F376261

General Info

Members Datasets Scaffolds Average Seq Length
269 164 538 317

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10258828|Ga0207690_102588282
Length 356
Sequence MSTGTEIVGRGAVFRSITPPEHVQGLVNLEGREFYCIPDYDRMPPFLMTVVSDTDLWMYLSSTGALTAGQIEEAVLVRFDPVRRRGVARFASGEEALVDRLPVGTREGAPVRLEVTRAAIAERGRLKRAQARPSEAPLHGASSPAQVLASQGHPVRAVRRFPAGLWEDVWTEAWSGEVAFASGALLFSITPAMTLIDIDGTVSPGALAQAAVAPLASAIRRFDLGGSIGVDFPSLEQKADRRALDALLDDALRDWPHERTAMNGFGFVQLVARLERPSLLHRLTLSRAGAAARLLLRRAEQVEAPGRLLLTAHPSVISNLTDEWLAELARRSGREVRLAIDPTLALDGGFAQAVAR

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
138 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
144 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
145 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
146 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
147 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
148 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
149 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
150 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
151 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
152 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
153 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
154 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
155 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
156 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
157 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
158 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
159 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
160 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
161 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
162 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
163 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
164 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0
Isolates 7.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 0
Rhizoplane 4.46
Rhizosphere 70.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10258828 3300025932 Bacteria 1347
2 SwRhRL2b_contig_2631586 2162886007 Bacteria 27217
3 Ga0065704_10070209 3300005289 Bacteria 78459
4 Ga0070658_10000475 3300005327 Bacteria 34795
5 Ga0070658_10015369 3300005327 Bacteria 6125
6 Ga0070683_100007087 3300005329 Bacteria 9443
7 Ga0070683_100131729 3300005329 Bacteria 2366
8 Ga0070670_100084104 3300005331 Bacteria 2734
9 Ga0070666_10007981 3300005335 Bacteria 6544
10 Ga0070680_100019415 3300005336 Bacteria 5386
11 Ga0070660_100000138 3300005339 Bacteria 46736
12 Ga0070660_100048247 3300005339 Bacteria 3270
13 Ga0070661_100081825 3300005344 Bacteria 2384
14 Ga0070668_100053850 3300005347 Bacteria 3102
15 Ga0070668_100247106 3300005347 Bacteria 1480
16 Ga0070669_100000334 3300005353 Bacteria 36683
17 Ga0070669_100031199 3300005353 Bacteria 3849
18 Ga0070671_100000138 3300005355 Bacteria 46941
19 Ga0070671_100017934 3300005355 Bacteria 5742
20 Ga0070659_100000634 3300005366 Bacteria 25720
21 Ga0070659_100056103 3300005366 Bacteria 3106
22 Ga0070659_100097696 3300005366 Bacteria 2360
23 Ga0070667_100000268 3300005367 Bacteria 59162
24 Ga0070667_100001422 3300005367 Bacteria 21447
25 Ga0070667_100028721 3300005367 Bacteria 4631
26 Ga0070667_100058568 3300005367 Bacteria 3257
27 Ga0070662_100000168 3300005457 Bacteria 38012
28 Ga0070662_100084220 3300005457 Bacteria 2375
29 Ga0070681_10002123 3300005458 Bacteria 18002
30 Ga0070679_100002413 3300005530 Bacteria 16933
31 Ga0070679_100040649 3300005530 Bacteria 4626
32 Ga0068853_100000481 3300005539 Bacteria 27224
33 Ga0070665_100009828 3300005548 Bacteria 9670
34 Ga0070665_100018020 3300005548 Bacteria 7088
35 Ga0068855_100001485 3300005563 Bacteria 29343
36 Ga0068855_100030457 3300005563 Bacteria 6455
37 Ga0068855_100113903 3300005563 Bacteria 3101
38 Ga0068855_100181560 3300005563 Bacteria 2379
39 Ga0070664_100003332 3300005564 Bacteria 12979
40 Ga0070664_100179185 3300005564 Bacteria 1883
41 Ga0068857_100016239 3300005577 Bacteria 6522
42 Ga0068857_100018423 3300005577 Bacteria 6126
43 Ga0068857_100049930 3300005577 Bacteria 3712
44 Ga0068854_100006417 3300005578 Bacteria 7482
45 Ga0068854_100008028 3300005578 Bacteria 6763
46 Ga0068854_100026256 3300005578 Bacteria 4001
47 Ga0068852_100000148 3300005616 Bacteria 47327
48 Ga0068864_100013691 3300005618 Bacteria 6726
49 Ga0068851_10054277 3300005834 Bacteria 2041
50 Ga0068863_100001327 3300005841 Bacteria 24641
51 Ga0068863_100023720 3300005841 Bacteria 5854
52 Ga0068863_100031736 3300005841 Bacteria 5041
53 Ga0068858_100011578 3300005842 Bacteria 8319
54 Ga0068860_100000007 3300005843 Bacteria 429329
55 Ga0068860_100003664 3300005843 Bacteria 15819
56 Ga0068860_100024880 3300005843 Bacteria 5781
57 Ga0068860_100128742 3300005843 Bacteria 2427
58 Ga0068860_100218690 3300005843 Bacteria 1850
59 Ga0068862_100008452 3300005844 Bacteria 8515
60 Ga0068862_100097150 3300005844 Bacteria 2571
61 Ga0068862_100147968 3300005844 Bacteria 2089
62 Ga0075365_10032560 3300006038 Bacteria 3352
63 Ga0075368_10001034 3300006042 Bacteria 8709
64 Ga0075364_10002252 3300006051 Bacteria 10820
65 Ga0075362_10006060 3300006177 Bacteria 4476
66 Ga0075362_10093786 3300006177 Bacteria 1396
67 Ga0075367_10003627 3300006178 Bacteria 7400
68 Ga0075366_10018788 3300006195 Bacteria 3994
69 Ga0105251_10008601 3300009011 Bacteria 6123
70 Ga0105240_10002335 3300009093 Bacteria 30672
71 Ga0105248_10017512 3300009177 Bacteria 7900
72 Ga0105248_10087964 3300009177 Bacteria 3497
73 Ga0105248_10100199 3300009177 Bacteria 3264
74 Ga0105238_10062257 3300009551 Bacteria 3732
75 Ga0105246_10000224 3300011119 Bacteria 28800
76 Ga0157373_10019752 3300013100 Bacteria 4900
77 Ga0157371_10001911 3300013102 Bacteria 20840
78 Ga0157371_10182659 3300013102 Bacteria 1500
79 Ga0157370_10025799 3300013104 Bacteria 5814
80 Ga0157369_10004179 3300013105 Bacteria 17106
81 Ga0157369_10241910 3300013105 Bacteria 1885
82 Ga0163162_10030331 3300013306 Bacteria 5358
83 Ga0157372_10002839 3300013307 Bacteria 18721
84 Ga0157372_10410924 3300013307 Bacteria 1577
85 Ga0157375_10413095 3300013308 Bacteria 1516
86 Ga0163161_10044371 3300017792 Bacteria 3202
87 Ga0209050_1000370 3300025298 Bacteria 85916
88 Ga0207680_10031709 3300025903 Bacteria 2996
89 Ga0207680_10088192 3300025903 Bacteria 1966
90 Ga0207705_10000023 3300025909 Bacteria 301755
91 Ga0207705_10001064 3300025909 Bacteria 22327
92 Ga0207705_10022620 3300025909 Bacteria 4484
93 Ga0207705_10029920 3300025909 Bacteria 3884
94 Ga0207707_10019635 3300025912 Bacteria 5898
95 Ga0207695_10005422 3300025913 Bacteria 16927
96 Ga0207657_10000362 3300025919 Bacteria 47826
97 Ga0207657_10009136 3300025919 Bacteria 10001
98 Ga0207657_10050407 3300025919 Bacteria 3623
99 Ga0207657_10149193 3300025919 Bacteria 1905
100 Ga0207649_10023935 3300025920 Bacteria 3543
101 Ga0207652_10011632 3300025921 Bacteria 7098
102 Ga0207652_10028663 3300025921 Bacteria 4648
103 Ga0207652_10291474 3300025921 Bacteria 1472
104 Ga0207681_10003860 3300025923 Bacteria 9309
105 Ga0207681_10004289 3300025923 Bacteria 8802
106 Ga0207694_10037889 3300025924 Bacteria 3706
107 Ga0207644_10000005 3300025931 Bacteria 441948
108 Ga0207644_10014013 3300025931 Bacteria 5358
109 Ga0207644_10331572 3300025931 Bacteria 1232
110 Ga0207690_10000733 3300025932 Bacteria 21132
111 Ga0207706_10018671 3300025933 Bacteria 6240
112 Ga0207706_10027211 3300025933 Bacteria 5114
113 Ga0207706_10027241 3300025933 Bacteria 5111
114 Ga0207711_10006622 3300025941 Bacteria 9757
115 Ga0207711_10185063 3300025941 Bacteria 1896
116 Ga0207661_10005453 3300025944 Bacteria 8969
117 Ga0207679_10004890 3300025945 Bacteria 8352
118 Ga0207679_10011143 3300025945 Bacteria 5807
119 Ga0207667_10002972 3300025949 Bacteria 21067
120 Ga0207667_10148477 3300025949 Bacteria 2413
121 Ga0207667_10310602 3300025949 Bacteria 1610
122 Ga0207668_10002245 3300025972 Bacteria 11265
123 Ga0207668_10328593 3300025972 Bacteria 1271
124 Ga0207640_10000228 3300025981 Bacteria 39076
125 Ga0207640_10001698 3300025981 Bacteria 11802
126 Ga0207640_10026758 3300025981 Bacteria 3506
127 Ga0207658_10000912 3300025986 Bacteria 24496
128 Ga0207658_10001021 3300025986 Bacteria 22789
129 Ga0207658_10083118 3300025986 Bacteria 2460
130 Ga0207658_10111124 3300025986 Bacteria 2167
131 Ga0207703_10012950 3300026035 Bacteria 6501
132 Ga0207639_10006436 3300026041 Bacteria 7986
133 Ga0207641_10000035 3300026088 Bacteria 214358
134 Ga0207676_10028374 3300026095 Bacteria 4180
135 Ga0207676_10132368 3300026095 Bacteria 2122
136 Ga0207674_10112520 3300026116 Bacteria 2696
137 Ga0207674_10332724 3300026116 Bacteria 1469
138 Ga0207674_10404995 3300026116 Bacteria 1318
139 Ga0207698_10000685 3300026142 Bacteria 19678
140 Ga0209813_10000064 3300027866 Bacteria 43230
141 Ga0268266_10001866 3300028379 Bacteria 23816
142 Ga0268266_10007663 3300028379 Bacteria 9706
143 Ga0268266_10070533 3300028379 Bacteria 3028
144 Ga0268265_10006764 3300028380 Bacteria 7757
145 Ga0268265_10023422 3300028380 Bacteria 4352
146 Ga0268265_10130946 3300028380 Bacteria 2084
147 Ga0268264_10000077 3300028381 Bacteria 252597
148 Ga0268264_10002195 3300028381 Bacteria 17346
149 Ga0268264_10016382 3300028381 Bacteria 6068
150 Ga0268264_10097977 3300028381 Bacteria 2542
151 Ga0268264_10250852 3300028381 Bacteria 1644
152 Ga0307408_100133312 3300031548 Bacteria 1941
153 Ga0307508_10005872 3300031616 Bacteria 11586
154 Ga0307405_10000325 3300031731 Bacteria 17647
155 Ga0307410_10146881 3300031852 Bacteria 1751
156 Ga0307410_10236480 3300031852 Bacteria 1413
157 Ga0307406_10029766 3300031901 Bacteria 3309
158 Ga0307406_10408306 3300031901 Bacteria 1079
159 Ga0307412_10102568 3300031911 Bacteria 2026
160 Ga0307412_10136462 3300031911 Bacteria 1790
161 Ga0307409_100380447 3300031995 Bacteria 1342
162 Ga0307416_100315583 3300032002 Bacteria 1562
163 Ga0307414_10046599 3300032004 Bacteria 2977
164 Ga0307411_10026792 3300032005 Bacteria 3476
165 Ga0307415_100200805 3300032126 Bacteria 1582
166 Ga0307510_10291031 3300033180 Bacteria 1099
167 Ga0316582_0223704 3300036647 Bacteria 1287
168 Ga0439462_0014271 3300042015 Bacteria 2040
169 Ga0495627_000099 3300046453 Bacteria 107062
170 Ga0495650_0001568 3300046471 Bacteria 21502
171 Ga0495596_0000113 3300046500 Bacteria 55405
172 Ga0495596_0000790 3300046500 Bacteria 19241
173 Ga0495607_0059105 3300046501 Bacteria 2188
174 Ga0495606_0008910 3300046507 Bacteria 8594
175 Ga0495606_0065826 3300046507 Bacteria 2301
176 Ga0495610_0000018 3300046512 Bacteria 355044
177 Ga0495610_0000750 3300046512 Bacteria 30638
178 Ga0495610_0001809 3300046512 Bacteria 18580
179 Ga0495620_0016257 3300046515 Bacteria 3740
180 Ga0495632_0000758 3300046519 Bacteria 29015
181 Ga0495632_0018412 3300046519 Bacteria 3834
182 Ga0495643_0000746 3300046522 Bacteria 36916
183 Ga0495643_0010107 3300046522 Bacteria 5822
184 Ga0495643_0017437 3300046522 Bacteria 4197
185 Ga0495643_0021526 3300046522 Bacteria 3698
186 Ga0495625_0012169 3300046660 Bacteria 6981
187 Ga0495681_0000020 3300047470 Bacteria 170007
188 Ga0495615_0000036 3300048090 Bacteria 44577
189 Ga0495626_0005162 3300048091 Bacteria 7745
190 Ga0496100_0087565 3300048903 Bacteria 2118
191 Ga0496101_0023327 3300048904 Bacteria 4273
192 Ga0496101_0134238 3300048904 Bacteria 1882
193 Ga0496103_0020803 3300048906 Bacteria 3944
194 Ga0496103_0047257 3300048906 Bacteria 2659
195 Ga0496104_0029253 3300048907 Bacteria 5110
196 Ga0496105_0000189 3300048908 Bacteria 41170
197 Ga0496109_0046084 3300048912 Bacteria 3959
198 Ga0496112_0205532 3300048915 Bacteria 1927
199 Ga0496113_0005305 3300048916 Bacteria 8024
200 Ga0496114_0048271 3300048917 Bacteria 3541
201 Ga0496114_0099439 3300048917 Bacteria 2481
202 Ga0496116_0000028 3300048919 Bacteria 424086
203 Ga0496117_0056499 3300048920 Bacteria 2733
204 Ga0496117_0057618 3300048920 Bacteria 2696
205 Ga0496118_0008372 3300048921 Bacteria 10697
206 Ga0496118_0029713 3300048921 Bacteria 4578
207 Ga0496118_0082167 3300048921 Bacteria 2259
208 Ga0496121_0000021 3300048924 Bacteria 478544
209 Ga0496121_0000861 3300048924 Bacteria 54871
210 Ga0496121_0011638 3300048924 Bacteria 9728
211 Ga0496122_0001127 3300048925 Bacteria 46009
212 Ga0496122_0029754 3300048925 Bacteria 4594
213 Ga0496123_0000705 3300048926 Bacteria 54647
214 Ga0496123_0001612 3300048926 Bacteria 30490
215 Ga0496124_0001859 3300048927 Bacteria 29158
216 Ga0496124_0009095 3300048927 Bacteria 10271
217 Ga0496124_0061756 3300048927 Bacteria 3139
218 Ga0496124_0118928 3300048927 Bacteria 2114
219 Ga0496125_0008127 3300048928 Bacteria 11051
220 Ga0496125_0012224 3300048928 Bacteria 8540
221 Ga0496125_0109116 3300048928 Bacteria 2010
222 Ga0496126_0000079 3300048929 Bacteria 222463
223 Ga0496126_0025230 3300048929 Bacteria 5723
224 Ga0496126_0090884 3300048929 Bacteria 2685
225 Ga0496126_0225975 3300048929 Bacteria 1570
226 Ga0501034_0145375 3300049571 Bacteria 2349
227 Ga0501039_0187083 3300049575 Bacteria 1629
228 Ga0501044_0291457 3300049823 Bacteria 1563
229 Ga0501044_0353618 3300049823 Bacteria 1388
230 nmdc:mga03683_440_c1 3300050489 Bacteria 11977
231 nmdc:mga03683_66527_c1 3300050489 Bacteria 1532
232 nmdc:mga00v17_1889_c1 3300050491 Bacteria 10846
233 nmdc:mga00v17_26695_c1 3300050491 Bacteria 3368
234 nmdc:mga0yw44_149646_c1 3300050492 Bacteria 1522
235 nmdc:mga06z11_588_c1 3300050494 Bacteria 13299
236 nmdc:mga04h51_80_c1 3300050495 Bacteria 31181
237 nmdc:mga07m45_39150_c2 3300050496 Bacteria 1560
238 nmdc:mga0sz30_64284_c1 3300050516 Bacteria 1572
239 Ga0500643_000001 3300053087 Bacteria 1440111
240 Ga0500641_0054470 3300053096 Bacteria 1654
241 Ga0500607_000781 3300053121 Bacteria 30691
242 Ga0500607_006304 3300053121 Bacteria 7535
243 Ga0500608_000150 3300053122 Bacteria 29081
244 Ga0500618_010164 3300053125 Bacteria 2533
245 Ga0500564_000930 3300053138 Bacteria 9471
246 Ga0500616_0003006 3300053153 Bacteria 13309
247 Ga0500622_0002564 3300053156 Bacteria 13016
248 Ga0500567_006462 3300053723 Bacteria 5478
249 Ga0500625_000002 3300053729 Bacteria 371909
250 Ga0500661_019245 3300055283 Bacteria 1216
251 2511128764 2510917021 Bacteria 5705459
252 2643949893 2643221588 Bacteria 3692460
253 2738709963 2738541275 Bacteria 4830863
254 2738848388 2738541301 Bacteria 4834102
255 2738864117 2738541304 Bacteria 4833665
256 2739296635 2738543022 Bacteria 4835059
257 2739358313 2738543033 Bacteria 4833336
258 2739652028 2739367664 Bacteria 4114334
259 2740030502 2739367865 Bacteria 4114482
260 2819553111 2818991438 Bacteria 5793701
261 2848298311 2848297114 Bacteria 3608511
262 2882808066 2882806704 Bacteria 3007728
263 2895883120 2895880812 Bacteria 11255272
264 2896254869 2896253425 Bacteria 3418029
265 2919140105 2919138771 Bacteria 5281312
266 2928101511 2928100450 Bacteria 4837635
267 2928960076 2928959182 Bacteria 4725774
268 3000865923 3000865235 Bacteria 3106258
269 8054305849 8054302542 Bacteria 5698134
270 Ga0207690_10258828
271 SwRhRL2b_contig_2631586
272 Ga0065704_10070209
273 Ga0070658_10000475
274 Ga0070658_10015369
275 Ga0070683_100007087
276 Ga0070683_100131729
277 Ga0070670_100084104
278 Ga0070666_10007981
279 Ga0070680_100019415
280 Ga0070660_100000138
281 Ga0070660_100048247
282 Ga0070661_100081825
283 Ga0070668_100053850
284 Ga0070668_100247106
285 Ga0070669_100000334
286 Ga0070669_100031199
287 Ga0070671_100000138
288 Ga0070671_100017934
289 Ga0070659_100000634
290 Ga0070659_100056103
291 Ga0070659_100097696
292 Ga0070667_100000268
293 Ga0070667_100001422
294 Ga0070667_100028721
295 Ga0070667_100058568
296 Ga0070662_100000168
297 Ga0070662_100084220
298 Ga0070681_10002123
299 Ga0070679_100002413
300 Ga0070679_100040649
301 Ga0068853_100000481
302 Ga0070665_100009828
303 Ga0070665_100018020
304 Ga0068855_100001485
305 Ga0068855_100030457
306 Ga0068855_100113903
307 Ga0068855_100181560
308 Ga0070664_100003332
309 Ga0070664_100179185
310 Ga0068857_100016239
311 Ga0068857_100018423
312 Ga0068857_100049930
313 Ga0068854_100006417
314 Ga0068854_100008028
315 Ga0068854_100026256
316 Ga0068852_100000148
317 Ga0068864_100013691
318 Ga0068851_10054277
319 Ga0068863_100001327
320 Ga0068863_100023720
321 Ga0068863_100031736
322 Ga0068858_100011578
323 Ga0068860_100000007
324 Ga0068860_100003664
325 Ga0068860_100024880
326 Ga0068860_100128742
327 Ga0068860_100218690
328 Ga0068862_100008452
329 Ga0068862_100097150
330 Ga0068862_100147968
331 Ga0075365_10032560
332 Ga0075368_10001034
333 Ga0075364_10002252
334 Ga0075362_10006060
335 Ga0075362_10093786
336 Ga0075367_10003627
337 Ga0075366_10018788
338 Ga0105251_10008601
339 Ga0105240_10002335
340 Ga0105248_10017512
341 Ga0105248_10087964
342 Ga0105248_10100199
343 Ga0105238_10062257
344 Ga0105246_10000224
345 Ga0157373_10019752
346 Ga0157371_10001911
347 Ga0157371_10182659
348 Ga0157370_10025799
349 Ga0157369_10004179
350 Ga0157369_10241910
351 Ga0163162_10030331
352 Ga0157372_10002839
353 Ga0157372_10410924
354 Ga0157375_10413095
355 Ga0163161_10044371
356 Ga0209050_1000370
357 Ga0207680_10031709
358 Ga0207680_10088192
359 Ga0207705_10000023
360 Ga0207705_10001064
361 Ga0207705_10022620
362 Ga0207705_10029920
363 Ga0207707_10019635
364 Ga0207695_10005422
365 Ga0207657_10000362
366 Ga0207657_10009136
367 Ga0207657_10050407
368 Ga0207657_10149193
369 Ga0207649_10023935
370 Ga0207652_10011632
371 Ga0207652_10028663
372 Ga0207652_10291474
373 Ga0207681_10003860
374 Ga0207681_10004289
375 Ga0207694_10037889
376 Ga0207644_10000005
377 Ga0207644_10014013
378 Ga0207644_10331572
379 Ga0207690_10000733
380 Ga0207706_10018671
381 Ga0207706_10027211
382 Ga0207706_10027241
383 Ga0207711_10006622
384 Ga0207711_10185063
385 Ga0207661_10005453
386 Ga0207679_10004890
387 Ga0207679_10011143
388 Ga0207667_10002972
389 Ga0207667_10148477
390 Ga0207667_10310602
391 Ga0207668_10002245
392 Ga0207668_10328593
393 Ga0207640_10000228
394 Ga0207640_10001698
395 Ga0207640_10026758
396 Ga0207658_10000912
397 Ga0207658_10001021
398 Ga0207658_10083118
399 Ga0207658_10111124
400 Ga0207703_10012950
401 Ga0207639_10006436
402 Ga0207641_10000035
403 Ga0207676_10028374
404 Ga0207676_10132368
405 Ga0207674_10112520
406 Ga0207674_10332724
407 Ga0207674_10404995
408 Ga0207698_10000685
409 Ga0209813_10000064
410 Ga0268266_10001866
411 Ga0268266_10007663
412 Ga0268266_10070533
413 Ga0268265_10006764
414 Ga0268265_10023422
415 Ga0268265_10130946
416 Ga0268264_10000077
417 Ga0268264_10002195
418 Ga0268264_10016382
419 Ga0268264_10097977
420 Ga0268264_10250852
421 Ga0307408_100133312
422 Ga0307508_10005872
423 Ga0307405_10000325
424 Ga0307410_10146881
425 Ga0307410_10236480
426 Ga0307406_10029766
427 Ga0307406_10408306
428 Ga0307412_10102568
429 Ga0307412_10136462
430 Ga0307409_100380447
431 Ga0307416_100315583
432 Ga0307414_10046599
433 Ga0307411_10026792
434 Ga0307415_100200805
435 Ga0307510_10291031
436 Ga0316582_0223704
437 Ga0439462_0014271
438 Ga0495627_000099
439 Ga0495650_0001568
440 Ga0495596_0000113
441 Ga0495596_0000790
442 Ga0495607_0059105
443 Ga0495606_0008910
444 Ga0495606_0065826
445 Ga0495610_0000018
446 Ga0495610_0000750
447 Ga0495610_0001809
448 Ga0495620_0016257
449 Ga0495632_0000758
450 Ga0495632_0018412
451 Ga0495643_0000746
452 Ga0495643_0010107
453 Ga0495643_0017437
454 Ga0495643_0021526
455 Ga0495625_0012169
456 Ga0495681_0000020
457 Ga0495615_0000036
458 Ga0495626_0005162
459 Ga0496100_0087565
460 Ga0496101_0023327
461 Ga0496101_0134238
462 Ga0496103_0020803
463 Ga0496103_0047257
464 Ga0496104_0029253
465 Ga0496105_0000189
466 Ga0496109_0046084
467 Ga0496112_0205532
468 Ga0496113_0005305
469 Ga0496114_0048271
470 Ga0496114_0099439
471 Ga0496116_0000028
472 Ga0496117_0056499
473 Ga0496117_0057618
474 Ga0496118_0008372
475 Ga0496118_0029713
476 Ga0496118_0082167
477 Ga0496121_0000021
478 Ga0496121_0000861
479 Ga0496121_0011638
480 Ga0496122_0001127
481 Ga0496122_0029754
482 Ga0496123_0000705
483 Ga0496123_0001612
484 Ga0496124_0001859
485 Ga0496124_0009095
486 Ga0496124_0061756
487 Ga0496124_0118928
488 Ga0496125_0008127
489 Ga0496125_0012224
490 Ga0496125_0109116
491 Ga0496126_0000079
492 Ga0496126_0025230
493 Ga0496126_0090884
494 Ga0496126_0225975
495 Ga0501034_0145375
496 Ga0501039_0187083
497 Ga0501044_0291457
498 Ga0501044_0353618
499 nmdc:mga03683_440_c1
500 nmdc:mga03683_66527_c1
501 nmdc:mga00v17_1889_c1
502 nmdc:mga00v17_26695_c1
503 nmdc:mga0yw44_149646_c1
504 nmdc:mga06z11_588_c1
505 nmdc:mga04h51_80_c1
506 nmdc:mga07m45_39150_c2
507 nmdc:mga0sz30_64284_c1
508 Ga0500643_000001
509 Ga0500641_0054470
510 Ga0500607_000781
511 Ga0500607_006304
512 Ga0500608_000150
513 Ga0500618_010164
514 Ga0500564_000930
515 Ga0500616_0003006
516 Ga0500622_0002564
517 Ga0500567_006462
518 Ga0500625_000002
519 Ga0500661_019245
520 2511128764
521 2643949893
522 2738709963
523 2738848388
524 2738864117
525 2739296635
526 2739358313
527 2739652028
528 2740030502
529 2819553111
530 2848298311
531 2882808066
532 2895883120
533 2896254869
534 2919140105
535 2928101511
536 2928960076
537 3000865923
538 8054305849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x2d-assembly1.cif.gz_B crystal structure of dnase i domain of ribonuclease e from vibrio cholerae 0.8982 144 241
5f7r-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.8948 1 30
2j4r-assembly2.cif.gz_B structural study of the aquifex aeolicus ppx-gppa enzyme 0.8938 1 28
6x2d-assembly1.cif.gz_A crystal structure of dnase i domain of ribonuclease e from vibrio cholerae 0.8864 144 241
5f7r-assembly1.cif.gz_E rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.8786 1 30
ID Description Score Start End Superfamily
af_Q4CRA5_13_211_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9218 2 30 3.30.420.40
2j4rB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.8938 1 28 3.30.420.150
af_A0A1D6KLZ1_83_208_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8831 144 241 3.30.230.10
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8725 2 28 3.30.420.40
af_Q4DBR1_13_290_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8721 2 30 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A848QN06-F1-model_v4 Ribonuclease 0.9736 1 324 GO:0003723
GO:0016787
AF-A0A845AC68-F1-model_v4 Ribonuclease 0.9718 1 323
AF-A0A848QN06-F1-model_v4 Ribonuclease 0.9706 1 324 GO:0003723
GO:0016787
AF-A0A7M2XA40-F1-model_v4 Ribonuclease E/G 0.9628 1 324 GO:0003723
GO:0016787
AF-A0A7W7AFK3-F1-model_v4 Uncharacterized protein 0.9609 1 324 GO:0003723
GO:0016787

Map