F376221

General Info

Members Datasets Scaffolds Average Seq Length
269 150 538 353

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10045367|Ga0157379_100453672
Length 397
Sequence MYKKHWAHYISDNDDCIKTMSHLGMKNKFLMICFLFGMTISFFSCANKKNDPMNGPPPPAAVNAEIAERGKAVYFDEYPATVAALNQNDLRAQVTGYITGIYFKDGQRVQQGQKLYDIDKRQYQASLDQAVANLNVTKANLAKAQQDADRYADLLKQDAVARQLYDHAKADLETAKMQMEAANSGVSNAQTTVKYSTIYAPFTGTIGISQVKIGVLVTANQTLLNTISSDDPMAVDIAVDQRDIARFVQLQNNSSARNDSVFVLKLPGNFTYPQPGKVSLIDRAVDPQTGTIKTRLVFSNPESMLKPGMNVNVRIKNNSADSSMLMIPYRAVIEQMGEYFVFVVNDSSRAIQQKLSLGPRINDKVVVRQGLNEGDKIITEGFQRLRDSAKVNVTMSK

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 2738541278 Niastella sp. CF465 Isolate Unclassified
143 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
144 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
145 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
146 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
147 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
148 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
149 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
150 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 0.37
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10045367 3300014968 Bacteria 3922
2 JGI24740J21852_10000968 3300001979 Bacteria 12786
3 JGI24740J21852_10003566 3300001979 Bacteria 6812
4 JGI24737J22298_10003011 3300001990 Bacteria 5976
5 JGI24737J22298_10005613 3300001990 Bacteria 4323
6 JGI25162J39368_1000017 3300002737 Bacteria 281385
7 JGI25154J39366_1000007 3300002738 Bacteria 335932
8 JGI25153J46596_10001828 3300003215 Bacteria 12620
9 rootH1_10065085 3300003316 Bacteria 4897
10 rootH2_10013162 3300003320 Bacteria 43068
11 rootH2_10027560 3300003320 Unclassified 3222
12 rootH2_10030616 3300003320 Bacteria 10703
13 rootL2_10188775 3300003322 Bacteria 3780
14 rootH1_10001790 3300003323 Bacteria 63047
15 rootH1_10016730 3300003323 Bacteria 2237
16 rootH1_10084943 3300003323 Bacteria 5571
17 Ga0055535_1002902 3300003761 Bacteria 5342
18 Ga0055542_1004157 3300003762 Bacteria 3634
19 Ga0070676_10096251 3300005328 Unclassified 1822
20 Ga0070683_100007696 3300005329 Bacteria 9117
21 Ga0070683_100017685 3300005329 Bacteria 6299
22 Ga0070670_100033285 3300005331 Bacteria 4439
23 Ga0070670_100065914 3300005331 Bacteria 3107
24 Ga0068869_100001850 3300005334 Bacteria 12717
25 Ga0068869_100031781 3300005334 Bacteria 3715
26 Ga0070666_10013926 3300005335 Bacteria 5111
27 Ga0070666_10031204 3300005335 Bacteria 3517
28 Ga0070689_100004423 3300005340 Bacteria 9490
29 Ga0070689_100145508 3300005340 Bacteria 1909
30 Ga0070689_100275532 3300005340 Bacteria 1394
31 Ga0070691_10032967 3300005341 Unclassified 2435
32 Ga0070691_10078225 3300005341 Unclassified 1615
33 Ga0070668_100065599 3300005347 Unclassified 2816
34 Ga0070671_100017559 3300005355 Bacteria 5797
35 Ga0070673_100059044 3300005364 Bacteria 3035
36 Ga0070688_100011482 3300005365 Bacteria 4922
37 Ga0070688_100020356 3300005365 Bacteria 3857
38 Ga0070659_100006728 3300005366 Bacteria 8311
39 Ga0070659_100017040 3300005366 Bacteria 5461
40 Ga0070667_100144373 3300005367 Bacteria 2086
41 Ga0070662_100016070 3300005457 Bacteria 5021
42 Ga0070681_10008290 3300005458 Bacteria 10175
43 Ga0070685_10031888 3300005466 Unclassified 2948
44 Ga0070679_100261411 3300005530 Bacteria 1686
45 Ga0070684_100008088 3300005535 Bacteria 8210
46 Ga0070684_100054484 3300005535 Unclassified 3485
47 Ga0068853_100046009 3300005539 Bacteria 3740
48 Ga0068853_100061845 3300005539 Bacteria 3239
49 Ga0068853_100120669 3300005539 Bacteria 2338
50 Ga0070665_100000009 3300005548 Bacteria 562640
51 Ga0070665_100061377 3300005548 Unclassified 3768
52 Ga0068855_100000998 3300005563 Bacteria 35254
53 Ga0068855_100236439 3300005563 Bacteria 2043
54 Ga0070664_100008138 3300005564 Bacteria 8477
55 Ga0070664_100084133 3300005564 Unclassified 2746
56 Ga0070664_100088582 3300005564 Unclassified 2676
57 Ga0070664_100259644 3300005564 Bacteria 1563
58 Ga0068857_100020057 3300005577 Bacteria 5877
59 Ga0068857_100042838 3300005577 Unclassified 4016
60 Ga0068857_100047350 3300005577 Unclassified 3817
61 Ga0068857_100144039 3300005577 Bacteria 2155
62 Ga0068854_100025480 3300005578 Bacteria 4059
63 Ga0068854_100068540 3300005578 Bacteria 2587
64 Ga0068854_100083764 3300005578 Bacteria 2358
65 Ga0068854_100137706 3300005578 Bacteria 1870
66 Ga0068856_100004713 3300005614 Bacteria 13539
67 Ga0068856_100174378 3300005614 Bacteria 2163
68 Ga0068852_100005446 3300005616 Bacteria 9101
69 Ga0068852_100128194 3300005616 Bacteria 2333
70 Ga0068864_100004874 3300005618 Bacteria 10986
71 Ga0068866_10012361 3300005718 Bacteria 3718
72 Ga0068861_100037406 3300005719 Bacteria 3608
73 Ga0068863_100227625 3300005841 Bacteria 1798
74 Ga0068860_100000033 3300005843 Bacteria 245461
75 Ga0068860_100004407 3300005843 Bacteria 14381
76 Ga0097621_100110992 3300006237 Bacteria 2317
77 Ga0097621_100420295 3300006237 Bacteria 1200
78 Ga0068871_100056513 3300006358 Bacteria 3190
79 Ga0105240_10011665 3300009093 Bacteria 12213
80 Ga0105240_10014277 3300009093 Bacteria 10849
81 Ga0105240_10023672 3300009093 Bacteria 8113
82 Ga0105240_10064407 3300009093 Bacteria 4555
83 Ga0105240_10131280 3300009093 Bacteria 3004
84 Ga0105241_10003981 3300009174 Bacteria 10919
85 Ga0105241_10020278 3300009174 Bacteria 4911
86 Ga0105242_10008719 3300009176 Bacteria 7782
87 Ga0105237_10003021 3300009545 Bacteria 20301
88 Ga0105237_10005763 3300009545 Bacteria 13915
89 Ga0105237_10017644 3300009545 Bacteria 7396
90 Ga0105237_10036096 3300009545 Bacteria 5000
91 Ga0105237_10046582 3300009545 Bacteria 4361
92 Ga0105237_10089615 3300009545 Bacteria 3065
93 Ga0105238_10006738 3300009551 Bacteria 11470
94 Ga0105238_10043410 3300009551 Bacteria 4550
95 Ga0105238_10119716 3300009551 Unclassified 2613
96 Ga0105239_10001380 3300010375 Bacteria 32568
97 Ga0105239_10011392 3300010375 Bacteria 9919
98 Ga0105239_10026720 3300010375 Bacteria 6354
99 Ga0105239_10120810 3300010375 Bacteria 2909
100 Ga0105239_10150779 3300010375 Unclassified 2595
101 Ga0105239_10178600 3300010375 Bacteria 2375
102 Ga0105239_10249415 3300010375 Bacteria 1994
103 Ga0105239_10249482 3300010375 Bacteria 1993
104 Ga0105246_10027023 3300011119 Bacteria 3756
105 Ga0157373_10000661 3300013100 Bacteria 27028
106 Ga0157373_10107206 3300013100 Bacteria 1964
107 Ga0157371_10000622 3300013102 Bacteria 42231
108 Ga0157371_10001349 3300013102 Bacteria 25843
109 Ga0157370_10000405 3300013104 Bacteria 54383
110 Ga0157370_10003763 3300013104 Bacteria 17707
111 Ga0157370_10011017 3300013104 Bacteria 9485
112 Ga0157370_10046885 3300013104 Unclassified 4143
113 Ga0157374_10001178 3300013296 Bacteria 22309
114 Ga0157374_10003276 3300013296 Bacteria 13602
115 Ga0157374_10016837 3300013296 Bacteria 6431
116 Ga0163162_10004829 3300013306 Bacteria 13007
117 Ga0163162_10005781 3300013306 Bacteria 11969
118 Ga0163162_10014811 3300013306 Bacteria 7616
119 Ga0157372_10001219 3300013307 Bacteria 27839
120 Ga0157372_10001355 3300013307 Bacteria 26492
121 Ga0157372_10005956 3300013307 Bacteria 12962
122 Ga0157372_10026621 3300013307 Bacteria 6294
123 Ga0157372_10026793 3300013307 Bacteria 6275
124 Ga0157372_10387822 3300013307 Bacteria 1628
125 Ga0157375_10122206 3300013308 Bacteria 2715
126 Ga0163163_10000803 3300014325 Bacteria 26650
127 Ga0163163_10020169 3300014325 Bacteria 6274
128 Ga0157377_10009333 3300014745 Bacteria 4807
129 Ga0157377_10152298 3300014745 Bacteria 1430
130 Ga0157379_10077166 3300014968 Bacteria 2983
131 Ga0157376_10019467 3300014969 Bacteria 5233
132 Ga0157376_10055133 3300014969 Bacteria 3316
133 Ga0163161_10015385 3300017792 Bacteria 5333
134 Ga0209437_100024 3300025233 Bacteria 592878
135 Ga0209258_100219 3300025242 Bacteria 108974
136 Ga0209646_1000002 3300025246 Bacteria 1425781
137 Ga0209026_1001015 3300025250 Bacteria 13857
138 Ga0209148_1000283 3300025254 Bacteria 77780
139 Ga0209233_1002165 3300025261 Bacteria 7364
140 Ga0209130_1002280 3300025284 Bacteria 9860
141 Ga0209758_1005513 3300025297 Bacteria 9676
142 Ga0207426_1000341 3300025302 Bacteria 87735
143 Ga0207426_1000850 3300025302 Bacteria 32126
144 Ga0207680_10019826 3300025903 Bacteria 3606
145 Ga0207647_10000492 3300025904 Bacteria 31644
146 Ga0207647_10014974 3300025904 Bacteria 5330
147 Ga0207647_10025154 3300025904 Bacteria 3918
148 Ga0207645_10032490 3300025907 Bacteria 3354
149 Ga0207654_10008319 3300025911 Bacteria 5242
150 Ga0207654_10030725 3300025911 Bacteria 2951
151 Ga0207707_10027756 3300025912 Bacteria 4949
152 Ga0207695_10000128 3300025913 Bacteria 226098
153 Ga0207695_10007519 3300025913 Bacteria 13821
154 Ga0207695_10008461 3300025913 Bacteria 12883
155 Ga0207695_10054281 3300025913 Bacteria 4186
156 Ga0207695_10118937 3300025913 Bacteria 2613
157 Ga0207695_10239783 3300025913 Bacteria 1715
158 Ga0207671_10006532 3300025914 Bacteria 10364
159 Ga0207671_10006681 3300025914 Bacteria 10219
160 Ga0207671_10011200 3300025914 Bacteria 7319
161 Ga0207671_10020410 3300025914 Bacteria 5043
162 Ga0207660_10117233 3300025917 Bacteria 2012
163 Ga0207649_10108636 3300025920 Unclassified 1849
164 Ga0207652_10000350 3300025921 Bacteria 47780
165 Ga0207652_10230567 3300025921 Bacteria 1669
166 Ga0207694_10015736 3300025924 Bacteria 5707
167 Ga0207694_10041349 3300025924 Bacteria 3552
168 Ga0207694_10248836 3300025924 Bacteria 1454
169 Ga0207659_10017079 3300025926 Bacteria 4735
170 Ga0207690_10012852 3300025932 Bacteria 5016
171 Ga0207706_10027500 3300025933 Bacteria 5085
172 Ga0207706_10241665 3300025933 Unclassified 1578
173 Ga0207691_10080520 3300025940 Bacteria 2929
174 Ga0207691_10171283 3300025940 Bacteria 1901
175 Ga0207689_10004660 3300025942 Bacteria 12400
176 Ga0207689_10008354 3300025942 Bacteria 9014
177 Ga0207661_10007258 3300025944 Bacteria 7882
178 Ga0207661_10041072 3300025944 Bacteria 3640
179 Ga0207679_10001099 3300025945 Bacteria 17218
180 Ga0207679_10098829 3300025945 Unclassified 2277
181 Ga0207679_10211248 3300025945 Bacteria 1627
182 Ga0207667_10000610 3300025949 Bacteria 46234
183 Ga0207667_10001471 3300025949 Bacteria 29532
184 Ga0207667_10001886 3300025949 Bacteria 26373
185 Ga0207667_10060847 3300025949 Bacteria 3952
186 Ga0207668_10063895 3300025972 Bacteria 2599
187 Ga0207640_10052074 3300025981 Bacteria 2665
188 Ga0207640_10065743 3300025981 Unclassified 2420
189 Ga0207640_10073362 3300025981 Bacteria 2312
190 Ga0207640_10077868 3300025981 Bacteria 2255
191 Ga0207677_10025286 3300026023 Bacteria 3702
192 Ga0207677_10160741 3300026023 Bacteria 1745
193 Ga0207703_10134417 3300026035 Unclassified 2139
194 Ga0207702_10106303 3300026078 Bacteria 2487
195 Ga0207702_10141248 3300026078 Bacteria 2179
196 Ga0207641_10086286 3300026088 Bacteria 2737
197 Ga0207676_10010000 3300026095 Bacteria 6750
198 Ga0207674_10022550 3300026116 Bacteria 6759
199 Ga0207674_10025146 3300026116 Bacteria 6354
200 Ga0207674_10027591 3300026116 Bacteria 6003
201 Ga0207674_10144789 3300026116 Bacteria 2335
202 Ga0207675_100021658 3300026118 Bacteria 5983
203 Ga0207698_10017062 3300026142 Bacteria 4916
204 Ga0207698_10140811 3300026142 Bacteria 2078
205 Ga0268266_10000014 3300028379 Bacteria 644033
206 Ga0268266_10081426 3300028379 Bacteria 2823
207 Ga0268264_10000013 3300028381 Bacteria 513859
208 Ga0268264_10002568 3300028381 Bacteria 15916
209 Ga0268264_10190763 3300028381 Bacteria 1868
210 Ga0265327_10000146 3300031251 Bacteria 154436
211 Ga0307510_10001022 3300033180 Bacteria 29641
212 Ga0373936_0046216 3300035113 Bacteria 1755
213 Ga0395899_0045562 3300037312 Bacteria 3267
214 Ga0395900_0025616 3300037418 Bacteria 6037
215 Ga0395900_0110922 3300037418 Bacteria 2818
216 Ga0395898_0011037 3300037466 Bacteria 9411
217 Ga0395901_0016919 3300038443 Bacteria 7433
218 Ga0395901_0172691 3300038443 Bacteria 2268
219 Ga0466969_0000445 3300044656 Bacteria 22630
220 Ga0466972_0000270 3300044658 Bacteria 32742
221 Ga0466972_0003967 3300044658 Bacteria 7374
222 Ga0466972_0029509 3300044658 Bacteria 2700
223 Ga0466965_0093325 3300044683 Bacteria 1533
224 Ga0466966_0000144 3300044684 Bacteria 45151
225 Ga0466968_0009046 3300044735 Bacteria 3830
226 Ga0466957_0001227 3300044842 Bacteria 13383
227 Ga0466957_0023111 3300044842 Bacteria 3672
228 Ga0466960_0049194 3300044901 Unclassified 2029
229 Ga0466959_0000045 3300045049 Bacteria 89773
230 Ga0495638_0041258 3300046460 Bacteria 2921
231 Ga0495638_0044276 3300046460 Bacteria 2804
232 Ga0495606_0011528 3300046507 Bacteria 7201
233 Ga0495643_0036640 3300046522 Bacteria 2694
234 Ga0495648_0002439 3300046524 Bacteria 17207
235 Ga0495611_0000154 3300046648 Bacteria 49174
236 Ga0495672_0017121 3300047320 Bacteria 4854
237 Ga0495686_0000256 3300047472 Bacteria 95552
238 Ga0496110_0046802 3300048913 Bacteria 3785
239 Ga0501037_0071185 3300049573 Bacteria 2530
240 Ga0501047_0043490 3300049581 Bacteria 4339
241 Ga0501047_0078931 3300049581 Bacteria 3165
242 Ga0501225_0000212 3300049705 Bacteria 18288
243 Ga0501035_0112471 3300049822 Bacteria 2386
244 Ga0501044_0005156 3300049823 Bacteria 14565
245 Ga0501044_0034223 3300049823 Bacteria 5331
246 Ga0500578_0000184 3300053086 Bacteria 75675
247 Ga0500644_0000279 3300053088 Bacteria 28337
248 Ga0500583_0000709 3300053092 Bacteria 9682
249 Ga0500583_0004699 3300053092 Bacteria 4487
250 Ga0500641_0013144 3300053096 Bacteria 3039
251 Ga0500564_029498 3300053138 Bacteria 2527
252 Ga0500568_0001732 3300053139 Bacteria 13529
253 Ga0500568_0016148 3300053139 Bacteria 3326
254 Ga0500588_0085818 3300053146 Bacteria 1062
255 Ga0500622_0000991 3300053156 Bacteria 23992
256 Ga0500622_0002062 3300053156 Bacteria 14972
257 Ga0500622_0043346 3300053156 Bacteria 2334
258 Ga0500637_0079122 3300053178 Unclassified 1898
259 Ga0466962_0033075 3300061719 Bacteria 2474
260 Ga0466962_0105615 3300061719 Bacteria 1354
261 2738726882 2738541278 Bacteria 9755573
262 2819680508 2818991460 Bacteria 7595395
263 2884798081 2884791551 Bacteria 8511252
264 2919438923 2919437846 Bacteria 6199444
265 2929182801 2929177148 Bacteria 7883697
266 2929923401 2929921140 Bacteria 8649150
267 2945978756 2945977869 Bacteria 7777518
268 2946015377 2946013367 Bacteria 7766675
269 8003152803 8003151029 Bacteria 8187759
270 Ga0157379_10045367
271 JGI24740J21852_10000968
272 JGI24740J21852_10003566
273 JGI24737J22298_10003011
274 JGI24737J22298_10005613
275 JGI25162J39368_1000017
276 JGI25154J39366_1000007
277 JGI25153J46596_10001828
278 rootH1_10065085
279 rootH2_10013162
280 rootH2_10027560
281 rootH2_10030616
282 rootL2_10188775
283 rootH1_10001790
284 rootH1_10016730
285 rootH1_10084943
286 Ga0055535_1002902
287 Ga0055542_1004157
288 Ga0070676_10096251
289 Ga0070683_100007696
290 Ga0070683_100017685
291 Ga0070670_100033285
292 Ga0070670_100065914
293 Ga0068869_100001850
294 Ga0068869_100031781
295 Ga0070666_10013926
296 Ga0070666_10031204
297 Ga0070689_100004423
298 Ga0070689_100145508
299 Ga0070689_100275532
300 Ga0070691_10032967
301 Ga0070691_10078225
302 Ga0070668_100065599
303 Ga0070671_100017559
304 Ga0070673_100059044
305 Ga0070688_100011482
306 Ga0070688_100020356
307 Ga0070659_100006728
308 Ga0070659_100017040
309 Ga0070667_100144373
310 Ga0070662_100016070
311 Ga0070681_10008290
312 Ga0070685_10031888
313 Ga0070679_100261411
314 Ga0070684_100008088
315 Ga0070684_100054484
316 Ga0068853_100046009
317 Ga0068853_100061845
318 Ga0068853_100120669
319 Ga0070665_100000009
320 Ga0070665_100061377
321 Ga0068855_100000998
322 Ga0068855_100236439
323 Ga0070664_100008138
324 Ga0070664_100084133
325 Ga0070664_100088582
326 Ga0070664_100259644
327 Ga0068857_100020057
328 Ga0068857_100042838
329 Ga0068857_100047350
330 Ga0068857_100144039
331 Ga0068854_100025480
332 Ga0068854_100068540
333 Ga0068854_100083764
334 Ga0068854_100137706
335 Ga0068856_100004713
336 Ga0068856_100174378
337 Ga0068852_100005446
338 Ga0068852_100128194
339 Ga0068864_100004874
340 Ga0068866_10012361
341 Ga0068861_100037406
342 Ga0068863_100227625
343 Ga0068860_100000033
344 Ga0068860_100004407
345 Ga0097621_100110992
346 Ga0097621_100420295
347 Ga0068871_100056513
348 Ga0105240_10011665
349 Ga0105240_10014277
350 Ga0105240_10023672
351 Ga0105240_10064407
352 Ga0105240_10131280
353 Ga0105241_10003981
354 Ga0105241_10020278
355 Ga0105242_10008719
356 Ga0105237_10003021
357 Ga0105237_10005763
358 Ga0105237_10017644
359 Ga0105237_10036096
360 Ga0105237_10046582
361 Ga0105237_10089615
362 Ga0105238_10006738
363 Ga0105238_10043410
364 Ga0105238_10119716
365 Ga0105239_10001380
366 Ga0105239_10011392
367 Ga0105239_10026720
368 Ga0105239_10120810
369 Ga0105239_10150779
370 Ga0105239_10178600
371 Ga0105239_10249415
372 Ga0105239_10249482
373 Ga0105246_10027023
374 Ga0157373_10000661
375 Ga0157373_10107206
376 Ga0157371_10000622
377 Ga0157371_10001349
378 Ga0157370_10000405
379 Ga0157370_10003763
380 Ga0157370_10011017
381 Ga0157370_10046885
382 Ga0157374_10001178
383 Ga0157374_10003276
384 Ga0157374_10016837
385 Ga0163162_10004829
386 Ga0163162_10005781
387 Ga0163162_10014811
388 Ga0157372_10001219
389 Ga0157372_10001355
390 Ga0157372_10005956
391 Ga0157372_10026621
392 Ga0157372_10026793
393 Ga0157372_10387822
394 Ga0157375_10122206
395 Ga0163163_10000803
396 Ga0163163_10020169
397 Ga0157377_10009333
398 Ga0157377_10152298
399 Ga0157379_10077166
400 Ga0157376_10019467
401 Ga0157376_10055133
402 Ga0163161_10015385
403 Ga0209437_100024
404 Ga0209258_100219
405 Ga0209646_1000002
406 Ga0209026_1001015
407 Ga0209148_1000283
408 Ga0209233_1002165
409 Ga0209130_1002280
410 Ga0209758_1005513
411 Ga0207426_1000341
412 Ga0207426_1000850
413 Ga0207680_10019826
414 Ga0207647_10000492
415 Ga0207647_10014974
416 Ga0207647_10025154
417 Ga0207645_10032490
418 Ga0207654_10008319
419 Ga0207654_10030725
420 Ga0207707_10027756
421 Ga0207695_10000128
422 Ga0207695_10007519
423 Ga0207695_10008461
424 Ga0207695_10054281
425 Ga0207695_10118937
426 Ga0207695_10239783
427 Ga0207671_10006532
428 Ga0207671_10006681
429 Ga0207671_10011200
430 Ga0207671_10020410
431 Ga0207660_10117233
432 Ga0207649_10108636
433 Ga0207652_10000350
434 Ga0207652_10230567
435 Ga0207694_10015736
436 Ga0207694_10041349
437 Ga0207694_10248836
438 Ga0207659_10017079
439 Ga0207690_10012852
440 Ga0207706_10027500
441 Ga0207706_10241665
442 Ga0207691_10080520
443 Ga0207691_10171283
444 Ga0207689_10004660
445 Ga0207689_10008354
446 Ga0207661_10007258
447 Ga0207661_10041072
448 Ga0207679_10001099
449 Ga0207679_10098829
450 Ga0207679_10211248
451 Ga0207667_10000610
452 Ga0207667_10001471
453 Ga0207667_10001886
454 Ga0207667_10060847
455 Ga0207668_10063895
456 Ga0207640_10052074
457 Ga0207640_10065743
458 Ga0207640_10073362
459 Ga0207640_10077868
460 Ga0207677_10025286
461 Ga0207677_10160741
462 Ga0207703_10134417
463 Ga0207702_10106303
464 Ga0207702_10141248
465 Ga0207641_10086286
466 Ga0207676_10010000
467 Ga0207674_10022550
468 Ga0207674_10025146
469 Ga0207674_10027591
470 Ga0207674_10144789
471 Ga0207675_100021658
472 Ga0207698_10017062
473 Ga0207698_10140811
474 Ga0268266_10000014
475 Ga0268266_10081426
476 Ga0268264_10000013
477 Ga0268264_10002568
478 Ga0268264_10190763
479 Ga0265327_10000146
480 Ga0307510_10001022
481 Ga0373936_0046216
482 Ga0395899_0045562
483 Ga0395900_0025616
484 Ga0395900_0110922
485 Ga0395898_0011037
486 Ga0395901_0016919
487 Ga0395901_0172691
488 Ga0466969_0000445
489 Ga0466972_0000270
490 Ga0466972_0003967
491 Ga0466972_0029509
492 Ga0466965_0093325
493 Ga0466966_0000144
494 Ga0466968_0009046
495 Ga0466957_0001227
496 Ga0466957_0023111
497 Ga0466960_0049194
498 Ga0466959_0000045
499 Ga0495638_0041258
500 Ga0495638_0044276
501 Ga0495606_0011528
502 Ga0495643_0036640
503 Ga0495648_0002439
504 Ga0495611_0000154
505 Ga0495672_0017121
506 Ga0495686_0000256
507 Ga0496110_0046802
508 Ga0501037_0071185
509 Ga0501047_0043490
510 Ga0501047_0078931
511 Ga0501225_0000212
512 Ga0501035_0112471
513 Ga0501044_0005156
514 Ga0501044_0034223
515 Ga0500578_0000184
516 Ga0500644_0000279
517 Ga0500583_0000709
518 Ga0500583_0004699
519 Ga0500641_0013144
520 Ga0500564_029498
521 Ga0500568_0001732
522 Ga0500568_0016148
523 Ga0500588_0085818
524 Ga0500622_0000991
525 Ga0500622_0002062
526 Ga0500622_0043346
527 Ga0500637_0079122
528 Ga0466962_0033075
529 Ga0466962_0105615
530 2738726882
531 2819680508
532 2884798081
533 2919438923
534 2929182801
535 2929923401
536 2945978756
537 2946015377
538 8003152803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

86

135

0.95

PF13437

HlyD_3

HlyD family secretion protein

197

308

0.83

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

80

311

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsk-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.9146 63 168
5vyz-assembly1.cif.gz_C crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.9067 63 167
5vyz-assembly1.cif.gz_D crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.9055 63 167
5vz0-assembly1.cif.gz_D crystal structure of lactococcus lactis pyruvate carboxylase g746a mutant in complex with cyclic-di-amp 0.9054 63 167
7ybu-assembly1.cif.gz_A human propionyl-coenzyme a carboxylase 0.9053 63 167
ID Description Score Start End Superfamily
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9289 60 167 2.40.50.100
3oocA01 Mainly Beta;Beta Barrel;conserved putative lor/sdh protein from methanococcus maripaludis s2 fold; 0.9272 263 319 2.40.420.20
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9096 60 167 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9021 60 167 2.40.50.100
af_Q9UUE1_1106_1184_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9015 63 167 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A5K7SF47-F1-model_v4 Co/Zn/Cd efflux system membrane fusion protein 0.9189 263 333 GO:0015562
GO:1990281
AF-A0A6M1NFB2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8803 257 331 GO:0015562
GO:1990281
AF-A0A5B8CZW7-F1-model_v4 deleted 0.8358 28 337
AF-A0A3D4TBD7-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8207 116 330 GO:0005886
GO:0022857
GO:0030313
GO:0046677
AF-A0A4P5R3V9-F1-model_v4 MexH family multidrug efflux RND transporter periplasmic adaptor subunit 0.8174 31 340 GO:0015562
GO:1990281

Map