16782
48 Ga0075369_10287637 3300006186 Bacteria 766
49 Ga0075366_10003170 3300006195 Bacteria 8614
50 Ga0075366_10423496 3300006195 Bacteria 820
51 Ga0075370_10095407 3300006353 Bacteria 1718
52 Ga0097620_100012435 3300006931 Bacteria 8565
53 Ga0079104_1073437 3300006946 Bacteria 714
54 Ga0105240_11771053 3300009093 Bacteria 644
55 Ga0105245_10612183 3300009098 Bacteria 1117
56 Ga0105245_10849610 3300009098 Bacteria 953
57 Ga0105243_10235137 3300009148 Bacteria 1628
58 Ga0105248_10059350 3300009177 Bacteria 4297
59 Ga0105248_11104493 3300009177 Bacteria 896
60 Ga0105237_10021914 3300009545 Bacteria 6562
61 Ga0105249_10070398 3300009553 Bacteria 3229
62 Ga0157378_10337378 3300013297 Bacteria 1469
63 Ga0163162_10033538 3300013306 Bacteria 5102
64 Ga0157375_10233600 3300013308 Bacteria 1998
65 Ga0209565_1060578 3300025263 Bacteria 657
66 Ga0209675_1000754 3300025291 Bacteria 21760
67 Ga0209676_1000273 3300025292 Bacteria 107724
68 Ga0209676_1000569 3300025292 Bacteria 55557
69 Ga0209676_1071520 3300025292 Bacteria 823
70 Ga0209025_1012209 3300025294 Bacteria 5537
71 Ga0209758_1177739 3300025297 Bacteria 514
72 Ga0209050_1000218 3300025298 Bacteria 128776
73 Ga0209050_1010491 3300025298 Bacteria 4557
74 Ga0209050_1047785 3300025298 Bacteria 1112
75 Ga0209257_1000248 3300025304 Bacteria 125170
76 Ga0209257_1000912 3300025304 Bacteria 41182
77 Ga0209257_1003677 3300025304 Bacteria 12813
78 Ga0207697_10454848 3300025315 Bacteria 567
79 Ga0207682_10001435 3300025893 Bacteria 10998
80 Ga0207680_10004406 3300025903 Bacteria 6677
81 Ga0207645_10509799 3300025907 Bacteria 815
82 Ga0207695_10161437 3300025913 Bacteria 2172
83 Ga0207671_10013955 3300025914 Bacteria 6375
84 Ga0207657_10004726 3300025919 Bacteria 14376
85 Ga0207649_10431907 3300025920 Bacteria 991
86 Ga0207650_10266969 3300025925 Bacteria 1390
87 Ga0207650_10281611 3300025925 Bacteria 1354
88 Ga0207650_10370911 3300025925 Bacteria 1181
89 Ga0207659_10001126 3300025926 Bacteria 15848
90 Ga0207687_10054329 3300025927 Bacteria 2801
91 Ga0207687_10077333 3300025927 Bacteria 2393
92 Ga0207644_10009998 3300025931 Bacteria 6247
93 Ga0207690_10000005 3300025932 Bacteria 581199
94 Ga0207691_10413019 3300025940 Bacteria 1150
95 Ga0207711_10247837 3300025941 Bacteria 1635
96 Ga0207689_10419561 3300025942 Bacteria 1116
97 Ga0207668_10010595 3300025972 Bacteria 5576
98 Ga0207668_11212137 3300025972 Bacteria 678
99 Ga0207640_10328831 3300025981 Bacteria 1220
100 Ga0207658_10000199 3300025986 Bacteria 62791
101 Ga0207677_10000150 3300026023 Bacteria 55710
102 Ga0207703_10004226 3300026035 Bacteria 11837
103 Ga0207703_10110237 3300026035 Bacteria 2348
104 Ga0207639_10250315 3300026041 Bacteria 1545
105 Ga0207708_10269100 3300026075 Bacteria 1378
106 Ga0207641_10000285 3300026088 Bacteria 63539
107 Ga0207641_10010204 3300026088 Bacteria 7725
108 Ga0207648_11587161 3300026089 Bacteria 615
109 Ga0207674_10049549 3300026116 Bacteria 4295
110 Ga0207698_10017064 3300026142 Bacteria 4916
111 Ga0207698_10335514 3300026142 Bacteria 1422
112 Ga0209813_10000182 3300027866 Bacteria 20378
113 Ga0209974_10001446 3300027876 Bacteria 8616
114 Ga0207428_10048487 3300027907 Bacteria 3407
115 Ga0268266_10000566 3300028379 Bacteria 51401
116 Ga0268266_11112741 3300028379 Bacteria 764
117 Ga0268265_10059565 3300028380 Bacteria 2922
118 Ga0268265_11420920 3300028380 Bacteria 696
119 Ga0268264_10055848 3300028381 Bacteria 3300
120 Ga0307405_10019198 3300031731 Bacteria 3791
121 Ga0307405_10243224 3300031731 Bacteria 1334
122 Ga0307405_10618330 3300031731 Bacteria 886
123 Ga0307413_12163633 3300031824 Bacteria 504
124 Ga0307410_10261180 3300031852 Bacteria 1351
125 Ga0307410_10506493 3300031852 Bacteria 994
126 Ga0307407_10350471 3300031903 Bacteria 1045
127 Ga0307412_10002730 3300031911 Bacteria 9815
128 Ga0307412_10004344 3300031911 Bacteria 7904
129 Ga0307412_10051415 3300031911 Bacteria 2723
130 Ga0307412_10720557 3300031911 Bacteria 858
131 Ga0307416_100352282 3300032002 Bacteria 1490
132 Ga0307414_10000148 3300032004 Bacteria 47023
133 Ga0307414_10111149 3300032004 Bacteria 2086
134 Ga0307414_10539751 3300032004 Bacteria 1038
135 Ga0307414_10584925 3300032004 Bacteria 999
136 Ga0307414_11460228 3300032004 Bacteria 636
137 Ga0307414_12013081 3300032004 Bacteria 539
138 Ga0307411_10131459 3300032005 Bacteria 1830
139 Ga0307411_10276239 3300032005 Bacteria 1335
140 Ga0307411_11988955 3300032005 Bacteria 542
141 Ga0307415_100058575 3300032126 Bacteria 2652
142 Ga0373948_0057102 3300034817 Bacteria 850
143 Ga0373939_0150441 3300035114 Bacteria 847
144 Ga0373931_0331980 3300035691 Bacteria 947
145 Ga0451797_0048970 3300041453 Bacteria 554
146 Ga0451576_0018854 3300045051 Bacteria 7543
147 Ga0451576_1065508 3300045051 Bacteria 846
148 Ga0495627_001020 3300046453 Bacteria 18755
149 Ga0495650_0000597 3300046471 Bacteria 49626
150 Ga0495650_0001697 3300046471 Bacteria 20282
151 Ga0495650_0153318 3300046471 Bacteria 826
152 Ga0495596_0000153 3300046500 Bacteria 47822
153 Ga0495607_0050260 3300046501 Bacteria 2428
154 Ga0495583_0354690 3300046506 Bacteria 578
155 Ga0495606_0006535 3300046507 Bacteria 10723
156 Ga0495606_0257184 3300046507 Bacteria 966
157 Ga0495610_0000015 3300046512 Bacteria 391489
158 Ga0495610_0004210 3300046512 Bacteria 10735
159 Ga0495616_0000703 3300046513 Bacteria 24798
160 Ga0495620_0024364 3300046515 Bacteria 2878
161 Ga0495620_0110174 3300046515 Bacteria 1091
162 Ga0495632_0000039 3300046519 Bacteria 150268
163 Ga0495632_0001085 3300046519 Bacteria 23323
164 Ga0495632_0008546 3300046519 Bacteria 6266
165 Ga0495632_0031269 3300046519 Bacteria 2754
166 Ga0495632_0143423 3300046519 Bacteria 1107
167 Ga0495637_0001499 3300046520 Bacteria 13692
168 Ga0495643_0000162 3300046522 Bacteria 106672
169 Ga0495643_0043477 3300046522 Bacteria 2444
170 Ga0495643_0061284 3300046522 Bacteria 1995
171 Ga0495643_0190902 3300046522 Bacteria 989
172 Ga0495648_0165752 3300046524 Bacteria 1137
173 Ga0495663_0000006 3300046525 Bacteria 306938
174 Ga0495609_0125950 3300046538 Bacteria 1099
175 Ga0495633_0000600 3300046558 Bacteria 34616
176 Ga0495633_0000724 3300046558 Bacteria 29905
177 Ga0495668_0126938 3300046616 Bacteria 1396
178 Ga0495611_0188489 3300046648 Bacteria 963
179 Ga0495625_0000528 3300046660 Bacteria 56251
180 Ga0495625_0005379 3300046660 Bacteria 11710
181 Ga0495625_0661034 3300046660 Bacteria 621
182 Ga0495671_0000062 3300046692 Bacteria 106672
183 Ga0495671_0078279 3300046692 Bacteria 1621
184 Ga0495649_0564417 3300046694 Bacteria 563
185 Ga0495681_0000062 3300047470 Bacteria 99851
186 Ga0495686_0618257 3300047472 Bacteria 559
187 Ga0495626_0000459 3300048091 Bacteria 41540
188 Ga0496102_0523556 3300048905 Bacteria 1108
189 Ga0496102_0773051 3300048905 Bacteria 883
190 Ga0496104_0707673 3300048907 Bacteria 915
191 Ga0496108_0859723 3300048911 Bacteria 780
192 Ga0496109_0048286 3300048912 Bacteria 3873
193 Ga0496110_0105773 3300048913 Bacteria 2525
194 Ga0496113_0760919 3300048916 Bacteria 771
195 Ga0496117_0491609 3300048920 Bacteria 597
196 Ga0496119_0112938 3300048922 Bacteria 1505
197 Ga0496120_0055287 3300048923 Bacteria 2245
198 Ga0496120_0210445 3300048923 Bacteria 935
199 Ga0496122_0015988 3300048925 Bacteria 7136
200 Ga0496122_0464320 3300048925 Bacteria 624
201 Ga0496123_0001199 3300048926 Bacteria 37943
202 Ga0496123_0090009 3300048926 Bacteria 1826
203 Ga0496123_0243525 3300048926 Bacteria 891
204 Ga0496123_0326273 3300048926 Bacteria 722
205 Ga0496124_0000648 3300048927 Bacteria 57426
206 Ga0496124_0014953 3300048927 Bacteria 7472
207 Ga0496124_0015075 3300048927 Bacteria 7432
208 Ga0496124_0018190 3300048927 Bacteria 6592
209 Ga0496125_0318975 3300048928 Bacteria 943
210 Ga0496126_0003221 3300048929 Bacteria 20886
211 Ga0496126_0010218 3300048929 Bacteria 9868
212 Ga0496126_0052884 3300048929 Bacteria 3688
213 Ga0501031_0159763 3300049568 Bacteria 1473
214 Ga0501032_0075036 3300049569 Bacteria 2252
215 Ga0501032_0280186 3300049569 Bacteria 1079
216 Ga0501032_0868146 3300049569 Bacteria 569
217 Ga0501033_0001566 3300049570 Bacteria 20182
218 Ga0501034_0103825 3300049571 Bacteria 2835
219 Ga0501034_0319651 3300049571 Bacteria 1485
220 Ga0501034_1239910 3300049571 Bacteria 624
221 Ga0501036_0710120 3300049572 Bacteria 830
222 Ga0501037_0137534 3300049573 Bacteria 1749
223 Ga0501037_0990603 3300049573 Bacteria 548
224 Ga0501038_0200301 3300049574 Bacteria 1602
225 Ga0501039_0224206 3300049575 Bacteria 1477
226 Ga0501042_0942417 3300049578 Bacteria 629
227 Ga0501043_0113886 3300049579 Bacteria 2123
228 Ga0501043_0495595 3300049579 Bacteria 913
229 Ga0501046_0489637 3300049580 Bacteria 882
230 Ga0501047_0014213 3300049581 Bacteria 7566
231 Ga0501069_0066582 3300049585 Bacteria 2014
232 Ga0501070_0103601 3300049586 Bacteria 2353
233 Ga0501035_0037057 3300049822 Bacteria 4417
234 Ga0501035_0257756 3300049822 Bacteria 1479
235 Ga0501044_0010376 3300049823 Bacteria 10107
236 Ga0501044_0387204 3300049823 Bacteria 1312
237 Ga0501044_0462032 3300049823 Bacteria 1175
238 Ga0501044_1088463 3300049823 Bacteria 669
239 nmdc:mga0k408_2924_c1 3300050493 Bacteria 6857
240 nmdc:mga06z11_443_c1 3300050494 Bacteria 15505
241 nmdc:mga04h51_151_c1 3300050495 Bacteria 20376
242 nmdc:mga07m45_122180_c1 3300050496 Bacteria 1504
243 Ga0500646_0037808 3300053090 Bacteria 1349
244 Ga0500592_024042 3300053116 Bacteria 982
245 Ga0500642_0203853 3300053130 Bacteria 920
246 Ga0500568_0001916 3300053139 Bacteria 12763
247 Ga0500588_0022519 3300053146 Bacteria 1717
248 Ga0500616_0000101 3300053153 Bacteria 172722
249 Ga0500611_048984 3300053727 Bacteria 960
250 Ga0500645_009736 3300053730 Bacteria 3217
251 Ga0500661_000095 3300055283 Bacteria 14070

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100001142 Ga0070668_10000114216 89
2 3300005367 Ga0070667_100000784 Ga0070667_1000007844 89
3 3300005841 Ga0068863_100000202 Ga0068863_10000020266 89
4 3300025903 Ga0207680_10004406 Ga0207680_100044068 89
5 3300025925 Ga0207650_10281611 Ga0207650_102816112 89
6 3300025972 Ga0207668_10010595 Ga0207668_100105959 89
7 3300025986 Ga0207658_10000199 Ga0207658_1000019965 89
8 3300026088 Ga0207641_10000285 Ga0207641_1000028561 89
9 3300045051 Ga0451576_0018854 Ga0451576_0018854_5009_5341 89
10 iso_pu_bacteria 2643221563 2643834377 93
11 iso_pu_bacteria 2643221608 2644055302 93
12 3300048929 Ga0496126_0052884 Ga0496126_0052884_373_666 96
13 iso_pu_bacteria 2885429604 2885432626 96
14 3300031824 Ga0307413_12163633 Ga0307413_121636332 97
15 3300013297 Ga0157378_10337378 Ga0157378_103373783 99
16 3300025940 Ga0207691_10413019 Ga0207691_104130192 99
17 3300045051 Ga0451576_1065508 Ga0451576_1065508_531_833 99
18 iso_pu_bacteria 2599185354 2600203442 99
19 iso_pu_bacteria 2599185359 2600228094 99
20 iso_pu_bacteria 2818991466 2819715098 99
21 iso_pu_bacteria 2928526807 2928531114 99
22 iso_pu_bacteria 2928968154 2928972290 99
23 iso_pu_bacteria 2990265787 2990267887 99
24 iso_pu_bacteria 2993693658 2993697095 99
25 3300005337 Ga0070682_100197581 Ga0070682_1001975812 100
26 3300005844 Ga0068862_100066281 Ga0068862_1000662813 100
27 3300006195 Ga0075366_10003170 Ga0075366_100031709 100
28 3300013308 Ga0157375_10233600 Ga0157375_102336001 100
29 3300028380 Ga0268265_10059565 Ga0268265_100595653 100
30 3300032004 Ga0307414_12013081 Ga0307414_120130812 100
31 3300046648 Ga0495611_0188489 Ga0495611_0188489_278_586 100
32 3300050493 nmdc:mga0k408_2924_c1 nmdc:mga0k408_2924_c1_2087_2392 100
33 3300053730 Ga0500645_009736 Ga0500645_009736_701_1009 100
34 3300055283 Ga0500661_000095 Ga0500661_000095_3761_4069 100
35 iso_pu_bacteria 2896184354 2896186003 100
36 iso_pu_bacteria 3000865235 3000867851 100
37 3300005328 Ga0070676_10158183 Ga0070676_101581833 101
38 3300005331 Ga0070670_100615891 Ga0070670_1006158912 101
39 3300005333 Ga0070677_10000188 Ga0070677_1000018810 101
40 3300005335 Ga0070666_10007589 Ga0070666_100075895 101
41 3300005338 Ga0068868_100000005 Ga0068868_10000000594 101
42 3300005339 Ga0070660_100001053 Ga0070660_10000105311 101
43 3300005354 Ga0070675_100001812 Ga0070675_10000181211 101
44 3300005364 Ga0070673_100522036 Ga0070673_1005220361 101
45 3300005366 Ga0070659_100000011 Ga0070659_100000011150 101
46 3300005459 Ga0068867_101765692 Ga0068867_1017656922 101
47 3300009098 Ga0105245_10612183 Ga0105245_106121832 101
48 3300009098 Ga0105245_10849610 Ga0105245_108496102 101
49 3300009553 Ga0105249_10070398 Ga0105249_100703984 101
50 3300025893 Ga0207682_10001435 Ga0207682_100014353 101
51 3300025907 Ga0207645_10509799 Ga0207645_105097992 101
52 3300025919 Ga0207657_10004726 Ga0207657_1000472617 101
53 3300025926 Ga0207659_10001126 Ga0207659_1000112613 101
54 3300025927 Ga0207687_10054329 Ga0207687_100543292 101
55 3300025927 Ga0207687_10077333 Ga0207687_100773332 101
56 3300025932 Ga0207690_10000005 Ga0207690_1000000559 101
57 3300026023 Ga0207677_10000150 Ga0207677_1000015047 101
58 3300026075 Ga0207708_10269100 Ga0207708_102691002 101
59 3300026089 Ga0207648_11587161 Ga0207648_115871612 101
60 3300031731 Ga0307405_10019198 Ga0307405_100191984 101
61 3300031731 Ga0307405_10618330 Ga0307405_106183302 101
62 3300031852 Ga0307410_10506493 Ga0307410_105064931 101
63 3300031903 Ga0307407_10350471 Ga0307407_103504712 101
64 3300031911 Ga0307412_10051415 Ga0307412_100514156 101
65 3300032002 Ga0307416_100352282 Ga0307416_1003522824 101
66 3300032004 Ga0307414_10539751 Ga0307414_105397513 101
67 3300032005 Ga0307411_10131459 Ga0307411_101314594 101
68 3300032126 Ga0307415_100058575 Ga0307415_1000585754 101
69 3300046453 Ga0495627_001020 Ga0495627_001020_8037_8345 101
70 3300046471 Ga0495650_0000597 Ga0495650_0000597_25129_25437 101
71 3300046512 Ga0495610_0000015 Ga0495610_0000015_278139_278447 101
72 3300046515 Ga0495620_0024364 Ga0495620_0024364_1726_2034 101
73 3300046515 Ga0495620_0110174 Ga0495620_0110174_20_328 101
74 3300046519 Ga0495632_0001085 Ga0495632_0001085_12976_13284 101
75 3300047470 Ga0495681_0000062 Ga0495681_0000062_40454_40762 101
76 3300048925 Ga0496122_0015988 Ga0496122_0015988_4829_5137 101
77 3300048926 Ga0496123_0001199 Ga0496123_0001199_30251_30559 101
78 iso_pu_bacteria 8054302542 8054305438 101
79 3300003781 Ga0055536_1019933 Ga0055536_10199333 102
80 3300003784 Ga0055534_1015115 Ga0055534_10151154 102
81 3300003791 Ga0055530_10000187 Ga0055530_1000018717 102
82 3300003791 Ga0055530_10093363 Ga0055530_100933632 102
83 3300003794 Ga0055531_10002656 Ga0055531_100026569 102
84 3300005355 Ga0070671_100020281 Ga0070671_1000202813 102
85 3300005578 Ga0068854_100008452 Ga0068854_1000084523 102
86 3300005843 Ga0068860_100074223 Ga0068860_1000742236 102
87 3300006042 Ga0075368_10003106 Ga0075368_100031062 102
88 3300006178 Ga0075367_10000330 Ga0075367_1000033018 102
89 3300006353 Ga0075370_10095407 Ga0075370_100954075 102
90 3300009093 Ga0105240_11771053 Ga0105240_117710532 102
91 3300009545 Ga0105237_10021914 Ga0105237_100219145 102
92 3300025263 Ga0209565_1060578 Ga0209565_10605782 102
93 3300025291 Ga0209675_1000754 Ga0209675_100075416 102
94 3300025292 Ga0209676_1000273 Ga0209676_100027343 102
95 3300025292 Ga0209676_1000569 Ga0209676_100056929 102
96 3300025292 Ga0209676_1071520 Ga0209676_10715202 102
97 3300025294 Ga0209025_1012209 Ga0209025_10122091 102
98 3300025297 Ga0209758_1177739 Ga0209758_11777391 102
99 3300025298 Ga0209050_1000218 Ga0209050_100021841 102
100 3300025298 Ga0209050_1010491 Ga0209050_10104914 102
101 3300025298 Ga0209050_1047785 Ga0209050_10477853 102
102 3300025304 Ga0209257_1000248 Ga0209257_100024815 102
103 3300025304 Ga0209257_1000912 Ga0209257_100091211 102
104 3300025304 Ga0209257_1003677 Ga0209257_10036778 102
105 3300025315 Ga0207697_10454848 Ga0207697_104548481 102
106 3300025913 Ga0207695_10161437 Ga0207695_101614375 102
107 3300025914 Ga0207671_10013955 Ga0207671_100139557 102
108 3300025931 Ga0207644_10009998 Ga0207644_100099984 102
109 3300025981 Ga0207640_10328831 Ga0207640_103288312 102
110 3300026088 Ga0207641_10010204 Ga0207641_100102044 102
111 3300026116 Ga0207674_10049549 Ga0207674_100495491 102
112 3300027866 Ga0209813_10000182 Ga0209813_1000018210 102
113 3300027876 Ga0209974_10001446 Ga0209974_100014469 102
114 3300028380 Ga0268265_11420920 Ga0268265_114209201 102
115 3300028381 Ga0268264_10055848 Ga0268264_100558486 102
116 3300031911 Ga0307412_10002730 Ga0307412_100027303 102
117 3300031911 Ga0307412_10004344 Ga0307412_100043444 102
118 3300032004 Ga0307414_10000148 Ga0307414_1000014814 102
119 3300032004 Ga0307414_10111149 Ga0307414_101111493 102
120 3300032004 Ga0307414_10584925 Ga0307414_105849252 102
121 3300032004 Ga0307414_11460228 Ga0307414_114602282 102
122 3300032005 Ga0307411_10276239 Ga0307411_102762392 102
123 3300032005 Ga0307411_11988955 Ga0307411_119889552 102
124 3300046471 Ga0495650_0001697 Ga0495650_0001697_1605_1922 102
125 3300046500 Ga0495596_0000153 Ga0495596_0000153_37274_37585 102
126 3300046501 Ga0495607_0050260 Ga0495607_0050260_1851_2162 102
127 3300046506 Ga0495583_0354690 Ga0495583_0354690_160_471 102
128 3300046507 Ga0495606_0006535 Ga0495606_0006535_8698_9009 102
129 3300046519 Ga0495632_0000039 Ga0495632_0000039_70810_71124 102
130 3300046519 Ga0495632_0008546 Ga0495632_0008546_1018_1329 102
131 3300046520 Ga0495637_0001499 Ga0495637_0001499_3665_3979 102
132 3300046522 Ga0495643_0000162 Ga0495643_0000162_70090_70404 102
133 3300046522 Ga0495643_0043477 Ga0495643_0043477_553_864 102
134 3300046522 Ga0495643_0061284 Ga0495643_0061284_1519_1830 102
135 3300046524 Ga0495648_0165752 Ga0495648_0165752_747_1061 102
136 3300046525 Ga0495663_0000006 Ga0495663_0000006_70893_71207 102
137 3300046538 Ga0495609_0125950 Ga0495609_0125950_133_444 102
138 3300046558 Ga0495633_0000600 Ga0495633_0000600_17905_18219 102
139 3300046558 Ga0495633_0000724 Ga0495633_0000724_10849_11163 102
140 3300046616 Ga0495668_0126938 Ga0495668_0126938_199_510 102
141 3300046660 Ga0495625_0000528 Ga0495625_0000528_33968_34279 102
142 3300046660 Ga0495625_0005379 Ga0495625_0005379_7863_8174 102
143 3300046660 Ga0495625_0661034 Ga0495625_0661034_206_520 102
144 3300046692 Ga0495671_0000062 Ga0495671_0000062_70090_70404 102
145 3300046692 Ga0495671_0078279 Ga0495671_0078279_1234_1545 102
146 3300047472 Ga0495686_0618257 Ga0495686_0618257_84_398 102
147 3300048905 Ga0496102_0523556 Ga0496102_0523556_446_760 102
148 3300048920 Ga0496117_0491609 Ga0496117_0491609_169_483 102
149 3300048922 Ga0496119_0112938 Ga0496119_0112938_579_890 102
150 3300048923 Ga0496120_0055287 Ga0496120_0055287_665_979 102
151 3300048923 Ga0496120_0210445 Ga0496120_0210445_78_389 102
152 3300048925 Ga0496122_0464320 Ga0496122_0464320_48_362 102
153 3300048926 Ga0496123_0090009 Ga0496123_0090009_1280_1594 102
154 3300048926 Ga0496123_0243525 Ga0496123_0243525_220_534 102
155 3300048926 Ga0496123_0326273 Ga0496123_0326273_107_421 102
156 3300048927 Ga0496124_0000648 Ga0496124_0000648_17636_17950 102
157 3300048927 Ga0496124_0014953 Ga0496124_0014953_3398_3709 102
158 3300048927 Ga0496124_0015075 Ga0496124_0015075_1534_1848 102
159 3300048927 Ga0496124_0018190 Ga0496124_0018190_3165_3479 102
160 3300048928 Ga0496125_0318975 Ga0496125_0318975_425_739 102
161 3300048929 Ga0496126_0010218 Ga0496126_0010218_2814_3125 102
162 3300049568 Ga0501031_0159763 Ga0501031_0159763_685_996 102
163 3300049569 Ga0501032_0075036 Ga0501032_0075036_350_664 102
164 3300049569 Ga0501032_0280186 Ga0501032_0280186_665_976 102
165 3300049570 Ga0501033_0001566 Ga0501033_0001566_14981_15295 102
166 3300049571 Ga0501034_0103825 Ga0501034_0103825_775_1086 102
167 3300049572 Ga0501036_0710120 Ga0501036_0710120_373_687 102
168 3300049573 Ga0501037_0137534 Ga0501037_0137534_562_873 102
169 3300049574 Ga0501038_0200301 Ga0501038_0200301_1268_1582 102
170 3300049575 Ga0501039_0224206 Ga0501039_0224206_527_841 102
171 3300049578 Ga0501042_0942417 Ga0501042_0942417_144_455 102
172 3300049579 Ga0501043_0113886 Ga0501043_0113886_479_793 102
173 3300049580 Ga0501046_0489637 Ga0501046_0489637_361_675 102
174 3300049581 Ga0501047_0014213 Ga0501047_0014213_1859_2173 102
175 3300049822 Ga0501035_0037057 Ga0501035_0037057_157_471 102
176 3300049822 Ga0501035_0257756 Ga0501035_0257756_886_1197 102
177 3300049823 Ga0501044_0010376 Ga0501044_0010376_6163_6477 102
178 3300049823 Ga0501044_0387204 Ga0501044_0387204_533_844 102
179 3300050494 nmdc:mga06z11_443_c1 nmdc:mga06z11_443_c1_7292_7606 102
180 3300050495 nmdc:mga04h51_151_c1 nmdc:mga04h51_151_c1_12771_13085 102
181 3300050496 nmdc:mga07m45_122180_c1 nmdc:mga07m45_122180_c1_383_697 102
182 3300053130 Ga0500642_0203853 Ga0500642_0203853_494_805 102
183 3300053146 Ga0500588_0022519 Ga0500588_0022519_582_893 102
184 iso_pu_bacteria 2808606401 2809061937 102
185 iso_pu_bacteria 2808606404 2809077901 102
186 iso_pu_bacteria 2808606405 2809082391 102
187 iso_pu_bacteria 2880518877 2880519879 102
188 2162886007 SwRhRL2b_contig_763086 SwRhRL2b_0749.00007130 103
189 3300005289 Ga0065704_10000316 Ga0065704_100003169 103
190 3300005289 Ga0065704_10806406 Ga0065704_108064061 103
191 3300005295 Ga0065707_10099685 Ga0065707_100996852 103
192 3300005331 Ga0070670_100308835 Ga0070670_1003088354 103
193 3300005331 Ga0070670_100529081 Ga0070670_1005290812 103
194 3300005334 Ga0068869_100471899 Ga0068869_1004718992 103
195 3300005347 Ga0070668_100251921 Ga0070668_1002519213 103
196 3300005367 Ga0070667_100878354 Ga0070667_1008783542 103
197 3300005539 Ga0068853_100517572 Ga0068853_1005175722 103
198 3300005548 Ga0070665_100001902 Ga0070665_10000190229 103
199 3300005548 Ga0070665_101863332 Ga0070665_1018633322 103
200 3300005563 Ga0068855_101262346 Ga0068855_1012623463 103
201 3300005614 Ga0068856_100105374 Ga0068856_1001053743 103
202 3300005616 Ga0068852_100023347 Ga0068852_1000233476 103
203 3300005616 Ga0068852_100463128 Ga0068852_1004631283 103
204 3300005616 Ga0068852_101123298 Ga0068852_1011232982 103
205 3300005617 Ga0068859_100012435 Ga0068859_1000124354 103
206 3300005842 Ga0068858_100002723 Ga0068858_10000272323 103
207 3300005842 Ga0068858_100019342 Ga0068858_1000193429 103
208 3300006051 Ga0075364_10749321 Ga0075364_107493212 103
209 3300006058 Ga0075432_10003204 Ga0075432_100032044 103
210 3300006186 Ga0075369_10287637 Ga0075369_102876372 103
211 3300006195 Ga0075366_10423496 Ga0075366_104234962 103
212 3300006931 Ga0097620_100012435 Ga0097620_10001243512 103
213 3300006946 Ga0079104_1073437 Ga0079104_10734372 103
214 3300009148 Ga0105243_10235137 Ga0105243_102351371 103
215 3300009177 Ga0105248_10059350 Ga0105248_100593506 103
216 3300009177 Ga0105248_11104493 Ga0105248_111044931 103
217 3300013306 Ga0163162_10033538 Ga0163162_100335384 103
218 3300025920 Ga0207649_10431907 Ga0207649_104319072 103
219 3300025925 Ga0207650_10266969 Ga0207650_102669692 103
220 3300025925 Ga0207650_10370911 Ga0207650_103709112 103
221 3300025941 Ga0207711_10247837 Ga0207711_102478372 103
222 3300025942 Ga0207689_10419561 Ga0207689_104195612 103
223 3300025972 Ga0207668_11212137 Ga0207668_112121373 103
224 3300026035 Ga0207703_10004226 Ga0207703_1000422615 103
225 3300026035 Ga0207703_10110237 Ga0207703_101102373 103
226 3300026041 Ga0207639_10250315 Ga0207639_102503153 103
227 3300026142 Ga0207698_10017064 Ga0207698_100170646 103
228 3300026142 Ga0207698_10335514 Ga0207698_103355142 103
229 3300027907 Ga0207428_10048487 Ga0207428_100484872 103
230 3300028379 Ga0268266_10000566 Ga0268266_100005664 103
231 3300028379 Ga0268266_11112741 Ga0268266_111127412 103
232 3300031731 Ga0307405_10243224 Ga0307405_102432243 103
233 3300031852 Ga0307410_10261180 Ga0307410_102611802 103
234 3300031911 Ga0307412_10720557 Ga0307412_107205572 103
235 3300034817 Ga0373948_0057102 Ga0373948_0057102_105_419 103
236 3300035114 Ga0373939_0150441 Ga0373939_0150441_499_813 103
237 3300035691 Ga0373931_0331980 Ga0373931_0331980_349_663 103
238 3300041453 Ga0451797_0048970 Ga0451797_0048970_185_499 103
239 3300046471 Ga0495650_0153318 Ga0495650_0153318_384_710 103
240 3300046507 Ga0495606_0257184 Ga0495606_0257184_509_838 103
241 3300046512 Ga0495610_0004210 Ga0495610_0004210_8775_9104 103
242 3300046513 Ga0495616_0000703 Ga0495616_0000703_14685_15017 103
243 3300046519 Ga0495632_0031269 Ga0495632_0031269_1253_1579 103
244 3300046519 Ga0495632_0143423 Ga0495632_0143423_576_905 103
245 3300046522 Ga0495643_0190902 Ga0495643_0190902_477_806 103
246 3300046694 Ga0495649_0564417 Ga0495649_0564417_220_546 103
247 3300048091 Ga0495626_0000459 Ga0495626_0000459_1684_2013 103
248 3300048905 Ga0496102_0773051 Ga0496102_0773051_284_598 103
249 3300048907 Ga0496104_0707673 Ga0496104_0707673_464_778 103
250 3300048911 Ga0496108_0859723 Ga0496108_0859723_106_420 103
251 3300048912 Ga0496109_0048286 Ga0496109_0048286_2279_2593 103
252 3300048913 Ga0496110_0105773 Ga0496110_0105773_583_897 103
253 3300048916 Ga0496113_0760919 Ga0496113_0760919_122_436 103
254 3300048929 Ga0496126_0003221 Ga0496126_0003221_9642_9956 103
255 3300049569 Ga0501032_0868146 Ga0501032_0868146_31_351 103
256 3300049571 Ga0501034_0319651 Ga0501034_0319651_1014_1343 103
257 3300049571 Ga0501034_1239910 Ga0501034_1239910_107_439 103
258 3300049573 Ga0501037_0990603 Ga0501037_0990603_46_366 103
259 3300049579 Ga0501043_0495595 Ga0501043_0495595_55_387 103
260 3300049585 Ga0501069_0066582 Ga0501069_0066582_44_373 103
261 3300049586 Ga0501070_0103601 Ga0501070_0103601_1663_1992 103
262 3300049823 Ga0501044_0462032 Ga0501044_0462032_238_567 103
263 3300049823 Ga0501044_1088463 Ga0501044_1088463_21_338 103
264 3300053090 Ga0500646_0037808 Ga0500646_0037808_558_872 103
265 3300053116 Ga0500592_024042 Ga0500592_024042_221_535 103
266 3300053139 Ga0500568_0001916 Ga0500568_0001916_9293_9607 103
267 3300053153 Ga0500616_0000101 Ga0500616_0000101_59605_59919 103
268 3300053727 Ga0500611_048984 Ga0500611_048984_452_766 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11836

Phage_TAC_11

Phage tail tube protein, GTA-gp10

11

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mfk-assembly1.cif.gz_A nmr solution structure of chitin-binding domain from dust mite group xii allergen blo t 12 0.6885 5 22
4af2-assembly1.cif.gz_A c61s mutant of thiol peroxidase form e. coli. 0.6051 2 23
3kvy-assembly1.cif.gz_A trapping of an oxocarbenium ion intermediate in up crystals 0.4575 4 38
3ku4-assembly2.cif.gz_C trapping of an oxocarbenium ion intermediate in up crystals 0.4555 4 37
3fgx-assembly1.cif.gz_A structure of uncharacterised protein rbstp2171 from bacillus stearothermophilus 0.4531 10 103
ID Description Score Start End Superfamily
af_O33229_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.6293 27 63 1.20.140.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6051 10 23 3.90.1580.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6051 2 23 3.40.30.10
af_B4FL28_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.5755 24 63 1.20.140.10
af_K7V5S9_412_555_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.5752 24 63 1.20.140.10
ID Description Score Start End GO Terms
AF-J8VZY7-F1-model_v4 deleted 0.9717 1 101
AF-A0A2P0B524-F1-model_v4 Gene transfer agent family protein 0.9631 4 101
AF-A0A369VSG5-F1-model_v4 Gene transfer agent family protein 0.9589 4 101
AF-A0A7X1KRL0-F1-model_v4 Gene transfer agent family protein 0.9528 4 101
AF-A0A5C6U617-F1-model_v4 Gene transfer agent family protein 0.9526 4 101

Feature Viewer

pLDDT pTM Quality
92.63 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map