F376085

General Info

Members Datasets Scaffolds Average Seq Length
269 226 252 151

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100053071|Ga0070702_1000530712
Length 188
Sequence VEQTLTDQQTTCESVRDTGRASRFSTGLEALPPTPAKLHRPLPPFTEETARQKVQAAEDAWNTLDPERVAQAYTPDSQWRNRDEFFDGRDEIIAFLERKWGERELDYGLRKDLWAFHGNRIAVRFQYESHDASGQWWRSYGNEQWEFDDEGYMRRREASINDVRIDESERRIFGPRPESERAQPLPLR

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
3 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
4 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
9 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
10 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
11 2867475112 Streptomyces sp. TM32 Isolate Unclassified
12 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
13 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
14 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
15 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
16 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.57
Metatranscriptomes 1.12
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 8.55
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10037417 3300001991 Bacteria 968
2 JGI24742J22300_10099401 3300002244 Bacteria 562
3 rootH2_10123891 3300003320 Bacteria 1226
4 Ga0070683_101173174 3300005329 Bacteria 738
5 Ga0068869_100362762 3300005334 Bacteria 1183
6 Ga0070660_100150687 3300005339 Bacteria 1869
7 Ga0070689_100171195 3300005340 Bacteria 1760
8 Ga0070687_100101483 3300005343 Bacteria 1612
9 Ga0070688_100464411 3300005365 Bacteria 949
10 Ga0070659_100216317 3300005366 Bacteria 1580
11 Ga0070714_100162757 3300005435 Bacteria 2020
12 Ga0070714_100543362 3300005435 Bacteria 1112
13 Ga0070711_100030022 3300005439 Bacteria 3594
14 Ga0070663_100560865 3300005455 Bacteria 956
15 Ga0070681_10071743 3300005458 Bacteria 3428
16 Ga0068867_100451430 3300005459 Bacteria 1095
17 Ga0070685_10038634 3300005466 Bacteria 2707
18 Ga0070706_100017128 3300005467 Bacteria 6696
19 Ga0070679_100640548 3300005530 Bacteria 1006
20 Ga0070697_100924520 3300005536 Bacteria 774
21 Ga0070693_100124100 3300005547 Bacteria 1605
22 Ga0068855_100937997 3300005563 Bacteria 912
23 Ga0070664_100263297 3300005564 Bacteria 1552
24 Ga0070664_100389036 3300005564 Bacteria 1274
25 Ga0068857_100556913 3300005577 Bacteria 1081
26 Ga0068854_100205494 3300005578 Bacteria 1550
27 Ga0070702_100053071 3300005615 Bacteria 2327
28 Ga0068859_100283820 3300005617 Bacteria 1748
29 Ga0068864_100180540 3300005618 Bacteria 1929
30 Ga0068866_10079227 3300005718 Bacteria 1759
31 Ga0068851_10212101 3300005834 Bacteria 1085
32 Ga0068858_101577908 3300005842 Bacteria 648
33 Ga0081455_10013436 3300005937 Bacteria 8093
34 Ga0070712_100000801 3300006175 Bacteria 18657
35 Ga0070712_100060266 3300006175 Bacteria 2676
36 Ga0075433_10120858 3300006852 Bacteria 2326
37 Ga0075434_100760715 3300006871 Bacteria 986
38 Ga0097620_100283816 3300006931 Bacteria 1748
39 Ga0105240_10435768 3300009093 Bacteria 1470
40 Ga0105245_10988775 3300009098 Bacteria 885
41 Ga0105243_11470422 3300009148 Bacteria 704
42 Ga0105237_10005369 3300009545 Bacteria 14494
43 Ga0105237_10411260 3300009545 Bacteria 1358
44 Ga0105237_11694294 3300009545 Bacteria 639
45 Ga0105238_10371994 3300009551 Bacteria 1419
46 Ga0105238_11889098 3300009551 Bacteria 630
47 Ga0105249_10076760 3300009553 Bacteria 3097
48 Ga0105249_13226803 3300009553 Bacteria 524
49 Ga0099796_10210166 3300010159 Bacteria 793
50 Ga0105239_10675135 3300010375 Bacteria 1181
51 Ga0105239_11402995 3300010375 Bacteria 806
52 Ga0157320_1017743 3300012481 Bacteria 622
53 Ga0157373_10374257 3300013100 Bacteria 1018
54 Ga0157371_11117647 3300013102 Bacteria 605
55 Ga0157370_10526088 3300013104 Bacteria 1085
56 Ga0157369_10012207 3300013105 Bacteria 9753
57 Ga0157369_10181765 3300013105 Bacteria 2213
58 Ga0157374_10311347 3300013296 Bacteria 1559
59 Ga0157374_10545526 3300013296 Bacteria 1167
60 Ga0157372_10136711 3300013307 Bacteria 2823
61 Ga0157375_10408017 3300013308 Bacteria 1525
62 Ga0163163_10167667 3300014325 Bacteria 2242
63 Ga0182008_10000517 3300014497 Bacteria 28996
64 Ga0157379_10646443 3300014968 Bacteria 990
65 Ga0182007_10004522 3300015262 Bacteria 6288
66 Ga0197907_11471987 3300020069 Bacteria 673
67 Ga0206350_10763921 3300020080 Bacteria 679
68 Ga0213876_10041431 3300021384 Bacteria 2433
69 Ga0224712_10462327 3300022467 Bacteria 610
70 Ga0207642_10215827 3300025899 Bacteria 1069
71 Ga0207710_10000214 3300025900 Bacteria 51172
72 Ga0207710_10051708 3300025900 Bacteria 1846
73 Ga0207688_10643751 3300025901 Bacteria 669
74 Ga0207699_10454748 3300025906 Bacteria 919
75 Ga0207684_10040682 3300025910 Bacteria 3941
76 Ga0207707_10059993 3300025912 Bacteria 3310
77 Ga0207707_10247823 3300025912 Bacteria 1548
78 Ga0207707_10902561 3300025912 Bacteria 730
79 Ga0207671_10240562 3300025914 Bacteria 1422
80 Ga0207693_10001195 3300025915 Bacteria 23193
81 Ga0207663_10050771 3300025916 Bacteria 2579
82 Ga0207662_10096060 3300025918 Bacteria 1830
83 Ga0207657_10264830 3300025919 Bacteria 1367
84 Ga0207652_10416079 3300025921 Bacteria 1212
85 Ga0207687_10200964 3300025927 Bacteria 1558
86 Ga0207700_10222568 3300025928 Bacteria 1601
87 Ga0207664_10421778 3300025929 Bacteria 1188
88 Ga0207664_11634654 3300025929 Bacteria 566
89 Ga0207709_10301976 3300025935 Bacteria 1191
90 Ga0207670_10189000 3300025936 Bacteria 1557
91 Ga0207665_10499850 3300025939 Bacteria 939
92 Ga0207661_10237540 3300025944 Bacteria 1616
93 Ga0207679_10739681 3300025945 Bacteria 894
94 Ga0207667_10984554 3300025949 Bacteria 831
95 Ga0207712_11127315 3300025961 Bacteria 699
96 Ga0207640_10443749 3300025981 Bacteria 1068
97 Ga0207677_10149037 3300026023 Bacteria 1802
98 Ga0207703_10774188 3300026035 Bacteria 915
99 Ga0207639_10247617 3300026041 Bacteria 1553
100 Ga0207702_10690055 3300026078 Bacteria 1006
101 Ga0207702_10810414 3300026078 Bacteria 926
102 Ga0207648_10039916 3300026089 Bacteria 4126
103 Ga0207676_10195083 3300026095 Bacteria 1785
104 Ga0207675_100054201 3300026118 Bacteria 3741
105 Ga0207683_10054966 3300026121 Bacteria 3491
106 Ga0207428_10375371 3300027907 Bacteria 1044
107 Ga0265357_1017417 3300028023 Bacteria 770
108 Ga0268265_10659866 3300028380 Bacteria 1006
109 Ga0268264_10501177 3300028381 Bacteria 1184
110 Ga0316181_1122073 3300030744 Bacteria 788
111 Ga0307513_10507892 3300031456 Bacteria 922
112 Ga0307509_10009368 3300031507 Bacteria 12267
113 Ga0307514_10008253 3300031649 Bacteria 8887
114 Ga0307516_10000862 3300031730 Bacteria 41576
115 Ga0307516_10013126 3300031730 Bacteria 8856
116 Ga0307516_10046117 3300031730 Bacteria 4302
117 Ga0307405_10000044 3300031731 Bacteria 77117
118 Ga0307413_10789483 3300031824 Bacteria 797
119 Ga0307518_10131224 3300031838 Bacteria 1761
120 Ga0307410_10597296 3300031852 Bacteria 920
121 Ga0307406_10019546 3300031901 Bacteria 3977
122 Ga0307407_10000007 3300031903 Bacteria 210716
123 Ga0307409_100080452 3300031995 Unclassified 2629
124 Ga0307416_100000015 3300032002 Bacteria 210716
125 Ga0307416_101071131 3300032002 Bacteria 910
126 Ga0307414_10015081 3300032004 Bacteria 4656
127 Ga0307415_100596490 3300032126 Bacteria 982
128 Ga0307510_10197491 3300033180 Bacteria 1551
129 Ga0307510_10344331 3300033180 Bacteria 942
130 Ga0373959_0156917 3300034820 Bacteria 579
131 Ga0373949_0215664 3300035090 Bacteria 582
132 Ga0373939_0047008 3300035114 Bacteria 1324
133 Ga0373941_0127341 3300035115 Bacteria 914
134 Ga0373957_0330720 3300035120 Bacteria 649
135 Ga0373960_0374913 3300035121 Bacteria 544
136 Ga0373955_0178804 3300035172 Bacteria 1258
137 Ga0373962_0242828 3300035242 Bacteria 623
138 Ga0373924_0042999 3300035410 Bacteria 1855
139 Ga0373931_0005298 3300035691 Bacteria 5950
140 Ga0373931_0558590 3300035691 Bacteria 744
141 Ga0373933_0157227 3300035724 Bacteria 1442
142 Ga0373937_0050612 3300036401 Bacteria 3805
143 Ga0395901_0338434 3300038443 Bacteria 1555
144 Ga0436365_1820273 3300039437 Bacteria 9459
145 Ga0436363_0217461 3300039450 Bacteria 1206
146 Ga0436363_0457184 3300039450 Bacteria 1292
147 Ga0436362_0293949 3300039453 Bacteria 1014
148 Ga0436362_0972732 3300039453 Bacteria 2301
149 Ga0439436_0007321 3300041404 Bacteria 3397
150 Ga0439439_0002600 3300041406 Bacteria 3863
151 Ga0451807_1177130 3300041486 Bacteria 589
152 Ga0439433_0020722 3300041999 Bacteria 1469
153 Ga0439449_0003550 3300042007 Bacteria 6058
154 Ga0439449_0005577 3300042007 Bacteria 4817
155 Ga0439457_004004 3300042014 Bacteria 3917
156 Ga0466969_0040342 3300044656 Bacteria 2339
157 Ga0466965_0360891 3300044683 Bacteria 797
158 Ga0466961_0022802 3300044693 Bacteria 4027
159 Ga0466961_0755277 3300044693 Bacteria 581
160 Ga0466963_0189788 3300044694 Bacteria 1435
161 Ga0466963_0198147 3300044694 Bacteria 1404
162 Ga0466964_0030837 3300044706 Bacteria 2124
163 Ga0466968_0008451 3300044735 Bacteria 3944
164 Ga0466957_0579034 3300044842 Bacteria 784
165 Ga0466960_0186346 3300044901 Bacteria 1127
166 Ga0466960_0336946 3300044901 Bacteria 857
167 Ga0466959_0049430 3300045049 Bacteria 3090
168 Ga0466959_0906379 3300045049 Bacteria 588
169 Ga0466958_0008956 3300045836 Bacteria 5561
170 Ga0466958_0014463 3300045836 Bacteria 4507
171 Ga0466958_0108927 3300045836 Bacteria 1728
172 Ga0466958_0745707 3300045836 Bacteria 638
173 Ga0466967_0027335 3300045976 Bacteria 4744
174 Ga0466967_0028499 3300045976 Bacteria 4661
175 Ga0466967_0526993 3300045976 Bacteria 1161
176 Ga0466967_0641372 3300045976 Bacteria 1050
177 Ga0466967_0738668 3300045976 Bacteria 976
178 Ga0495592_0037998 3300046454 Bacteria 3623
179 Ga0495651_0020739 3300046462 Bacteria 5102
180 Ga0495653_0031638 3300046463 Bacteria 4204
181 Ga0495664_0306741 3300046477 Bacteria 958
182 Ga0495608_0039759 3300046511 Bacteria 3151
183 Ga0495618_0147008 3300046514 Bacteria 1506
184 Ga0495628_0125899 3300046516 Bacteria 1963
185 Ga0495630_0276527 3300046517 Bacteria 1283
186 Ga0495652_0148873 3300046529 Bacteria 1831
187 Ga0495665_0173541 3300046531 Bacteria 1122
188 Ga0495640_0103726 3300046533 Bacteria 1864
189 Ga0495587_0029187 3300046536 Bacteria 3350
190 Ga0495645_0064485 3300046543 Bacteria 2651
191 Ga0495667_0066242 3300046559 Bacteria 2361
192 Ga0495635_0002714 3300046663 Bacteria 12118
193 Ga0495635_0023292 3300046663 Bacteria 4316
194 Ga0495657_0058960 3300046675 Bacteria 2547
195 Ga0495599_0016356 3300046678 Bacteria 4606
196 Ga0495623_0100647 3300046679 Bacteria 1761
197 Ga0495646_0014262 3300046680 Bacteria 5055
198 Ga0495613_0133248 3300046689 Bacteria 1779
199 Ga0495600_0119097 3300046809 Bacteria 1717
200 Ga0495581_0347681 3300047315 Bacteria 865
201 Ga0495604_0028657 3300047317 Bacteria 4430
202 Ga0495674_0110956 3300047319 Bacteria 2325
203 Ga0495676_0708334 3300047321 Bacteria 651
204 Ga0495680_0007284 3300047322 Bacteria 10181
205 Ga0495675_0056912 3300047444 Bacteria 2479
206 Ga0495684_0022779 3300047471 Bacteria 4817
207 Ga0495593_0174136 3300047673 Bacteria 1084
208 Ga0495602_0075967 3300048088 Bacteria 2849
209 Ga0496101_0103448 3300048904 Bacteria 2134
210 Ga0496102_0114223 3300048905 Bacteria 2519
211 Ga0496103_0125162 3300048906 Bacteria 1639
212 Ga0496104_0149145 3300048907 Bacteria 2245
213 Ga0496105_0047309 3300048908 Bacteria 3550
214 Ga0496105_0159329 3300048908 Bacteria 1853
215 Ga0496106_1293422 3300048909 Bacteria 566
216 Ga0496107_0417819 3300048910 Bacteria 997
217 Ga0496108_0143735 3300048911 Bacteria 2056
218 Ga0496109_0033520 3300048912 Bacteria 4621
219 Ga0496109_0295666 3300048912 Bacteria 1527
220 Ga0496109_0803574 3300048912 Bacteria 878
221 Ga0496110_0549600 3300048913 Bacteria 1049
222 Ga0496111_0030673 3300048914 Bacteria 3824
223 Ga0496112_0050037 3300048915 Bacteria 4096
224 Ga0496112_1518807 3300048915 Bacteria 583
225 Ga0496114_0054718 3300048917 Bacteria 3328
226 Ga0496114_0110164 3300048917 Bacteria 2358
227 Ga0496115_0049919 3300048918 Bacteria 3350
228 Ga0496115_0201187 3300048918 Bacteria 1645
229 Ga0496126_0081365 3300048929 Bacteria 2863
230 Ga0501034_0759307 3300049571 Bacteria 865
231 Ga0501038_0167128 3300049574 Bacteria 1784
232 Ga0501046_0189230 3300049580 Bacteria 1536
233 Ga0501047_0235678 3300049581 Bacteria 1682
234 Ga0501069_0048402 3300049585 Bacteria 2361
235 Ga0501069_0149042 3300049585 Bacteria 1344
236 Ga0501072_1113205 3300049588 Bacteria 614
237 Ga0501080_0000008 3300049742 Bacteria 134920
238 nmdc:mga0n895_407793_c1 3300050512 Bacteria 1374
239 nmdc:mga0a205_430729_c1 3300050515 Bacteria 1180
240 nmdc:mga0sz30_104438_c1 3300050516 Bacteria 1239
241 Ga0495601_0056102 3300053077 Bacteria 2495
242 Ga0495612_0019277 3300053078 Bacteria 2733
243 Ga0495595_0022493 3300053084 Bacteria 2767
244 Ga0500578_0463214 3300053086 Bacteria 719
245 Ga0500651_0265082 3300053093 Bacteria 995
246 Ga0500597_003260 3300053120 Bacteria 4747
247 Ga0500614_001097 3300053123 Bacteria 6685
248 Ga0500568_0071571 3300053139 Bacteria 1327
249 Ga0500568_0118481 3300053139 Bacteria 987
250 Ga0500603_085458 3300053150 Bacteria 920
251 Ga0500645_000046 3300053730 Bacteria 106127
252 Ga0466962_0166121 3300061719 Bacteria 1074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1177130 Ga0451807_1177130_170_577 131
2 3300010159 Ga0099796_10210166 Ga0099796_102101662 132
3 3300035115 Ga0373941_0127341 Ga0373941_0127341_224_631 132
4 3300035121 Ga0373960_0374913 Ga0373960_0374913_38_445 132
5 3300035242 Ga0373962_0242828 Ga0373962_0242828_17_424 132
6 3300035691 Ga0373931_0005298 Ga0373931_0005298_1304_1711 132
7 3300039450 Ga0436363_0217461 Ga0436363_0217461_32_430 132
8 3300048909 Ga0496106_1293422 Ga0496106_1293422_135_545 132
9 iso_pu_bacteria 2842909656 2842914736 132
10 3300014497 Ga0182008_10000517 Ga0182008_1000051728 134
11 3300015262 Ga0182007_10004522 Ga0182007_100045226 134
12 3300031730 Ga0307516_10000862 Ga0307516_1000086225 136
13 3300031731 Ga0307405_10000044 Ga0307405_1000004444 136
14 3300031903 Ga0307407_10000007 Ga0307407_10000007170 136
15 3300031995 Ga0307409_100080452 Ga0307409_1000804521 136
16 3300032002 Ga0307416_100000015 Ga0307416_10000001516 136
17 3300032004 Ga0307414_10015081 Ga0307414_100150812 136
18 3300048908 Ga0496105_0159329 Ga0496105_0159329_1062_1520 136
19 3300048917 Ga0496114_0054718 Ga0496114_0054718_316_774 136
20 3300003320 rootH2_10123891 rootH2_101238912 137
21 3300044901 Ga0466960_0186346 Ga0466960_0186346_62_475 137
22 3300045976 Ga0466967_0738668 Ga0466967_0738668_472_930 137
23 3300049571 Ga0501034_0759307 Ga0501034_0759307_439_852 137
24 3300053086 Ga0500578_0463214 Ga0500578_0463214_178_591 137
25 3300053139 Ga0500568_0071571 Ga0500568_0071571_362_775 137
26 3300053139 Ga0500568_0118481 Ga0500568_0118481_347_760 137
27 3300010375 Ga0105239_10675135 Ga0105239_106751352 138
28 3300035090 Ga0373949_0215664 Ga0373949_0215664_52_477 139
29 3300039450 Ga0436363_0457184 Ga0436363_0457184_53_511 139
30 3300005439 Ga0070711_100030022 Ga0070711_1000300222 145
31 3300006175 Ga0070712_100000801 Ga0070712_10000080117 145
32 3300025906 Ga0207699_10454748 Ga0207699_104547481 145
33 3300025915 Ga0207693_10001195 Ga0207693_100011958 145
34 3300025916 Ga0207663_10050771 Ga0207663_100507712 145
35 3300035120 Ga0373957_0330720 Ga0373957_0330720_167_625 145
36 3300035172 Ga0373955_0178804 Ga0373955_0178804_153_611 145
37 3300035410 Ga0373924_0042999 Ga0373924_0042999_1000_1458 145
38 3300035724 Ga0373933_0157227 Ga0373933_0157227_691_1149 145
39 3300036401 Ga0373937_0050612 Ga0373937_0050612_3233_3691 145
40 3300046454 Ga0495592_0037998 Ga0495592_0037998_2710_3168 145
41 3300046462 Ga0495651_0020739 Ga0495651_0020739_525_983 145
42 3300046463 Ga0495653_0031638 Ga0495653_0031638_670_1128 145
43 3300046477 Ga0495664_0306741 Ga0495664_0306741_383_841 145
44 3300046511 Ga0495608_0039759 Ga0495608_0039759_2023_2481 145
45 3300046514 Ga0495618_0147008 Ga0495618_0147008_328_786 145
46 3300046516 Ga0495628_0125899 Ga0495628_0125899_922_1380 145
47 3300046517 Ga0495630_0276527 Ga0495630_0276527_485_943 145
48 3300046529 Ga0495652_0148873 Ga0495652_0148873_607_1065 145
49 3300046531 Ga0495665_0173541 Ga0495665_0173541_538_996 145
50 3300046533 Ga0495640_0103726 Ga0495640_0103726_522_980 145
51 3300046536 Ga0495587_0029187 Ga0495587_0029187_406_864 145
52 3300046543 Ga0495645_0064485 Ga0495645_0064485_406_864 145
53 3300046559 Ga0495667_0066242 Ga0495667_0066242_186_644 145
54 3300046663 Ga0495635_0023292 Ga0495635_0023292_3078_3536 145
55 3300046675 Ga0495657_0058960 Ga0495657_0058960_274_732 145
56 3300046678 Ga0495599_0016356 Ga0495599_0016356_1148_1606 145
57 3300046679 Ga0495623_0100647 Ga0495623_0100647_840_1298 145
58 3300046680 Ga0495646_0014262 Ga0495646_0014262_928_1386 145
59 3300046689 Ga0495613_0133248 Ga0495613_0133248_178_636 145
60 3300046809 Ga0495600_0119097 Ga0495600_0119097_204_662 145
61 3300047315 Ga0495581_0347681 Ga0495581_0347681_185_643 145
62 3300047317 Ga0495604_0028657 Ga0495604_0028657_3190_3648 145
63 3300047319 Ga0495674_0110956 Ga0495674_0110956_312_770 145
64 3300047322 Ga0495680_0007284 Ga0495680_0007284_7610_8068 145
65 3300047444 Ga0495675_0056912 Ga0495675_0056912_903_1361 145
66 3300047471 Ga0495684_0022779 Ga0495684_0022779_3113_3571 145
67 3300047673 Ga0495593_0174136 Ga0495593_0174136_137_595 145
68 3300048088 Ga0495602_0075967 Ga0495602_0075967_1747_2205 145
69 3300048907 Ga0496104_0149145 Ga0496104_0149145_967_1425 145
70 3300048912 Ga0496109_0295666 Ga0496109_0295666_156_614 145
71 3300053077 Ga0495601_0056102 Ga0495601_0056102_683_1141 145
72 3300053078 Ga0495612_0019277 Ga0495612_0019277_1594_2052 145
73 3300053084 Ga0495595_0022493 Ga0495595_0022493_604_1062 145
74 3300030744 Ga0316181_1122073 Ga0316181_11220732 146
75 3300041404 Ga0439436_0007321 Ga0439436_0007321_765_1205 146
76 3300041406 Ga0439439_0002600 Ga0439439_0002600_1269_1709 146
77 3300041999 Ga0439433_0020722 Ga0439433_0020722_847_1287 146
78 3300042007 Ga0439449_0005577 Ga0439449_0005577_2304_2744 146
79 3300042014 Ga0439457_004004 Ga0439457_004004_3311_3751 146
80 3300053093 Ga0500651_0265082 Ga0500651_0265082_321_785 147
81 3300053120 Ga0500597_003260 Ga0500597_003260_858_1322 147
82 3300053123 Ga0500614_001097 Ga0500614_001097_4320_4784 147
83 3300053150 Ga0500603_085458 Ga0500603_085458_321_785 147
84 iso_pu_bacteria 2870782633 2870785298 147
85 iso_pu_bacteria 2912723979 2912728197 147
86 iso_pu_bacteria 8056207758 8056207890 147
87 iso_pu_bacteria 2675903059 2676483935 148
88 iso_pu_bacteria 2867475112 2867476841 148
89 3300031730 Ga0307516_10013126 Ga0307516_100131264 149
90 3300033180 Ga0307510_10344331 Ga0307510_103443311 149
91 iso_pu_bacteria 2554235005 2554258395 149
92 iso_pu_bacteria 2599185299 2599928963 149
93 iso_pu_bacteria 2648501693 2650899554 149
94 iso_pu_bacteria 2671180531 2673166572 149
95 iso_pu_bacteria 2684622997 2686355450 149
96 iso_pu_bacteria 2775506925 2776371860 149
97 iso_pu_bacteria 2863067949 2863074857 149
98 iso_pu_bacteria 2984494565 2984494909 149
99 iso_pu_bacteria 2990261002 2990264605 149
100 iso_pu_bacteria 3006493962 3006494144 149
101 3300026078 Ga0207702_10690055 Ga0207702_106900551 150
102 3300045836 Ga0466958_0108927 Ga0466958_0108927_73_525 150
103 3300049588 Ga0501072_1113205 Ga0501072_1113205_50_502 150
104 iso_pu_bacteria 2738543028 2739330608 150
105 3300005458 Ga0070681_10071743 Ga0070681_100717435 151
106 3300009545 Ga0105237_11694294 Ga0105237_116942941 151
107 3300009553 Ga0105249_13226803 Ga0105249_132268031 151
108 3300013102 Ga0157371_11117647 Ga0157371_111176471 151
109 3300025912 Ga0207707_10247823 Ga0207707_102478232 151
110 3300005467 Ga0070706_100017128 Ga0070706_1000171281 152
111 3300013105 Ga0157369_10012207 Ga0157369_100122079 152
112 3300021384 Ga0213876_10041431 Ga0213876_100414312 152
113 3300025910 Ga0207684_10040682 Ga0207684_100406824 152
114 3300025928 Ga0207700_10222568 Ga0207700_102225682 152
115 3300028023 Ga0265357_1017417 Ga0265357_10174172 152
116 3300031507 Ga0307509_10009368 Ga0307509_1000936812 152
117 3300031649 Ga0307514_10008253 Ga0307514_100082535 152
118 3300031730 Ga0307516_10046117 Ga0307516_100461173 152
119 3300033180 Ga0307510_10197491 Ga0307510_101974912 152
120 3300038443 Ga0395901_0338434 Ga0395901_0338434_466_924 152
121 3300039437 Ga0436365_1820273 Ga0436365_1820273_5931_6389 152
122 3300039453 Ga0436362_0293949 Ga0436362_0293949_178_645 152
123 3300039453 Ga0436362_0972732 Ga0436362_0972732_863_1321 152
124 3300044683 Ga0466965_0360891 Ga0466965_0360891_245_703 152
125 3300044842 Ga0466957_0579034 Ga0466957_0579034_289_747 152
126 3300045049 Ga0466959_0906379 Ga0466959_0906379_72_530 152
127 3300045836 Ga0466958_0008956 Ga0466958_0008956_1843_2301 152
128 3300045836 Ga0466958_0745707 Ga0466958_0745707_113_571 152
129 3300047321 Ga0495676_0708334 Ga0495676_0708334_53_511 152
130 3300048918 Ga0496115_0201187 Ga0496115_0201187_481_939 152
131 3300005329 Ga0070683_101173174 Ga0070683_1011731741 153
132 3300005339 Ga0070660_100150687 Ga0070660_1001506872 153
133 3300005435 Ga0070714_100162757 Ga0070714_1001627572 153
134 3300005530 Ga0070679_100640548 Ga0070679_1006405482 153
135 3300005536 Ga0070697_100924520 Ga0070697_1009245202 153
136 3300005547 Ga0070693_100124100 Ga0070693_1001241003 153
137 3300005563 Ga0068855_100937997 Ga0068855_1009379972 153
138 3300005564 Ga0070664_100389036 Ga0070664_1003890362 153
139 3300005577 Ga0068857_100556913 Ga0068857_1005569131 153
140 3300005937 Ga0081455_10013436 Ga0081455_100134367 153
141 3300009093 Ga0105240_10435768 Ga0105240_104357682 153
142 3300009545 Ga0105237_10005369 Ga0105237_100053697 153
143 3300009545 Ga0105237_10411260 Ga0105237_104112602 153
144 3300009551 Ga0105238_11889098 Ga0105238_118890981 153
145 3300010375 Ga0105239_11402995 Ga0105239_114029951 153
146 3300013104 Ga0157370_10526088 Ga0157370_105260881 153
147 3300013105 Ga0157369_10181765 Ga0157369_101817651 153
148 3300013296 Ga0157374_10545526 Ga0157374_105455262 153
149 3300013307 Ga0157372_10136711 Ga0157372_101367112 153
150 3300020069 Ga0197907_11471987 Ga0197907_114719871 153
151 3300020080 Ga0206350_10763921 Ga0206350_107639211 153
152 3300022467 Ga0224712_10462327 Ga0224712_104623271 153
153 3300025900 Ga0207710_10000214 Ga0207710_100002147 153
154 3300025912 Ga0207707_10059993 Ga0207707_100599932 153
155 3300025912 Ga0207707_10902561 Ga0207707_109025612 153
156 3300025914 Ga0207671_10240562 Ga0207671_102405621 153
157 3300025921 Ga0207652_10416079 Ga0207652_104160792 153
158 3300025929 Ga0207664_10421778 Ga0207664_104217782 153
159 3300025929 Ga0207664_11634654 Ga0207664_116346541 153
160 3300025944 Ga0207661_10237540 Ga0207661_102375402 153
161 3300025949 Ga0207667_10984554 Ga0207667_109845541 153
162 3300026041 Ga0207639_10247617 Ga0207639_102476171 153
163 3300026078 Ga0207702_10810414 Ga0207702_108104142 153
164 3300031456 Ga0307513_10507892 Ga0307513_105078921 153
165 3300031824 Ga0307413_10789483 Ga0307413_107894832 153
166 3300031838 Ga0307518_10131224 Ga0307518_101312242 153
167 3300031852 Ga0307410_10597296 Ga0307410_105972962 153
168 3300031901 Ga0307406_10019546 Ga0307406_100195462 153
169 3300032002 Ga0307416_101071131 Ga0307416_1010711312 153
170 3300032126 Ga0307415_100596490 Ga0307415_1005964902 153
171 3300034820 Ga0373959_0156917 Ga0373959_0156917_32_493 153
172 3300035114 Ga0373939_0047008 Ga0373939_0047008_211_672 153
173 3300035691 Ga0373931_0558590 Ga0373931_0558590_96_557 153
174 3300042007 Ga0439449_0003550 Ga0439449_0003550_5013_5474 153
175 3300044656 Ga0466969_0040342 Ga0466969_0040342_1623_2084 153
176 3300044693 Ga0466961_0022802 Ga0466961_0022802_1667_2128 153
177 3300044693 Ga0466961_0755277 Ga0466961_0755277_44_505 153
178 3300044694 Ga0466963_0189788 Ga0466963_0189788_603_1064 153
179 3300044694 Ga0466963_0198147 Ga0466963_0198147_417_878 153
180 3300044706 Ga0466964_0030837 Ga0466964_0030837_1612_2073 153
181 3300044735 Ga0466968_0008451 Ga0466968_0008451_750_1211 153
182 3300044901 Ga0466960_0336946 Ga0466960_0336946_233_700 153
183 3300045049 Ga0466959_0049430 Ga0466959_0049430_1313_1774 153
184 3300045836 Ga0466958_0014463 Ga0466958_0014463_1446_1907 153
185 3300045976 Ga0466967_0027335 Ga0466967_0027335_987_1448 153
186 3300045976 Ga0466967_0028499 Ga0466967_0028499_4112_4573 153
187 3300045976 Ga0466967_0526993 Ga0466967_0526993_364_825 153
188 3300045976 Ga0466967_0641372 Ga0466967_0641372_561_1028 153
189 3300046663 Ga0495635_0002714 Ga0495635_0002714_5062_5523 153
190 3300048911 Ga0496108_0143735 Ga0496108_0143735_621_1091 153
191 3300048915 Ga0496112_1518807 Ga0496112_1518807_82_543 153
192 3300048929 Ga0496126_0081365 Ga0496126_0081365_1019_1480 153
193 3300049574 Ga0501038_0167128 Ga0501038_0167128_70_531 153
194 3300049580 Ga0501046_0189230 Ga0501046_0189230_267_728 153
195 3300049581 Ga0501047_0235678 Ga0501047_0235678_554_1015 153
196 3300049585 Ga0501069_0048402 Ga0501069_0048402_957_1418 153
197 3300049742 Ga0501080_0000008 Ga0501080_0000008_6729_7190 153
198 3300050516 nmdc:mga0sz30_104438_c1 nmdc:mga0sz30_104438_c1_81_542 153
199 3300053730 Ga0500645_000046 Ga0500645_000046_64044_64505 153
200 3300061719 Ga0466962_0166121 Ga0466962_0166121_268_729 153
201 3300002244 JGI24742J22300_10099401 JGI24742J22300_100994011 154
202 3300049585 Ga0501069_0149042 Ga0501069_0149042_593_1084 154
203 3300001991 JGI24743J22301_10037417 JGI24743J22301_100374171 155
204 3300005334 Ga0068869_100362762 Ga0068869_1003627621 155
205 3300005340 Ga0070689_100171195 Ga0070689_1001711951 155
206 3300005343 Ga0070687_100101483 Ga0070687_1001014831 155
207 3300005365 Ga0070688_100464411 Ga0070688_1004644111 155
208 3300005366 Ga0070659_100216317 Ga0070659_1002163173 155
209 3300005435 Ga0070714_100543362 Ga0070714_1005433621 155
210 3300005455 Ga0070663_100560865 Ga0070663_1005608652 155
211 3300005459 Ga0068867_100451430 Ga0068867_1004514302 155
212 3300005466 Ga0070685_10038634 Ga0070685_100386342 155
213 3300005564 Ga0070664_100263297 Ga0070664_1002632972 155
214 3300005578 Ga0068854_100205494 Ga0068854_1002054942 155
215 3300005615 Ga0070702_100053071 Ga0070702_1000530712 155
216 3300005617 Ga0068859_100283820 Ga0068859_1002838202 155
217 3300005618 Ga0068864_100180540 Ga0068864_1001805402 155
218 3300005718 Ga0068866_10079227 Ga0068866_100792272 155
219 3300005834 Ga0068851_10212101 Ga0068851_102121012 155
220 3300005842 Ga0068858_101577908 Ga0068858_1015779081 155
221 3300006175 Ga0070712_100060266 Ga0070712_1000602665 155
222 3300006852 Ga0075433_10120858 Ga0075433_101208582 155
223 3300006871 Ga0075434_100760715 Ga0075434_1007607152 155
224 3300006931 Ga0097620_100283816 Ga0097620_1002838162 155
225 3300009098 Ga0105245_10988775 Ga0105245_109887752 155
226 3300009148 Ga0105243_11470422 Ga0105243_114704222 155
227 3300009551 Ga0105238_10371994 Ga0105238_103719942 155
228 3300009553 Ga0105249_10076760 Ga0105249_100767602 155
229 3300012481 Ga0157320_1017743 Ga0157320_10177432 155
230 3300013100 Ga0157373_10374257 Ga0157373_103742572 155
231 3300013296 Ga0157374_10311347 Ga0157374_103113472 155
232 3300013308 Ga0157375_10408017 Ga0157375_104080172 155
233 3300014325 Ga0163163_10167667 Ga0163163_101676673 155
234 3300014968 Ga0157379_10646443 Ga0157379_106464431 155
235 3300025899 Ga0207642_10215827 Ga0207642_102158272 155
236 3300025900 Ga0207710_10051708 Ga0207710_100517082 155
237 3300025901 Ga0207688_10643751 Ga0207688_106437511 155
238 3300025918 Ga0207662_10096060 Ga0207662_100960602 155
239 3300025919 Ga0207657_10264830 Ga0207657_102648302 155
240 3300025927 Ga0207687_10200964 Ga0207687_102009642 155
241 3300025935 Ga0207709_10301976 Ga0207709_103019761 155
242 3300025936 Ga0207670_10189000 Ga0207670_101890002 155
243 3300025939 Ga0207665_10499850 Ga0207665_104998501 155
244 3300025945 Ga0207679_10739681 Ga0207679_107396811 155
245 3300025961 Ga0207712_11127315 Ga0207712_111273152 155
246 3300025981 Ga0207640_10443749 Ga0207640_104437491 155
247 3300026023 Ga0207677_10149037 Ga0207677_101490374 155
248 3300026035 Ga0207703_10774188 Ga0207703_107741882 155
249 3300026089 Ga0207648_10039916 Ga0207648_100399165 155
250 3300026095 Ga0207676_10195083 Ga0207676_101950832 155
251 3300026118 Ga0207675_100054201 Ga0207675_1000542014 155
252 3300026121 Ga0207683_10054966 Ga0207683_100549664 155
253 3300027907 Ga0207428_10375371 Ga0207428_103753712 155
254 3300028380 Ga0268265_10659866 Ga0268265_106598661 155
255 3300028381 Ga0268264_10501177 Ga0268264_105011772 155
256 3300048904 Ga0496101_0103448 Ga0496101_0103448_981_1448 155
257 3300048905 Ga0496102_0114223 Ga0496102_0114223_1779_2246 155
258 3300048906 Ga0496103_0125162 Ga0496103_0125162_283_750 155
259 3300048908 Ga0496105_0047309 Ga0496105_0047309_1504_1971 155
260 3300048910 Ga0496107_0417819 Ga0496107_0417819_284_751 155
261 3300048912 Ga0496109_0033520 Ga0496109_0033520_4066_4533 155
262 3300048912 Ga0496109_0803574 Ga0496109_0803574_294_761 155
263 3300048913 Ga0496110_0549600 Ga0496110_0549600_117_584 155
264 3300048914 Ga0496111_0030673 Ga0496111_0030673_709_1176 155
265 3300048915 Ga0496112_0050037 Ga0496112_0050037_2951_3418 155
266 3300048917 Ga0496114_0110164 Ga0496114_0110164_220_687 155
267 3300048918 Ga0496115_0049919 Ga0496115_0049919_1153_1620 155
268 3300050512 nmdc:mga0n895_407793_c1 nmdc:mga0n895_407793_c1_373_840 155
269 3300050515 nmdc:mga0a205_430729_c1 nmdc:mga0a205_430729_c1_290_757 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

43

173

0.99

PF12680

SnoaL_2

SnoaL-like domain

54

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9661 4 150
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9227 4 150
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8819 17 128
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.8639 12 125
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.8495 15 128
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9484 13 150 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9285 13 150 3.10.450.50
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8563 40 128 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8425 39 128 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8405 36 128 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2R5GW03-F1-model_v4 Uncharacterized protein 1.002 5 137
AF-A0A7Y7B283-F1-model_v4 Nuclear transport factor 2 family protein 1.002 12 139
AF-A0A519YSE8-F1-model_v4 Nuclear transport factor 2 family protein 1.002 21 139
AF-A0A1N6DYQ3-F1-model_v4 DUF4440 domain-containing protein 1.001 5 140
AF-A0A1H4QTG3-F1-model_v4 SnoaL-like domain-containing protein 1.001 5 139

Feature Viewer

pLDDT pTM Quality
93.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map