F376161

General Info

Members Datasets Scaffolds Average Seq Length
269 197 538 128

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001793|Ga0105240_1000179323
Length 150
Sequence MTIMVIFYKCRHARGRMIDIGGFIMFKDSKAYSGFSVDNIEKAKNFYGEVLGLAVSEEHGMLDLHLATGGTVLVYPKENHEPATYTILNFPVDNIDAAADELISKGVSFEIYEGMHQDEKGIARGKAANMGPDIAWFKDPAGNILSILTE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
193 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.74
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 4.46
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10001793 3300009093 Bacteria 36153
2 JGI24743J22301_10008398 3300001991 Bacteria 1811
3 JGI24735J21928_10072936 3300002067 Bacteria 983
4 JGI25162J39368_1003264 3300002737 Bacteria 4940
5 JGI25164J39214_1001531 3300002772 Bacteria 5113
6 JGI25165J46597_1002917 3300003214 Bacteria 4816
7 rootH2_10066540 3300003320 Bacteria 1941
8 rootH1_10010186 3300003323 Bacteria 30481
9 rootH1_10064102 3300003323 Bacteria 13160
10 JGI25405J52794_10007249 3300003911 Bacteria 2042
11 Ga0070658_10000133 3300005327 Bacteria 65613
12 Ga0070658_10037511 3300005327 Bacteria 3907
13 Ga0070676_10237858 3300005328 Bacteria 1210
14 Ga0070670_100000561 3300005331 Bacteria 29475
15 Ga0070670_100983723 3300005331 Bacteria 767
16 Ga0070682_100008304 3300005337 Bacteria 5853
17 Ga0070682_101387910 3300005337 Bacteria 600
18 Ga0068868_100819944 3300005338 Bacteria 841
19 Ga0070660_100002654 3300005339 Bacteria 12286
20 Ga0070689_100038218 3300005340 Bacteria 3672
21 Ga0070689_100214079 3300005340 Bacteria 1578
22 Ga0070661_100030754 3300005344 Bacteria 3880
23 Ga0070692_10009627 3300005345 Bacteria 4366
24 Ga0070668_100354639 3300005347 Bacteria 1242
25 Ga0070668_100453657 3300005347 Bacteria 1103
26 Ga0070669_100003090 3300005353 Bacteria 11985
27 Ga0070675_100013319 3300005354 Bacteria 6462
28 Ga0070674_100054278 3300005356 Bacteria 2771
29 Ga0070673_100163169 3300005364 Bacteria 1896
30 Ga0070673_100171162 3300005364 Bacteria 1854
31 Ga0070659_100000154 3300005366 Bacteria 52564
32 Ga0070659_100012503 3300005366 Bacteria 6294
33 Ga0070667_100046637 3300005367 Bacteria 3646
34 Ga0070701_10087584 3300005438 Bacteria 1699
35 Ga0070700_100315763 3300005441 Bacteria 1146
36 Ga0070694_100139487 3300005444 Bacteria 1759
37 Ga0070708_100236174 3300005445 Bacteria 1716
38 Ga0070708_100990187 3300005445 Bacteria 788
39 Ga0070708_102114825 3300005445 Bacteria 520
40 Ga0070663_100038626 3300005455 Bacteria 3331
41 Ga0070662_100031044 3300005457 Bacteria 3746
42 Ga0070681_11163650 3300005458 Bacteria 693
43 Ga0070685_10021541 3300005466 Bacteria 3504
44 Ga0070685_10125866 3300005466 Bacteria 1596
45 Ga0070706_100020489 3300005467 Bacteria 6094
46 Ga0070706_101690325 3300005467 Bacteria 576
47 Ga0070707_100005771 3300005468 Archaea 11544
48 Ga0070707_102265756 3300005468 Bacteria 511
49 Ga0070698_100253185 3300005471 Unclassified 1693
50 Ga0070698_101191525 3300005471 Bacteria 711
51 Ga0070699_100019573 3300005518 Bacteria 5832
52 Ga0070699_100650776 3300005518 Bacteria 962
53 Ga0070679_100067786 3300005530 Bacteria 3559
54 Ga0070679_100874486 3300005530 Unclassified 842
55 Ga0070684_100007158 3300005535 Bacteria 8669
56 Ga0070684_100260828 3300005535 Bacteria 1585
57 Ga0070684_100485562 3300005535 Bacteria 1144
58 Ga0070684_101021385 3300005535 Bacteria 776
59 Ga0070684_101805894 3300005535 Bacteria 577
60 Ga0070697_100044178 3300005536 Bacteria 3608
61 Ga0070697_100827091 3300005536 Bacteria 820
62 Ga0070697_101108503 3300005536 Bacteria 704
63 Ga0068853_100013645 3300005539 Bacteria 6639
64 Ga0070672_100030751 3300005543 Bacteria 4037
65 Ga0070686_100104363 3300005544 Bacteria 1920
66 Ga0070695_100388029 3300005545 Bacteria 1055
67 Ga0070696_100015186 3300005546 Bacteria 5169
68 Ga0070696_100923496 3300005546 Bacteria 725
69 Ga0070665_100200700 3300005548 Bacteria 1995
70 Ga0070704_100092631 3300005549 Bacteria 2256
71 Ga0068855_100001288 3300005563 Bacteria 31095
72 Ga0070664_100013100 3300005564 Bacteria 6748
73 Ga0068857_100084632 3300005577 Unclassified 2834
74 Ga0068854_100022037 3300005578 Bacteria 4332
75 Ga0068854_101038877 3300005578 Bacteria 727
76 Ga0068856_100590227 3300005614 Unclassified 1132
77 Ga0068856_102075325 3300005614 Unclassified 578
78 Ga0070702_100143011 3300005615 Bacteria 1526
79 Ga0068852_100037693 3300005616 Unclassified 4056
80 Ga0068852_100509982 3300005616 Bacteria 1199
81 Ga0068859_101324275 3300005617 Bacteria 794
82 Ga0068864_100052331 3300005618 Bacteria 3519
83 Ga0068861_100351359 3300005719 Bacteria 1293
84 Ga0068858_100469740 3300005842 Unclassified 1213
85 Ga0068858_101424543 3300005842 Bacteria 683
86 Ga0068860_100097276 3300005843 Bacteria 2806
87 Ga0081455_10007938 3300005937 Bacteria 11106
88 Ga0081455_10483004 3300005937 Bacteria 837
89 Ga0081539_10003435 3300005985 Bacteria 19473
90 Ga0075365_10055598 3300006038 Bacteria 2628
91 Ga0075365_10153378 3300006038 Unclassified 1603
92 Ga0075365_10280207 3300006038 Bacteria 1173
93 Ga0075364_10162367 3300006051 Bacteria 1508
94 Ga0075367_10187605 3300006178 Bacteria 1290
95 Ga0075366_10041806 3300006195 Bacteria 2714
96 Ga0075430_100349991 3300006846 Bacteria 1220
97 Ga0075433_10024772 3300006852 Bacteria 5068
98 Ga0075434_100138285 3300006871 Bacteria 2455
99 Ga0097620_101324120 3300006931 Bacteria 794
100 Ga0075435_100143533 3300007076 Bacteria 2004
101 Ga0099794_10077201 3300007265 Bacteria 1638
102 Ga0099794_10264601 3300007265 Unclassified 888
103 Ga0111539_10707909 3300009094 Bacteria 1172
104 Ga0105245_10017038 3300009098 Bacteria 6343
105 Ga0105245_10961495 3300009098 Bacteria 897
106 Ga0105245_12156295 3300009098 Bacteria 611
107 Ga0114129_10020817 3300009147 Bacteria 9317
108 Ga0114129_10188103 3300009147 Bacteria 2805
109 Ga0114129_11545931 3300009147 Bacteria 814
110 Ga0105243_12554591 3300009148 Bacteria 550
111 Ga0105243_12725532 3300009148 Bacteria 535
112 Ga0105241_10047104 3300009174 Bacteria 3277
113 Ga0105242_11981682 3300009176 Bacteria 624
114 Ga0105242_13032812 3300009176 Unclassified 520
115 Ga0105238_12329179 3300009551 Bacteria 571
116 Ga0105249_10194992 3300009553 Bacteria 1979
117 Ga0105249_10436821 3300009553 Bacteria 1345
118 Ga0105239_10275216 3300010375 Bacteria 1894
119 Ga0105239_11634151 3300010375 Bacteria 745
120 Ga0105246_10492484 3300011119 Bacteria 1039
121 Ga0157373_10008892 3300013100 Bacteria 7433
122 Ga0157369_10000063 3300013105 Bacteria 147327
123 Ga0157369_10573840 3300013105 Bacteria 1165
124 Ga0157369_10940478 3300013105 Bacteria 886
125 Ga0157374_10616003 3300013296 Bacteria 1096
126 Ga0157374_11167915 3300013296 Unclassified 791
127 Ga0157374_12028349 3300013296 Bacteria 602
128 Ga0157378_10124198 3300013297 Bacteria 2383
129 Ga0157378_10455970 3300013297 Bacteria 1270
130 Ga0157378_11336497 3300013297 Bacteria 758
131 Ga0157378_11338223 3300013297 Bacteria 758
132 Ga0157378_11525906 3300013297 Bacteria 713
133 Ga0163162_10164782 3300013306 Bacteria 2340
134 Ga0157372_10098117 3300013307 Bacteria 3342
135 Ga0157375_10264878 3300013308 Bacteria 1880
136 Ga0163163_10436095 3300014325 Bacteria 1369
137 Ga0157380_10228019 3300014326 Bacteria 1671
138 Ga0182008_10228324 3300014497 Bacteria 954
139 Ga0157377_10134515 3300014745 Bacteria 1513
140 Ga0182007_10354646 3300015262 Bacteria 551
141 Ga0163161_11373738 3300017792 Bacteria 616
142 Ga0197907_11251192 3300020069 Bacteria 598
143 Ga0206353_10105443 3300020082 Bacteria 1448
144 Ga0209563_115748 3300025230 Unclassified 943
145 Ga0207427_100076 3300025231 Bacteria 149885
146 Ga0209437_100008 3300025233 Bacteria 921142
147 Ga0209233_1000024 3300025261 Bacteria 695418
148 Ga0207656_10021466 3300025321 Bacteria 2581
149 Ga0207688_10004778 3300025901 Bacteria 7382
150 Ga0207645_10295523 3300025907 Bacteria 1078
151 Ga0207705_10000011 3300025909 Bacteria 517768
152 Ga0207705_11288761 3300025909 Bacteria 558
153 Ga0207684_10000108 3300025910 Bacteria 156641
154 Ga0207695_10002102 3300025913 Bacteria 30254
155 Ga0207657_10002420 3300025919 Bacteria 20165
156 Ga0207657_10385589 3300025919 Bacteria 1103
157 Ga0207652_10320344 3300025921 Bacteria 1400
158 Ga0207646_10000487 3300025922 Bacteria 53200
159 Ga0207646_10008002 3300025922 Archaea 10658
160 Ga0207646_11655597 3300025922 Unclassified 551
161 Ga0207681_10008541 3300025923 Bacteria 6254
162 Ga0207694_10799307 3300025924 Bacteria 797
163 Ga0207650_10000484 3300025925 Bacteria 33197
164 Ga0207650_10702619 3300025925 Bacteria 854
165 Ga0207687_10129608 3300025927 Bacteria 1899
166 Ga0207687_11873551 3300025927 Bacteria 513
167 Ga0207690_10000518 3300025932 Bacteria 25073
168 Ga0207690_10155949 3300025932 Bacteria 1697
169 Ga0207706_10005581 3300025933 Bacteria 11723
170 Ga0207670_10078504 3300025936 Bacteria 2302
171 Ga0207670_10665671 3300025936 Bacteria 859
172 Ga0207669_10122802 3300025937 Bacteria 1767
173 Ga0207704_10105357 3300025938 Bacteria 1891
174 Ga0207691_10015477 3300025940 Bacteria 7252
175 Ga0207661_10032950 3300025944 Bacteria 4019
176 Ga0207661_10260696 3300025944 Unclassified 1544
177 Ga0207679_10035180 3300025945 Bacteria 3541
178 Ga0207667_10170535 3300025949 Unclassified 2237
179 Ga0207667_10445917 3300025949 Bacteria 1316
180 Ga0207712_11982868 3300025961 Bacteria 521
181 Ga0207668_10332571 3300025972 Bacteria 1264
182 Ga0207668_11091304 3300025972 Bacteria 715
183 Ga0207640_10052216 3300025981 Bacteria 2662
184 Ga0207640_10809277 3300025981 Bacteria 812
185 Ga0207658_10108712 3300025986 Bacteria 2188
186 Ga0207677_10511688 3300026023 Bacteria 1040
187 Ga0207703_10420138 3300026035 Unclassified 1244
188 Ga0207639_10018612 3300026041 Bacteria 4939
189 Ga0207678_10055243 3300026067 Bacteria 3420
190 Ga0207708_10003445 3300026075 Bacteria 11656
191 Ga0207702_10287368 3300026078 Unclassified 1557
192 Ga0207641_10011830 3300026088 Bacteria 7161
193 Ga0207676_10165453 3300026095 Bacteria 1921
194 Ga0207674_10190521 3300026116 Bacteria 2000
195 Ga0207675_100095691 3300026118 Bacteria 2795
196 Ga0207698_10054426 3300026142 Bacteria 3079
197 Ga0207698_10085974 3300026142 Unclassified 2556
198 Ga0209588_1060941 3300027671 Bacteria 1219
199 Ga0209998_10024045 3300027717 Bacteria 1320
200 Ga0268264_10406516 3300028381 Bacteria 1309
201 Ga0316182_1064039 3300030745 Bacteria 5802
202 Ga0307513_10502355 3300031456 Bacteria 930
203 Ga0307408_100230659 3300031548 Bacteria 1516
204 Ga0307408_100699053 3300031548 Bacteria 911
205 Ga0307408_100810956 3300031548 Bacteria 850
206 Ga0307413_10109691 3300031824 Bacteria 1845
207 Ga0307410_11242802 3300031852 Bacteria 650
208 Ga0307406_10134505 3300031901 Bacteria 1740
209 Ga0307409_100096642 3300031995 Bacteria 2438
210 Ga0307416_100133199 3300032002 Bacteria 2242
211 Ga0307414_11264733 3300032004 Bacteria 684
212 Ga0307415_100231115 3300032126 Bacteria 1489
213 Ga0307415_100796910 3300032126 Bacteria 862
214 Ga0373930_0040907 3300034816 Bacteria 987
215 Ga0373931_0081761 3300035691 Unclassified 1784
216 Ga0395899_0825129 3300037312 Bacteria 571
217 Ga0395900_0003457 3300037418 Bacteria 17070
218 Ga0395900_0858152 3300037418 Bacteria 833
219 Ga0395898_0044424 3300037466 Bacteria 4373
220 Ga0395898_1143895 3300037466 Bacteria 711
221 Ga0395898_1805796 3300037466 Bacteria 532
222 Ga0395905_0003554 3300037471 Bacteria 16603
223 Ga0395901_0114008 3300038443 Bacteria 2839
224 Ga0451802_0310731 3300041460 Bacteria 1279
225 Ga0450906_030661 3300042145 Bacteria 951
226 Ga0466961_0195310 3300044693 Bacteria 1253
227 Ga0495596_0104238 3300046500 Bacteria 1102
228 Ga0495609_0271657 3300046538 Bacteria 695
229 Ga0495658_0394202 3300046683 Bacteria 882
230 Ga0496100_0424993 3300048903 Bacteria 1015
231 Ga0496101_0082929 3300048904 Bacteria 2373
232 Ga0496102_0975060 3300048905 Bacteria 768
233 Ga0496107_0016039 3300048910 Bacteria 5257
234 Ga0496107_0163008 3300048910 Bacteria 1653
235 Ga0496109_0035981 3300048912 Bacteria 4469
236 Ga0496110_1507819 3300048913 Bacteria 582
237 Ga0496111_0536970 3300048914 Bacteria 859
238 Ga0496111_0562170 3300048914 Bacteria 837
239 Ga0496112_0003198 3300048915 Bacteria 13478
240 Ga0496113_0072506 3300048916 Bacteria 2621
241 nmdc:mga03n38_45494_c1 3300050490 Bacteria 1933
242 nmdc:mga00v17_352689_c1 3300050491 Bacteria 956
243 nmdc:mga0yw44_10219_c1 3300050492 Bacteria 4785
244 nmdc:mga0yw44_134037_c1 3300050492 Unclassified 1605
245 nmdc:mga0yw44_251057_c1 3300050492 Bacteria 1177
246 nmdc:mga0k408_8542_c1 3300050493 Bacteria 2731
247 nmdc:mga06z11_654071_c1 3300050494 Bacteria 640
248 nmdc:mga05p37_132284_c1 3300050507 Bacteria 3061
249 nmdc:mga05p37_19741_c1 3300050507 Bacteria 8153
250 nmdc:mga0qj67_308741_c1 3300050509 Bacteria 1281
251 nmdc:mga06r32_367416_c1 3300050510 Bacteria 1422
252 nmdc:mga0n895_50838_c1 3300050512 Bacteria 4065
253 nmdc:mga08x19_166579_c1 3300050514 Bacteria 1499
254 nmdc:mga0a205_19707_c1 3300050515 Bacteria 3719
255 Ga0500643_000022 3300053087 Bacteria 277519
256 Ga0500646_0001410 3300053090 Bacteria 6378
257 Ga0500583_0017696 3300053092 Bacteria 2879
258 Ga0500650_0000001 3300053098 Bacteria 818797
259 Ga0500562_000009 3300053108 Bacteria 187538
260 Ga0500562_001747 3300053108 Bacteria 5419
261 Ga0500594_0000001 3300053118 Bacteria 1178472
262 Ga0500655_000233 3300053133 Bacteria 13340
263 Ga0500577_0003350 3300053142 Bacteria 4157
264 Ga0500579_000849 3300053143 Bacteria 17560
265 Ga0500620_238013 3300053155 Bacteria 609
266 Ga0500633_0011613 3300053160 Bacteria 2402
267 Ga0501084_1293844 3300054114 Bacteria 611
268 Ga0590075_040187 3300059424 Bacteria 1194
269 2852648492 2852646457 Bacteria 3408613
270 Ga0105240_10001793
271 JGI24743J22301_10008398
272 JGI24735J21928_10072936
273 JGI25162J39368_1003264
274 JGI25164J39214_1001531
275 JGI25165J46597_1002917
276 rootH2_10066540
277 rootH1_10010186
278 rootH1_10064102
279 JGI25405J52794_10007249
280 Ga0070658_10000133
281 Ga0070658_10037511
282 Ga0070676_10237858
283 Ga0070670_100000561
284 Ga0070670_100983723
285 Ga0070682_100008304
286 Ga0070682_101387910
287 Ga0068868_100819944
288 Ga0070660_100002654
289 Ga0070689_100038218
290 Ga0070689_100214079
291 Ga0070661_100030754
292 Ga0070692_10009627
293 Ga0070668_100354639
294 Ga0070668_100453657
295 Ga0070669_100003090
296 Ga0070675_100013319
297 Ga0070674_100054278
298 Ga0070673_100163169
299 Ga0070673_100171162
300 Ga0070659_100000154
301 Ga0070659_100012503
302 Ga0070667_100046637
303 Ga0070701_10087584
304 Ga0070700_100315763
305 Ga0070694_100139487
306 Ga0070708_100236174
307 Ga0070708_100990187
308 Ga0070708_102114825
309 Ga0070663_100038626
310 Ga0070662_100031044
311 Ga0070681_11163650
312 Ga0070685_10021541
313 Ga0070685_10125866
314 Ga0070706_100020489
315 Ga0070706_101690325
316 Ga0070707_100005771
317 Ga0070707_102265756
318 Ga0070698_100253185
319 Ga0070698_101191525
320 Ga0070699_100019573
321 Ga0070699_100650776
322 Ga0070679_100067786
323 Ga0070679_100874486
324 Ga0070684_100007158
325 Ga0070684_100260828
326 Ga0070684_100485562
327 Ga0070684_101021385
328 Ga0070684_101805894
329 Ga0070697_100044178
330 Ga0070697_100827091
331 Ga0070697_101108503
332 Ga0068853_100013645
333 Ga0070672_100030751
334 Ga0070686_100104363
335 Ga0070695_100388029
336 Ga0070696_100015186
337 Ga0070696_100923496
338 Ga0070665_100200700
339 Ga0070704_100092631
340 Ga0068855_100001288
341 Ga0070664_100013100
342 Ga0068857_100084632
343 Ga0068854_100022037
344 Ga0068854_101038877
345 Ga0068856_100590227
346 Ga0068856_102075325
347 Ga0070702_100143011
348 Ga0068852_100037693
349 Ga0068852_100509982
350 Ga0068859_101324275
351 Ga0068864_100052331
352 Ga0068861_100351359
353 Ga0068858_100469740
354 Ga0068858_101424543
355 Ga0068860_100097276
356 Ga0081455_10007938
357 Ga0081455_10483004
358 Ga0081539_10003435
359 Ga0075365_10055598
360 Ga0075365_10153378
361 Ga0075365_10280207
362 Ga0075364_10162367
363 Ga0075367_10187605
364 Ga0075366_10041806
365 Ga0075430_100349991
366 Ga0075433_10024772
367 Ga0075434_100138285
368 Ga0097620_101324120
369 Ga0075435_100143533
370 Ga0099794_10077201
371 Ga0099794_10264601
372 Ga0111539_10707909
373 Ga0105245_10017038
374 Ga0105245_10961495
375 Ga0105245_12156295
376 Ga0114129_10020817
377 Ga0114129_10188103
378 Ga0114129_11545931
379 Ga0105243_12554591
380 Ga0105243_12725532
381 Ga0105241_10047104
382 Ga0105242_11981682
383 Ga0105242_13032812
384 Ga0105238_12329179
385 Ga0105249_10194992
386 Ga0105249_10436821
387 Ga0105239_10275216
388 Ga0105239_11634151
389 Ga0105246_10492484
390 Ga0157373_10008892
391 Ga0157369_10000063
392 Ga0157369_10573840
393 Ga0157369_10940478
394 Ga0157374_10616003
395 Ga0157374_11167915
396 Ga0157374_12028349
397 Ga0157378_10124198
398 Ga0157378_10455970
399 Ga0157378_11336497
400 Ga0157378_11338223
401 Ga0157378_11525906
402 Ga0163162_10164782
403 Ga0157372_10098117
404 Ga0157375_10264878
405 Ga0163163_10436095
406 Ga0157380_10228019
407 Ga0182008_10228324
408 Ga0157377_10134515
409 Ga0182007_10354646
410 Ga0163161_11373738
411 Ga0197907_11251192
412 Ga0206353_10105443
413 Ga0209563_115748
414 Ga0207427_100076
415 Ga0209437_100008
416 Ga0209233_1000024
417 Ga0207656_10021466
418 Ga0207688_10004778
419 Ga0207645_10295523
420 Ga0207705_10000011
421 Ga0207705_11288761
422 Ga0207684_10000108
423 Ga0207695_10002102
424 Ga0207657_10002420
425 Ga0207657_10385589
426 Ga0207652_10320344
427 Ga0207646_10000487
428 Ga0207646_10008002
429 Ga0207646_11655597
430 Ga0207681_10008541
431 Ga0207694_10799307
432 Ga0207650_10000484
433 Ga0207650_10702619
434 Ga0207687_10129608
435 Ga0207687_11873551
436 Ga0207690_10000518
437 Ga0207690_10155949
438 Ga0207706_10005581
439 Ga0207670_10078504
440 Ga0207670_10665671
441 Ga0207669_10122802
442 Ga0207704_10105357
443 Ga0207691_10015477
444 Ga0207661_10032950
445 Ga0207661_10260696
446 Ga0207679_10035180
447 Ga0207667_10170535
448 Ga0207667_10445917
449 Ga0207712_11982868
450 Ga0207668_10332571
451 Ga0207668_11091304
452 Ga0207640_10052216
453 Ga0207640_10809277
454 Ga0207658_10108712
455 Ga0207677_10511688
456 Ga0207703_10420138
457 Ga0207639_10018612
458 Ga0207678_10055243
459 Ga0207708_10003445
460 Ga0207702_10287368
461 Ga0207641_10011830
462 Ga0207676_10165453
463 Ga0207674_10190521
464 Ga0207675_100095691
465 Ga0207698_10054426
466 Ga0207698_10085974
467 Ga0209588_1060941
468 Ga0209998_10024045
469 Ga0268264_10406516
470 Ga0316182_1064039
471 Ga0307513_10502355
472 Ga0307408_100230659
473 Ga0307408_100699053
474 Ga0307408_100810956
475 Ga0307413_10109691
476 Ga0307410_11242802
477 Ga0307406_10134505
478 Ga0307409_100096642
479 Ga0307416_100133199
480 Ga0307414_11264733
481 Ga0307415_100231115
482 Ga0307415_100796910
483 Ga0373930_0040907
484 Ga0373931_0081761
485 Ga0395899_0825129
486 Ga0395900_0003457
487 Ga0395900_0858152
488 Ga0395898_0044424
489 Ga0395898_1143895
490 Ga0395898_1805796
491 Ga0395905_0003554
492 Ga0395901_0114008
493 Ga0451802_0310731
494 Ga0450906_030661
495 Ga0466961_0195310
496 Ga0495596_0104238
497 Ga0495609_0271657
498 Ga0495658_0394202
499 Ga0496100_0424993
500 Ga0496101_0082929
501 Ga0496102_0975060
502 Ga0496107_0016039
503 Ga0496107_0163008
504 Ga0496109_0035981
505 Ga0496110_1507819
506 Ga0496111_0536970
507 Ga0496111_0562170
508 Ga0496112_0003198
509 Ga0496113_0072506
510 nmdc:mga03n38_45494_c1
511 nmdc:mga00v17_352689_c1
512 nmdc:mga0yw44_10219_c1
513 nmdc:mga0yw44_134037_c1
514 nmdc:mga0yw44_251057_c1
515 nmdc:mga0k408_8542_c1
516 nmdc:mga06z11_654071_c1
517 nmdc:mga05p37_132284_c1
518 nmdc:mga05p37_19741_c1
519 nmdc:mga0qj67_308741_c1
520 nmdc:mga06r32_367416_c1
521 nmdc:mga0n895_50838_c1
522 nmdc:mga08x19_166579_c1
523 nmdc:mga0a205_19707_c1
524 Ga0500643_000022
525 Ga0500646_0001410
526 Ga0500583_0017696
527 Ga0500650_0000001
528 Ga0500562_000009
529 Ga0500562_001747
530 Ga0500594_0000001
531 Ga0500655_000233
532 Ga0500577_0003350
533 Ga0500579_000849
534 Ga0500620_238013
535 Ga0500633_0011613
536 Ga0501084_1293844
537 Ga0590075_040187
538 2852648492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

147

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7746 6 127
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7701 3 126
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7682 1 127
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7673 2 124
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.764 3 126
ID Description Score Start End Superfamily
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7768 10 61 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7713 9 127 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7709 9 127 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7674 6 126 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.762 64 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W1D3C4-F1-model_v4 VOC family protein 0.9809 4 127
AF-A0A2N7T1R3-F1-model_v4 deleted 0.9728 6 126
AF-A0A4R7EJ75-F1-model_v4 deleted 0.9721 7 127
AF-A0A1E5MHP9-F1-model_v4 Glyoxalase 0.9713 1 126
AF-A0A2W1W6Q0-F1-model_v4 deleted 0.9712 1 126

Map