F376100

General Info

Members Datasets Scaffolds Average Seq Length
269 175 538 247

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100718254|Ga0068858_1007182541
Length 271
Sequence MPAPEAGAPDDLHGGFPPXXVPKAALVTGGARRIGRALVLALAEDGYAVAVHHHASRPDAEALVADIERAGGRAVALSADLADEQAVKGLLPQAVAALGPVGVLVNNASIFENDTVATVTRDSWDAHLAVNLRAPFVLIQEFAARLPPDSGGVVINLLDERVWNLTPYFLSYTLSKSALWTLTQSTALGLAPRIRVNGIGPGPTLPSPRQSPEQFARQCRMMPLQRGTSPAEIAAALRFILSAPAMTGQMIALDGGQHLGWAQPGQIPQVE

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
174 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
175 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 2.6
Rhizosphere 90.33
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100718254 3300005842 Bacteria 973
2 JGI25159J45721_1008648 3300002987 Bacteria 2774
3 JGI25151J46595_10000290 3300003187 Bacteria 56749
4 JGI25160J50197_1004214 3300003354 Bacteria 6249
5 Ga0070670_100851332 3300005331 Bacteria 825
6 Ga0070680_100015386 3300005336 Bacteria 5996
7 Ga0070682_100005946 3300005337 Bacteria 6829
8 Ga0068868_100216766 3300005338 Bacteria 1601
9 Ga0070660_100229914 3300005339 Bacteria 1509
10 Ga0070691_10064327 3300005341 Bacteria 1770
11 Ga0070668_100034566 3300005347 Bacteria 3852
12 Ga0070659_100007782 3300005366 Bacteria 7793
13 Ga0070709_10005519 3300005434 Bacteria 6849
14 Ga0070714_100004955 3300005435 Bacteria 10121
15 Ga0070714_100185298 3300005435 Bacteria 1896
16 Ga0070714_100285523 3300005435 Bacteria 1534
17 Ga0070714_100309153 3300005435 Bacteria 1475
18 Ga0070713_100069532 3300005436 Bacteria 2969
19 Ga0070713_100131995 3300005436 Bacteria 2203
20 Ga0070713_100157569 3300005436 Bacteria 2025
21 Ga0070710_10000601 3300005437 Bacteria 17146
22 Ga0070711_100000791 3300005439 Bacteria 16534
23 Ga0070711_100024589 3300005439 Bacteria 3931
24 Ga0070711_100055814 3300005439 Bacteria 2730
25 Ga0070705_100014954 3300005440 Bacteria 4003
26 Ga0070700_100287656 3300005441 Bacteria 1194
27 Ga0070694_100042667 3300005444 Bacteria 3031
28 Ga0070663_100001710 3300005455 Bacteria 12186
29 Ga0070678_100118476 3300005456 Bacteria 2084
30 Ga0070662_100272801 3300005457 Bacteria 1366
31 Ga0070681_10002483 3300005458 Bacteria 16886
32 Ga0070681_10013038 3300005458 Bacteria 8254
33 Ga0070681_10160354 3300005458 Bacteria 2173
34 Ga0070706_100052118 3300005467 Bacteria 3777
35 Ga0070706_100412057 3300005467 Bacteria 1258
36 Ga0070707_100007401 3300005468 Bacteria 10195
37 Ga0070698_100002604 3300005471 Bacteria 19881
38 Ga0070698_100147324 3300005471 Bacteria 2303
39 Ga0070698_100289593 3300005471 Bacteria 1569
40 Ga0070699_100029256 3300005518 Bacteria 4749
41 Ga0070699_100185592 3300005518 Bacteria 1847
42 Ga0070679_100012334 3300005530 Bacteria 8162
43 Ga0070679_100013459 3300005530 Bacteria 7833
44 Ga0070684_100201921 3300005535 Bacteria 1811
45 Ga0070697_100087963 3300005536 Bacteria 2565
46 Ga0070697_100109725 3300005536 Bacteria 2298
47 Ga0068853_100021815 3300005539 Bacteria 5342
48 Ga0070695_100006171 3300005545 Bacteria 7083
49 Ga0070695_100050978 3300005545 Bacteria 2654
50 Ga0070696_100036056 3300005546 Bacteria 3408
51 Ga0070665_100293955 3300005548 Bacteria 1627
52 Ga0070665_100600105 3300005548 Bacteria 1114
53 Ga0068855_100037468 3300005563 Bacteria 5765
54 Ga0070664_100168300 3300005564 Bacteria 1943
55 Ga0068854_100519578 3300005578 Bacteria 1005
56 Ga0068856_100029512 3300005614 Bacteria 5357
57 Ga0070702_100064956 3300005615 Bacteria 2136
58 Ga0068861_100194351 3300005719 Bacteria 1699
59 Ga0068860_100061700 3300005843 Bacteria 3562
60 Ga0081540_1038030 3300005983 Bacteria 2542
61 Ga0070717_10000230 3300006028 Bacteria 38578
62 Ga0070717_10008007 3300006028 Bacteria 7874
63 Ga0070717_10111823 3300006028 Bacteria 2331
64 Ga0070716_100172619 3300006173 Bacteria 1412
65 Ga0070712_100001947 3300006175 Bacteria 12657
66 Ga0070712_100246968 3300006175 Bacteria 1424
67 Ga0075435_100238358 3300007076 Bacteria 1546
68 Ga0105245_10412789 3300009098 Bacteria 1352
69 Ga0105243_10005920 3300009148 Bacteria 9472
70 Ga0105241_10006259 3300009174 Bacteria 8775
71 Ga0105238_10013850 3300009551 Bacteria 8152
72 Ga0105239_10023741 3300010375 Bacteria 6752
73 Ga0105246_10004253 3300011119 Bacteria 8706
74 Ga0157370_10018088 3300013104 Bacteria 7095
75 Ga0157369_10540329 3300013105 Bacteria 1205
76 Ga0157369_10619198 3300013105 Bacteria 1117
77 Ga0157378_10144223 3300013297 Bacteria 2214
78 Ga0157379_10044682 3300014968 Bacteria 3955
79 Ga0157379_10100690 3300014968 Bacteria 2594
80 Ga0213872_10000606 3300021361 Bacteria 27189
81 Ga0213872_10004997 3300021361 Bacteria 6890
82 Ga0213872_10007283 3300021361 Bacteria 5462
83 Ga0213872_10009639 3300021361 Bacteria 4623
84 Ga0213872_10016819 3300021361 Bacteria 3389
85 Ga0213872_10021556 3300021361 Bacteria 2967
86 Ga0213872_10040687 3300021361 Bacteria 2122
87 Ga0213872_10079835 3300021361 Bacteria 1470
88 Ga0213876_10026707 3300021384 Bacteria 3045
89 Ga0213875_10000145 3300021388 Bacteria 75194
90 Ga0213875_10007933 3300021388 Bacteria 5458
91 Ga0213875_10011053 3300021388 Bacteria 4505
92 Ga0228598_1006456 3300024227 Bacteria 2428
93 Ga0209130_1001424 3300025284 Bacteria 15911
94 Ga0209025_1000212 3300025294 Bacteria 139086
95 Ga0209758_1005134 3300025297 Bacteria 10337
96 Ga0207426_1000102 3300025302 Bacteria 255303
97 Ga0207692_10059782 3300025898 Bacteria 1969
98 Ga0207647_10058681 3300025904 Bacteria 2356
99 Ga0207699_10001605 3300025906 Bacteria 10738
100 Ga0207684_10123230 3300025910 Bacteria 2223
101 Ga0207654_10229335 3300025911 Bacteria 1236
102 Ga0207707_10021403 3300025912 Bacteria 5653
103 Ga0207707_10041710 3300025912 Bacteria 4007
104 Ga0207707_10459078 3300025912 Bacteria 1089
105 Ga0207693_10000460 3300025915 Bacteria 37218
106 Ga0207693_10057638 3300025915 Bacteria 3044
107 Ga0207693_10070123 3300025915 Bacteria 2743
108 Ga0207693_10313527 3300025915 Bacteria 1228
109 Ga0207663_10013565 3300025916 Bacteria 4432
110 Ga0207660_10035294 3300025917 Bacteria 3471
111 Ga0207657_10023037 3300025919 Bacteria 5809
112 Ga0207649_10180306 3300025920 Bacteria 1478
113 Ga0207652_10005712 3300025921 Bacteria 10099
114 Ga0207652_10207827 3300025921 Bacteria 1762
115 Ga0207646_10190858 3300025922 Bacteria 1850
116 Ga0207694_10268114 3300025924 Bacteria 1400
117 Ga0207700_10002530 3300025928 Bacteria 10490
118 Ga0207700_10083558 3300025928 Bacteria 2500
119 Ga0207700_10317066 3300025928 Bacteria 1350
120 Ga0207664_10007945 3300025929 Bacteria 7375
121 Ga0207664_10216185 3300025929 Unclassified 1660
122 Ga0207690_10065163 3300025932 Bacteria 2490
123 Ga0207665_10021497 3300025939 Bacteria 4243
124 Ga0207665_10133316 3300025939 Bacteria 1765
125 Ga0207667_10178716 3300025949 Bacteria 2180
126 Ga0207668_10220965 3300025972 Bacteria 1521
127 Ga0207640_10358701 3300025981 Bacteria 1174
128 Ga0207658_10032844 3300025986 Bacteria 3698
129 Ga0207658_10246297 3300025986 Bacteria 1517
130 Ga0207677_10367519 3300026023 Bacteria 1210
131 Ga0207703_10245530 3300026035 Bacteria 1611
132 Ga0207703_10288206 3300026035 Bacteria 1493
133 Ga0207639_10008101 3300026041 Bacteria 7185
134 Ga0207678_10000132 3300026067 Bacteria 62810
135 Ga0207708_10319813 3300026075 Bacteria 1266
136 Ga0207702_10065971 3300026078 Bacteria 3101
137 Ga0207702_10453269 3300026078 Bacteria 1245
138 Ga0268266_10545199 3300028379 Bacteria 1111
139 Ga0268266_10736469 3300028379 Bacteria 951
140 Ga0265329_10040410 3300031242 Bacteria 1497
141 Ga0265327_10002872 3300031251 Bacteria 17334
142 Ga0265316_10037137 3300031344 Bacteria 3935
143 Ga0265342_10084069 3300031712 Bacteria 1834
144 Ga0373934_0009311 3300035086 Bacteria 3677
145 Ga0373934_0047744 3300035086 Bacteria 1694
146 Ga0373953_0019747 3300035117 Bacteria 2510
147 Ga0373954_0004047 3300035118 Bacteria 6272
148 Ga0373954_0187233 3300035118 Unclassified 1016
149 Ga0373957_0005349 3300035120 Bacteria 3975
150 Ga0373943_0265535 3300035170 Unclassified 967
151 Ga0373955_0001423 3300035172 Bacteria 10181
152 Ga0373924_0071774 3300035410 Bacteria 1461
153 Ga0373931_0181602 3300035691 Bacteria 1246
154 Ga0373931_0236774 3300035691 Bacteria 1105
155 Ga0373933_0001689 3300035724 Bacteria 12836
156 Ga0373933_0074719 3300035724 Bacteria 2068
157 Ga0373933_0092012 3300035724 Bacteria 1873
158 Ga0373947_0042815 3300035725 Bacteria 2703
159 Ga0373947_0127437 3300035725 Bacteria 1622
160 Ga0373937_0012902 3300036401 Bacteria 7359
161 Ga0373937_0027872 3300036401 Bacteria 5110
162 Ga0373937_0097054 3300036401 Bacteria 2733
163 Ga0373937_0188959 3300036401 Bacteria 1935
164 Ga0373925_0100910 3300037068 Bacteria 2219
165 Ga0395898_0073669 3300037466 Bacteria 3299
166 Ga0436364_0056880 3300037853 Bacteria 87492
167 Ga0436364_0062844 3300037853 Bacteria 42162
168 Ga0436364_0414080 3300037853 Bacteria 6313
169 Ga0436364_1493393 3300037853 Bacteria 1197
170 Ga0395901_0010632 3300038443 Bacteria 9326
171 Ga0395901_0273103 3300038443 Bacteria 1758
172 Ga0395901_0434763 3300038443 Bacteria 1344
173 Ga0436365_0934504 3300039437 Bacteria 1235
174 Ga0436365_1428539 3300039437 Bacteria 1132
175 Ga0436360_0119295 3300039438 Bacteria 1806
176 Ga0436360_0254736 3300039438 Bacteria 2363
177 Ga0436360_0770041 3300039438 Bacteria 1041
178 Ga0436360_0840642 3300039438 Bacteria 3764
179 Ga0436360_1071904 3300039438 Bacteria 2061
180 Ga0436361_0049175 3300039447 Bacteria 1590
181 Ga0436361_0075171 3300039447 Bacteria 5289
182 Ga0436361_0242926 3300039447 Bacteria 32751
183 Ga0436361_0248942 3300039447 Bacteria 11981
184 Ga0436361_0287258 3300039447 Bacteria 3406
185 Ga0436361_0461392 3300039447 Bacteria 5831
186 Ga0436361_0681229 3300039447 Bacteria 4374
187 Ga0436361_0705649 3300039447 Bacteria 2318
188 Ga0436361_0719120 3300039447 Bacteria 8324
189 Ga0436361_0963791 3300039447 Bacteria 22825
190 Ga0436363_0064137 3300039450 Bacteria 3572
191 Ga0436362_0142033 3300039453 Bacteria 1718
192 Ga0436362_0401702 3300039453 Bacteria 4353
193 Ga0439431_0004418 3300041997 Bacteria 3092
194 Ga0439458_0009445 3300042157 Bacteria 2171
195 Ga0439459_0013482 3300042438 Bacteria 1472
196 Ga0466966_0015514 3300044684 Bacteria 5036
197 Ga0453684_0144497 3300044712 Bacteria 2836
198 Ga0466957_0005329 3300044842 Bacteria 7216
199 Ga0451576_0000159 3300045051 Bacteria 171363
200 Ga0451576_0388295 3300045051 Bacteria 1463
201 Ga0466958_0000303 3300045836 Bacteria 19346
202 Ga0495580_0366172 3300046472 Unclassified 975
203 Ga0495610_0040783 3300046512 Bacteria 2336
204 Ga0495618_0293467 3300046514 Bacteria 1011
205 Ga0495640_0155018 3300046533 Bacteria 1470
206 Ga0495586_0044296 3300046535 Bacteria 2397
207 Ga0495667_0052906 3300046559 Bacteria 2674
208 Ga0495635_0113495 3300046663 Bacteria 1850
209 Ga0495600_0308954 3300046809 Bacteria 996
210 Ga0495684_0227623 3300047471 Bacteria 1365
211 Ga0495684_0276516 3300047471 Bacteria 1213
212 Ga0496100_0008386 3300048903 Bacteria 5762
213 Ga0496102_0457340 3300048905 Unclassified 1197
214 Ga0496103_0004702 3300048906 Bacteria 8261
215 Ga0496106_0022233 3300048909 Bacteria 4710
216 Ga0496107_0004994 3300048910 Bacteria 9032
217 Ga0496113_0282033 3300048916 Bacteria 1328
218 Ga0496115_0010175 3300048918 Bacteria 7019
219 Ga0501032_0012502 3300049569 Bacteria 6061
220 Ga0501034_0000013 3300049571 Bacteria 297898
221 Ga0501036_0018165 3300049572 Bacteria 5890
222 Ga0501037_0013012 3300049573 Bacteria 6133
223 Ga0501038_0029439 3300049574 Bacteria 4866
224 Ga0501038_0149511 3300049574 Bacteria 1905
225 Ga0501039_0001004 3300049575 Bacteria 20555
226 Ga0501039_0030021 3300049575 Bacteria 4189
227 Ga0501042_0023358 3300049578 Bacteria 4327
228 Ga0501043_0066349 3300049579 Bacteria 2834
229 Ga0501043_0439871 3300049579 Bacteria 981
230 Ga0501046_0066561 3300049580 Bacteria 2807
231 Ga0501046_0431998 3300049580 Bacteria 948
232 Ga0501047_0000212 3300049581 Bacteria 69742
233 Ga0501047_0070542 3300049581 Bacteria 3364
234 Ga0501047_0136022 3300049581 Bacteria 2338
235 Ga0501047_0334384 3300049581 Bacteria 1353
236 Ga0501048_0000953 3300049582 Bacteria 21365
237 Ga0501048_0094808 3300049582 Bacteria 2105
238 Ga0501067_0025732 3300049583 Bacteria 3261
239 Ga0501070_0020729 3300049586 Bacteria 5513
240 Ga0501070_0067191 3300049586 Bacteria 2969
241 Ga0501072_0145842 3300049588 Bacteria 1887
242 Ga0501073_0107849 3300049589 Bacteria 1932
243 Ga0501074_0261605 3300049590 Bacteria 1230
244 Ga0501075_0083497 3300049591 Bacteria 2420
245 Ga0501077_0042053 3300049593 Bacteria 2908
246 Ga0501079_0125813 3300049741 Bacteria 1994
247 Ga0501080_0000003 3300049742 Bacteria 214890
248 Ga0501080_0094159 3300049742 Bacteria 2782
249 Ga0501081_0152213 3300049743 Bacteria 1662
250 Ga0501081_0214330 3300049743 Bacteria 1399
251 Ga0501083_0021391 3300049744 Bacteria 4495
252 Ga0501083_0048070 3300049744 Bacteria 2881
253 Ga0501035_0000149 3300049822 Bacteria 85464
254 Ga0501035_0192161 3300049822 Bacteria 1755
255 Ga0501035_0283527 3300049822 Bacteria 1400
256 Ga0501044_0000392 3300049823 Bacteria 54287
257 Ga0501044_0075955 3300049823 Bacteria 3411
258 Ga0501044_0327642 3300049823 Bacteria 1455
259 nmdc:mga0n895_266633_c1 3300050512 Bacteria 1737
260 Ga0495601_0056640 3300053077 Bacteria 2483
261 Ga0495601_0161716 3300053077 Bacteria 1463
262 Ga0495595_0012030 3300053084 Bacteria 3629
263 Ga0495619_0003815 3300053085 Bacteria 9698
264 Ga0495619_0166033 3300053085 Bacteria 1526
265 Ga0501082_0021705 3300060353 Bacteria 5535
266 Ga0530510_0026311 3300061734 Bacteria 4164
267 2844535716 2844533157 Bacteria 7517899
268 2883292876 2883291878 Bacteria 5894118
269 2883355846 2883354860 Bacteria 5865246
270 Ga0068858_100718254
271 JGI25159J45721_1008648
272 JGI25151J46595_10000290
273 JGI25160J50197_1004214
274 Ga0070670_100851332
275 Ga0070680_100015386
276 Ga0070682_100005946
277 Ga0068868_100216766
278 Ga0070660_100229914
279 Ga0070691_10064327
280 Ga0070668_100034566
281 Ga0070659_100007782
282 Ga0070709_10005519
283 Ga0070714_100004955
284 Ga0070714_100185298
285 Ga0070714_100285523
286 Ga0070714_100309153
287 Ga0070713_100069532
288 Ga0070713_100131995
289 Ga0070713_100157569
290 Ga0070710_10000601
291 Ga0070711_100000791
292 Ga0070711_100024589
293 Ga0070711_100055814
294 Ga0070705_100014954
295 Ga0070700_100287656
296 Ga0070694_100042667
297 Ga0070663_100001710
298 Ga0070678_100118476
299 Ga0070662_100272801
300 Ga0070681_10002483
301 Ga0070681_10013038
302 Ga0070681_10160354
303 Ga0070706_100052118
304 Ga0070706_100412057
305 Ga0070707_100007401
306 Ga0070698_100002604
307 Ga0070698_100147324
308 Ga0070698_100289593
309 Ga0070699_100029256
310 Ga0070699_100185592
311 Ga0070679_100012334
312 Ga0070679_100013459
313 Ga0070684_100201921
314 Ga0070697_100087963
315 Ga0070697_100109725
316 Ga0068853_100021815
317 Ga0070695_100006171
318 Ga0070695_100050978
319 Ga0070696_100036056
320 Ga0070665_100293955
321 Ga0070665_100600105
322 Ga0068855_100037468
323 Ga0070664_100168300
324 Ga0068854_100519578
325 Ga0068856_100029512
326 Ga0070702_100064956
327 Ga0068861_100194351
328 Ga0068860_100061700
329 Ga0081540_1038030
330 Ga0070717_10000230
331 Ga0070717_10008007
332 Ga0070717_10111823
333 Ga0070716_100172619
334 Ga0070712_100001947
335 Ga0070712_100246968
336 Ga0075435_100238358
337 Ga0105245_10412789
338 Ga0105243_10005920
339 Ga0105241_10006259
340 Ga0105238_10013850
341 Ga0105239_10023741
342 Ga0105246_10004253
343 Ga0157370_10018088
344 Ga0157369_10540329
345 Ga0157369_10619198
346 Ga0157378_10144223
347 Ga0157379_10044682
348 Ga0157379_10100690
349 Ga0213872_10000606
350 Ga0213872_10004997
351 Ga0213872_10007283
352 Ga0213872_10009639
353 Ga0213872_10016819
354 Ga0213872_10021556
355 Ga0213872_10040687
356 Ga0213872_10079835
357 Ga0213876_10026707
358 Ga0213875_10000145
359 Ga0213875_10007933
360 Ga0213875_10011053
361 Ga0228598_1006456
362 Ga0209130_1001424
363 Ga0209025_1000212
364 Ga0209758_1005134
365 Ga0207426_1000102
366 Ga0207692_10059782
367 Ga0207647_10058681
368 Ga0207699_10001605
369 Ga0207684_10123230
370 Ga0207654_10229335
371 Ga0207707_10021403
372 Ga0207707_10041710
373 Ga0207707_10459078
374 Ga0207693_10000460
375 Ga0207693_10057638
376 Ga0207693_10070123
377 Ga0207693_10313527
378 Ga0207663_10013565
379 Ga0207660_10035294
380 Ga0207657_10023037
381 Ga0207649_10180306
382 Ga0207652_10005712
383 Ga0207652_10207827
384 Ga0207646_10190858
385 Ga0207694_10268114
386 Ga0207700_10002530
387 Ga0207700_10083558
388 Ga0207700_10317066
389 Ga0207664_10007945
390 Ga0207664_10216185
391 Ga0207690_10065163
392 Ga0207665_10021497
393 Ga0207665_10133316
394 Ga0207667_10178716
395 Ga0207668_10220965
396 Ga0207640_10358701
397 Ga0207658_10032844
398 Ga0207658_10246297
399 Ga0207677_10367519
400 Ga0207703_10245530
401 Ga0207703_10288206
402 Ga0207639_10008101
403 Ga0207678_10000132
404 Ga0207708_10319813
405 Ga0207702_10065971
406 Ga0207702_10453269
407 Ga0268266_10545199
408 Ga0268266_10736469
409 Ga0265329_10040410
410 Ga0265327_10002872
411 Ga0265316_10037137
412 Ga0265342_10084069
413 Ga0373934_0009311
414 Ga0373934_0047744
415 Ga0373953_0019747
416 Ga0373954_0004047
417 Ga0373954_0187233
418 Ga0373957_0005349
419 Ga0373943_0265535
420 Ga0373955_0001423
421 Ga0373924_0071774
422 Ga0373931_0181602
423 Ga0373931_0236774
424 Ga0373933_0001689
425 Ga0373933_0074719
426 Ga0373933_0092012
427 Ga0373947_0042815
428 Ga0373947_0127437
429 Ga0373937_0012902
430 Ga0373937_0027872
431 Ga0373937_0097054
432 Ga0373937_0188959
433 Ga0373925_0100910
434 Ga0395898_0073669
435 Ga0436364_0056880
436 Ga0436364_0062844
437 Ga0436364_0414080
438 Ga0436364_1493393
439 Ga0395901_0010632
440 Ga0395901_0273103
441 Ga0395901_0434763
442 Ga0436365_0934504
443 Ga0436365_1428539
444 Ga0436360_0119295
445 Ga0436360_0254736
446 Ga0436360_0770041
447 Ga0436360_0840642
448 Ga0436360_1071904
449 Ga0436361_0049175
450 Ga0436361_0075171
451 Ga0436361_0242926
452 Ga0436361_0248942
453 Ga0436361_0287258
454 Ga0436361_0461392
455 Ga0436361_0681229
456 Ga0436361_0705649
457 Ga0436361_0719120
458 Ga0436361_0963791
459 Ga0436363_0064137
460 Ga0436362_0142033
461 Ga0436362_0401702
462 Ga0439431_0004418
463 Ga0439458_0009445
464 Ga0439459_0013482
465 Ga0466966_0015514
466 Ga0453684_0144497
467 Ga0466957_0005329
468 Ga0451576_0000159
469 Ga0451576_0388295
470 Ga0466958_0000303
471 Ga0495580_0366172
472 Ga0495610_0040783
473 Ga0495618_0293467
474 Ga0495640_0155018
475 Ga0495586_0044296
476 Ga0495667_0052906
477 Ga0495635_0113495
478 Ga0495600_0308954
479 Ga0495684_0227623
480 Ga0495684_0276516
481 Ga0496100_0008386
482 Ga0496102_0457340
483 Ga0496103_0004702
484 Ga0496106_0022233
485 Ga0496107_0004994
486 Ga0496113_0282033
487 Ga0496115_0010175
488 Ga0501032_0012502
489 Ga0501034_0000013
490 Ga0501036_0018165
491 Ga0501037_0013012
492 Ga0501038_0029439
493 Ga0501038_0149511
494 Ga0501039_0001004
495 Ga0501039_0030021
496 Ga0501042_0023358
497 Ga0501043_0066349
498 Ga0501043_0439871
499 Ga0501046_0066561
500 Ga0501046_0431998
501 Ga0501047_0000212
502 Ga0501047_0070542
503 Ga0501047_0136022
504 Ga0501047_0334384
505 Ga0501048_0000953
506 Ga0501048_0094808
507 Ga0501067_0025732
508 Ga0501070_0020729
509 Ga0501070_0067191
510 Ga0501072_0145842
511 Ga0501073_0107849
512 Ga0501074_0261605
513 Ga0501075_0083497
514 Ga0501077_0042053
515 Ga0501079_0125813
516 Ga0501080_0000003
517 Ga0501080_0094159
518 Ga0501081_0152213
519 Ga0501081_0214330
520 Ga0501083_0021391
521 Ga0501083_0048070
522 Ga0501035_0000149
523 Ga0501035_0192161
524 Ga0501035_0283527
525 Ga0501044_0000392
526 Ga0501044_0075955
527 Ga0501044_0327642
528 nmdc:mga0n895_266633_c1
529 Ga0495601_0056640
530 Ga0495601_0161716
531 Ga0495595_0012030
532 Ga0495619_0003815
533 Ga0495619_0166033
534 Ga0501082_0021705
535 Ga0530510_0026311
536 2844535716
537 2883292876
538 2883355846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

215

0.97

PF08659

KR

KR domain

24

147

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

258

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bt9-assembly3.cif.gz_C crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9708 18 259
5tgd-assembly1.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.9684 18 260
5bt9-assembly5.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9649 18 260
5tgd-assembly1.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.9648 19 260
5bt9-assembly5.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9641 18 260
ID Description Score Start End Superfamily
5bt9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 18 260 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 18 251 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 15 253 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 15 254 3.40.50.720
2c7vC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 15 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2H0QYZ1-F1-model_v4 Short-chain dehydrogenase 0.9797 15 254
AF-A0A7V4E1S1-F1-model_v4 SDR family oxidoreductase 0.9673 17 254
AF-A0A2M8MWT1-F1-model_v4 Short chain dehydrogenase 0.9618 18 259 GO:0016491
AF-A0A2R7NZP1-F1-model_v4 Short chain dehydrogenase 0.9569 20 254
AF-A0A520VU29-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9548 17 254

Map