F376282

General Info

Members Datasets Scaffolds Average Seq Length
269 201 538 205

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1000069|Ga0265337_100006921
Length 217
Sequence MGASGEQQGVTFVTLGPEGTCHERAVQNYAAFQGIEDFEMVLLTDFFVGLEMVRETPGTFLVQCSAHPKVHEITEKYWTEVFVVDTFIYPTKHLVVLSRRDVEQPRSLGIVPATKGYVKAELEAGKWGEVIDVASKPLVAEGLSRGDYEAGLTHMEHFEEHPELLRLDLDIGEIDTTWVVYGSEKRFEGDLIGIPSASIYKDAAAEHEPVGAATVAS

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 8.18
Rhizosphere 84.39
Stem 0
Stem Tuber 0
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1000069 3300028556 Bacteria 47825
2 rootH2_10179372 3300003320 Unclassified 1741
3 Ga0058862_12811478 3300004803 Bacteria 2512
4 Ga0070683_100027029 3300005329 Bacteria 5173
5 Ga0070666_10016957 3300005335 Bacteria 4664
6 Ga0070682_100128986 3300005337 Bacteria 1709
7 Ga0070660_100426749 3300005339 Bacteria 1098
8 Ga0070689_100145545 3300005340 Bacteria 1908
9 Ga0070691_10000006 3300005341 Bacteria 66177
10 Ga0070661_100000678 3300005344 Bacteria 24970
11 Ga0070661_100029041 3300005344 Bacteria 3990
12 Ga0070668_100292360 3300005347 Bacteria 1364
13 Ga0070674_100000003 3300005356 Bacteria 258221
14 Ga0070674_100000020 3300005356 Bacteria 88217
15 Ga0070673_100046800 3300005364 Bacteria 3362
16 Ga0070688_100000951 3300005365 Bacteria 14479
17 Ga0070688_100196929 3300005365 Bacteria 1407
18 Ga0070667_100000653 3300005367 Bacteria 33687
19 Ga0070667_100222596 3300005367 Unclassified 1680
20 Ga0070663_100004774 3300005455 Bacteria 7998
21 Ga0070663_100054471 3300005455 Unclassified 2859
22 Ga0068867_100000179 3300005459 Bacteria 41694
23 Ga0070685_10001095 3300005466 Bacteria 14490
24 Ga0070679_100015202 3300005530 Bacteria 7393
25 Ga0070679_100325818 3300005530 Bacteria 1485
26 Ga0070684_100006419 3300005535 Bacteria 9100
27 Ga0068853_100017989 3300005539 Bacteria 5842
28 Ga0068853_100149129 3300005539 Unclassified 2104
29 Ga0070672_100000039 3300005543 Bacteria 57491
30 Ga0070665_100000159 3300005548 Bacteria 122613
31 Ga0070664_100009297 3300005564 Bacteria 7976
32 Ga0068854_100005369 3300005578 Bacteria 8091
33 Ga0068856_100000403 3300005614 Bacteria 47397
34 Ga0068852_100000058 3300005616 Bacteria 75312
35 Ga0068864_100000262 3300005618 Bacteria 47006
36 Ga0068866_10000002 3300005718 Bacteria 394090
37 Ga0068866_10000019 3300005718 Bacteria 64778
38 Ga0068851_10000463 3300005834 Bacteria 17891
39 Ga0068863_100000032 3300005841 Bacteria 172402
40 Ga0068858_100000049 3300005842 Bacteria 122693
41 Ga0081455_10008871 3300005937 Bacteria 10397
42 Ga0081455_10120360 3300005937 Bacteria 2069
43 Ga0081540_1018137 3300005983 Bacteria 4329
44 Ga0070715_10000012 3300006163 Bacteria 173731
45 Ga0075435_100448720 3300007076 Unclassified 1112
46 Ga0105240_10956120 3300009093 Unclassified 918
47 Ga0105245_10006814 3300009098 Bacteria 10022
48 Ga0105245_10023484 3300009098 Bacteria 5413
49 Ga0105242_10106588 3300009176 Bacteria 2382
50 Ga0105237_10101402 3300009545 Bacteria 2871
51 Ga0105238_10000028 3300009551 Bacteria 188361
52 Ga0105238_10619330 3300009551 Unclassified 1091
53 Ga0157371_10009216 3300013102 Bacteria 7789
54 Ga0157370_10011236 3300013104 Bacteria 9388
55 Ga0157370_10063321 3300013104 Unclassified 3504
56 Ga0157370_10274815 3300013104 Bacteria 1556
57 Ga0157369_10001902 3300013105 Bacteria 25182
58 Ga0157369_10073554 3300013105 Bacteria 3667
59 Ga0157374_10001500 3300013296 Bacteria 19673
60 Ga0157374_10032991 3300013296 Bacteria 4721
61 Ga0157374_10660595 3300013296 Unclassified 1057
62 Ga0163162_10276117 3300013306 Unclassified 1812
63 Ga0157372_10010581 3300013307 Bacteria 9815
64 Ga0157375_10046134 3300013308 Bacteria 4246
65 Ga0157375_10052963 3300013308 Bacteria 3991
66 Ga0157375_10317030 3300013308 Unclassified 1724
67 Ga0163163_10039380 3300014325 Unclassified 4612
68 Ga0157380_10037553 3300014326 Bacteria 3754
69 Ga0157379_10686648 3300014968 Bacteria 960
70 Ga0206352_10775527 3300020078 Bacteria 868
71 Ga0207656_10000368 3300025321 Bacteria 15123
72 Ga0207653_10105374 3300025885 Bacteria 1002
73 Ga0207642_10000001 3300025899 Bacteria 714030
74 Ga0207642_10000003 3300025899 Bacteria 650651
75 Ga0207642_10000004 3300025899 Bacteria 407822
76 Ga0207642_10000017 3300025899 Bacteria 64774
77 Ga0207680_10011937 3300025903 Bacteria 4410
78 Ga0207685_10000001 3300025905 Bacteria 604473
79 Ga0207705_10031067 3300025909 Unclassified 3811
80 Ga0207695_10889160 3300025913 Unclassified 770
81 Ga0207693_10003069 3300025915 Bacteria 14406
82 Ga0207663_10015627 3300025916 Bacteria 4192
83 Ga0207649_10000308 3300025920 Bacteria 37444
84 Ga0207649_10131041 3300025920 Unclassified 1703
85 Ga0207652_10000480 3300025921 Bacteria 40915
86 Ga0207652_10521599 3300025921 Bacteria 1069
87 Ga0207694_10000008 3300025924 Bacteria 484902
88 Ga0207650_10047404 3300025925 Bacteria 3167
89 Ga0207687_10000011 3300025927 Bacteria 388349
90 Ga0207700_10000009 3300025928 Bacteria 314953
91 Ga0207664_10049490 3300025929 Unclassified 3309
92 Ga0207686_10048557 3300025934 Bacteria 2630
93 Ga0207709_10028829 3300025935 Bacteria 3212
94 Ga0207669_10000016 3300025937 Bacteria 124532
95 Ga0207669_10000036 3300025937 Bacteria 78568
96 Ga0207691_10000199 3300025940 Bacteria 57652
97 Ga0207661_10004465 3300025944 Bacteria 9830
98 Ga0207679_10008708 3300025945 Bacteria 6470
99 Ga0207651_10111878 3300025960 Bacteria 2051
100 Ga0207668_10244257 3300025972 Unclassified 1454
101 Ga0207640_10000059 3300025981 Bacteria 90901
102 Ga0207658_10003290 3300025986 Bacteria 11469
103 Ga0207658_10341056 3300025986 Bacteria 1302
104 Ga0207677_10000723 3300026023 Bacteria 19330
105 Ga0207703_10000067 3300026035 Bacteria 125623
106 Ga0207639_10001160 3300026041 Bacteria 17875
107 Ga0207639_10132599 3300026041 Unclassified 2065
108 Ga0207678_10002034 3300026067 Bacteria 18333
109 Ga0207702_10000027 3300026078 Bacteria 183792
110 Ga0207702_10016146 3300026078 Bacteria 6181
111 Ga0207641_10000071 3300026088 Bacteria 151812
112 Ga0207648_10000228 3300026089 Bacteria 60032
113 Ga0207676_10000038 3300026095 Bacteria 171492
114 Ga0207683_10022998 3300026121 Bacteria 5357
115 Ga0207698_10000002 3300026142 Bacteria 404991
116 Ga0207698_10005416 3300026142 Bacteria 7886
117 Ga0268266_10000023 3300028379 Bacteria 501899
118 Ga0268264_10019511 3300028381 Bacteria 5539
119 Ga0265326_10000012 3300028558 Bacteria 175352
120 Ga0265322_10000003 3300028654 Bacteria 468671
121 Ga0265336_10007249 3300028666 Bacteria 3949
122 Ga0265324_10000398 3300029957 Bacteria 31535
123 Ga0307511_10041159 3300030521 Bacteria 3907
124 Ga0265320_10000001 3300031240 Bacteria 847191
125 Ga0265329_10002598 3300031242 Bacteria 8143
126 Ga0265331_10002571 3300031250 Bacteria 12205
127 Ga0265327_10000003 3300031251 Bacteria 852750
128 Ga0265316_10098767 3300031344 Bacteria 2221
129 Ga0265314_10000044 3300031711 Bacteria 207337
130 Ga0451845_0476418 3300041501 Bacteria 854
131 Ga0466963_0086775 3300044694 Unclassified 2127
132 Ga0466957_0071558 3300044842 Bacteria 2145
133 Ga0495603_0025212 3300046455 Bacteria 3596
134 Ga0495603_0355969 3300046455 Bacteria 840
135 Ga0495629_0000384 3300046459 Bacteria 36987
136 Ga0495629_0022139 3300046459 Bacteria 4532
137 Ga0495651_0182950 3300046462 Bacteria 1482
138 Ga0495582_0000005 3300046473 Bacteria 156170
139 Ga0495662_0000022 3300046476 Bacteria 54342
140 Ga0495662_0006260 3300046476 Bacteria 5950
141 Ga0495594_0000004 3300046499 Bacteria 195881
142 Ga0495608_0000001 3300046511 Bacteria 411278
143 Ga0495618_0000068 3300046514 Bacteria 74614
144 Ga0495620_0000315 3300046515 Bacteria 34463
145 Ga0495628_0000454 3300046516 Bacteria 37425
146 Ga0495628_0005324 3300046516 Bacteria 11286
147 Ga0495628_0028015 3300046516 Bacteria 4582
148 Ga0495628_0072367 3300046516 Bacteria 2686
149 Ga0495630_0002355 3300046517 Bacteria 13106
150 Ga0495644_0000954 3300046523 Bacteria 11954
151 Ga0495652_0000066 3300046529 Bacteria 109895
152 Ga0495587_0001931 3300046536 Bacteria 13803
153 Ga0495587_0042478 3300046536 Bacteria 2711
154 Ga0495598_0000907 3300046537 Bacteria 5706
155 Ga0495622_0000016 3300046557 Bacteria 177089
156 Ga0495667_0000015 3300046559 Bacteria 200377
157 Ga0495634_0548363 3300046642 Bacteria 674
158 Ga0495625_0000020 3300046660 Bacteria 290440
159 Ga0495635_0000009 3300046663 Bacteria 259024
160 Ga0495588_0000240 3300046674 Bacteria 46975
161 Ga0495657_0000002 3300046675 Bacteria 411958
162 Ga0495657_0004915 3300046675 Bacteria 10635
163 Ga0495623_0120355 3300046679 Unclassified 1581
164 Ga0495647_0000724 3300046681 Bacteria 9761
165 Ga0495647_0118292 3300046681 Unclassified 1112
166 Ga0495658_0000019 3300046683 Bacteria 91606
167 Ga0495613_0000185 3300046689 Bacteria 60963
168 Ga0495613_0000249 3300046689 Bacteria 50975
169 Ga0495624_0000135 3300046690 Bacteria 52614
170 Ga0495624_0055606 3300046690 Bacteria 2492
171 Ga0495670_0106340 3300046691 Bacteria 1449
172 Ga0495600_0083327 3300046809 Unclassified 2087
173 Ga0495604_0000771 3300047317 Bacteria 26951
174 Ga0495604_0116101 3300047317 Unclassified 1944
175 Ga0495672_0071992 3300047320 Bacteria 1954
176 Ga0495676_0000809 3300047321 Bacteria 26167
177 Ga0495676_0164611 3300047321 Bacteria 1566
178 Ga0495676_0398486 3300047321 Bacteria 914
179 Ga0495680_0000023 3300047322 Bacteria 116444
180 Ga0495680_0013737 3300047322 Bacteria 7048
181 Ga0495680_0063026 3300047322 Bacteria 2848
182 Ga0495675_0000046 3300047444 Bacteria 82596
183 Ga0495675_0014044 3300047444 Bacteria 5062
184 Ga0495673_0062580 3300047469 Bacteria 1589
185 Ga0495684_0167988 3300047471 Bacteria 1633
186 Ga0495686_0019239 3300047472 Bacteria 4566
187 Ga0495602_0000010 3300048088 Bacteria 212121
188 Ga0495602_0001039 3300048088 Bacteria 27067
189 Ga0496101_0146790 3300048904 Unclassified 1801
190 Ga0496103_0120837 3300048906 Bacteria 1668
191 Ga0496104_0158221 3300048907 Unclassified 2174
192 Ga0496104_0175066 3300048907 Unclassified 2056
193 Ga0496105_0092427 3300048908 Unclassified 2498
194 Ga0496106_0000013 3300048909 Bacteria 202263
195 Ga0496106_0053546 3300048909 Bacteria 3048
196 Ga0496107_0053573 3300048910 Bacteria 2910
197 Ga0496107_0125200 3300048910 Bacteria 1895
198 Ga0496108_0000024 3300048911 Bacteria 183389
199 Ga0496109_0000033 3300048912 Bacteria 160496
200 Ga0496110_0000128 3300048913 Bacteria 43226
201 Ga0496110_0006319 3300048913 Bacteria 9358
202 Ga0496110_0017994 3300048913 Bacteria 5919
203 Ga0496111_0000022 3300048914 Bacteria 66777
204 Ga0496111_0062644 3300048914 Unclassified 2697
205 Ga0496112_0000002 3300048915 Bacteria 782039
206 Ga0496113_0000038 3300048916 Bacteria 56379
207 Ga0496114_0000010 3300048917 Bacteria 363396
208 Ga0496114_0087349 3300048917 Unclassified 2644
209 Ga0496115_0000088 3300048918 Bacteria 86213
210 Ga0496115_0127757 3300048918 Bacteria 2095
211 Ga0496118_0073541 3300048921 Bacteria 2448
212 Ga0496118_0244874 3300048921 Bacteria 1023
213 Ga0496119_0002276 3300048922 Bacteria 21277
214 Ga0496119_0007144 3300048922 Bacteria 10128
215 Ga0496119_0032777 3300048922 Unclassified 3458
216 Ga0496119_0033074 3300048922 Bacteria 3437
217 Ga0496120_0017258 3300048923 Bacteria 4687
218 Ga0496121_0006671 3300048924 Bacteria 14199
219 Ga0496121_0016296 3300048924 Bacteria 7684
220 Ga0496121_0061106 3300048924 Unclassified 3094
221 Ga0496121_0346139 3300048924 Bacteria 992
222 Ga0496124_0169129 3300048927 Bacteria 1695
223 Ga0496125_0126068 3300048928 Unclassified 1814
224 Ga0496126_0028104 3300048929 Bacteria 5363
225 Ga0496126_0035073 3300048929 Bacteria 4704
226 Ga0501031_0000044 3300049568 Bacteria 67192
227 Ga0501032_0000300 3300049569 Bacteria 41595
228 Ga0501033_0000393 3300049570 Bacteria 42051
229 Ga0501034_0000867 3300049571 Bacteria 44681
230 Ga0501034_0003292 3300049571 Bacteria 18452
231 Ga0501036_0003202 3300049572 Bacteria 13071
232 Ga0501037_0000305 3300049573 Bacteria 41631
233 Ga0501038_0000310 3300049574 Bacteria 41581
234 Ga0501039_0020751 3300049575 Bacteria 5035
235 Ga0501040_0080472 3300049576 Bacteria 2257
236 Ga0501043_0000350 3300049579 Bacteria 41992
237 Ga0501046_0000166 3300049580 Bacteria 67210
238 Ga0501047_0000512 3300049581 Bacteria 41820
239 Ga0501048_0000160 3300049582 Bacteria 41743
240 Ga0501067_0076124 3300049583 Bacteria 1859
241 Ga0501067_0165709 3300049583 Bacteria 1231
242 Ga0501068_0000214 3300049584 Bacteria 27988
243 Ga0501069_0000257 3300049585 Bacteria 24074
244 Ga0501070_0004054 3300049586 Bacteria 12587
245 Ga0501071_0000378 3300049587 Bacteria 21934
246 Ga0501072_0105915 3300049588 Unclassified 2236
247 Ga0501073_0002542 3300049589 Bacteria 13631
248 Ga0501074_0000153 3300049590 Bacteria 35898
249 Ga0501075_0007396 3300049591 Bacteria 7619
250 Ga0501076_0103102 3300049592 Bacteria 2301
251 Ga0501079_0000638 3300049741 Bacteria 23335
252 Ga0501080_0001105 3300049742 Bacteria 22223
253 Ga0501083_0000324 3300049744 Bacteria 30319
254 Ga0501083_0015691 3300049744 Bacteria 5302
255 Ga0501035_0000545 3300049822 Bacteria 41853
256 Ga0501044_0000653 3300049823 Bacteria 41929
257 Ga0501044_0019455 3300049823 Bacteria 7264
258 Ga0501045_0009337 3300049824 Bacteria 6856
259 nmdc:mga0rr50_425378_c1 3300050513 Unclassified 1124
260 Ga0495601_0000012 3300053077 Bacteria 227853
261 Ga0495655_0001608 3300053083 Bacteria 3482
262 Ga0495595_0000001 3300053084 Bacteria 495226
263 Ga0495595_0007924 3300053084 Bacteria 4350
264 Ga0495619_0000120 3300053085 Bacteria 58265
265 Ga0495619_0016464 3300053085 Bacteria 4680
266 Ga0500566_0013018 3300053094 Bacteria 4903
267 Ga0500616_0003135 3300053153 Bacteria 12925
268 Ga0501084_0080162 3300054114 Unclassified 2737
269 Ga0501082_0027989 3300060353 Unclassified 4855
270 Ga0265337_1000069
271 rootH2_10179372
272 Ga0058862_12811478
273 Ga0070683_100027029
274 Ga0070666_10016957
275 Ga0070682_100128986
276 Ga0070660_100426749
277 Ga0070689_100145545
278 Ga0070691_10000006
279 Ga0070661_100000678
280 Ga0070661_100029041
281 Ga0070668_100292360
282 Ga0070674_100000003
283 Ga0070674_100000020
284 Ga0070673_100046800
285 Ga0070688_100000951
286 Ga0070688_100196929
287 Ga0070667_100000653
288 Ga0070667_100222596
289 Ga0070663_100004774
290 Ga0070663_100054471
291 Ga0068867_100000179
292 Ga0070685_10001095
293 Ga0070679_100015202
294 Ga0070679_100325818
295 Ga0070684_100006419
296 Ga0068853_100017989
297 Ga0068853_100149129
298 Ga0070672_100000039
299 Ga0070665_100000159
300 Ga0070664_100009297
301 Ga0068854_100005369
302 Ga0068856_100000403
303 Ga0068852_100000058
304 Ga0068864_100000262
305 Ga0068866_10000002
306 Ga0068866_10000019
307 Ga0068851_10000463
308 Ga0068863_100000032
309 Ga0068858_100000049
310 Ga0081455_10008871
311 Ga0081455_10120360
312 Ga0081540_1018137
313 Ga0070715_10000012
314 Ga0075435_100448720
315 Ga0105240_10956120
316 Ga0105245_10006814
317 Ga0105245_10023484
318 Ga0105242_10106588
319 Ga0105237_10101402
320 Ga0105238_10000028
321 Ga0105238_10619330
322 Ga0157371_10009216
323 Ga0157370_10011236
324 Ga0157370_10063321
325 Ga0157370_10274815
326 Ga0157369_10001902
327 Ga0157369_10073554
328 Ga0157374_10001500
329 Ga0157374_10032991
330 Ga0157374_10660595
331 Ga0163162_10276117
332 Ga0157372_10010581
333 Ga0157375_10046134
334 Ga0157375_10052963
335 Ga0157375_10317030
336 Ga0163163_10039380
337 Ga0157380_10037553
338 Ga0157379_10686648
339 Ga0206352_10775527
340 Ga0207656_10000368
341 Ga0207653_10105374
342 Ga0207642_10000001
343 Ga0207642_10000003
344 Ga0207642_10000004
345 Ga0207642_10000017
346 Ga0207680_10011937
347 Ga0207685_10000001
348 Ga0207705_10031067
349 Ga0207695_10889160
350 Ga0207693_10003069
351 Ga0207663_10015627
352 Ga0207649_10000308
353 Ga0207649_10131041
354 Ga0207652_10000480
355 Ga0207652_10521599
356 Ga0207694_10000008
357 Ga0207650_10047404
358 Ga0207687_10000011
359 Ga0207700_10000009
360 Ga0207664_10049490
361 Ga0207686_10048557
362 Ga0207709_10028829
363 Ga0207669_10000016
364 Ga0207669_10000036
365 Ga0207691_10000199
366 Ga0207661_10004465
367 Ga0207679_10008708
368 Ga0207651_10111878
369 Ga0207668_10244257
370 Ga0207640_10000059
371 Ga0207658_10003290
372 Ga0207658_10341056
373 Ga0207677_10000723
374 Ga0207703_10000067
375 Ga0207639_10001160
376 Ga0207639_10132599
377 Ga0207678_10002034
378 Ga0207702_10000027
379 Ga0207702_10016146
380 Ga0207641_10000071
381 Ga0207648_10000228
382 Ga0207676_10000038
383 Ga0207683_10022998
384 Ga0207698_10000002
385 Ga0207698_10005416
386 Ga0268266_10000023
387 Ga0268264_10019511
388 Ga0265326_10000012
389 Ga0265322_10000003
390 Ga0265336_10007249
391 Ga0265324_10000398
392 Ga0307511_10041159
393 Ga0265320_10000001
394 Ga0265329_10002598
395 Ga0265331_10002571
396 Ga0265327_10000003
397 Ga0265316_10098767
398 Ga0265314_10000044
399 Ga0451845_0476418
400 Ga0466963_0086775
401 Ga0466957_0071558
402 Ga0495603_0025212
403 Ga0495603_0355969
404 Ga0495629_0000384
405 Ga0495629_0022139
406 Ga0495651_0182950
407 Ga0495582_0000005
408 Ga0495662_0000022
409 Ga0495662_0006260
410 Ga0495594_0000004
411 Ga0495608_0000001
412 Ga0495618_0000068
413 Ga0495620_0000315
414 Ga0495628_0000454
415 Ga0495628_0005324
416 Ga0495628_0028015
417 Ga0495628_0072367
418 Ga0495630_0002355
419 Ga0495644_0000954
420 Ga0495652_0000066
421 Ga0495587_0001931
422 Ga0495587_0042478
423 Ga0495598_0000907
424 Ga0495622_0000016
425 Ga0495667_0000015
426 Ga0495634_0548363
427 Ga0495625_0000020
428 Ga0495635_0000009
429 Ga0495588_0000240
430 Ga0495657_0000002
431 Ga0495657_0004915
432 Ga0495623_0120355
433 Ga0495647_0000724
434 Ga0495647_0118292
435 Ga0495658_0000019
436 Ga0495613_0000185
437 Ga0495613_0000249
438 Ga0495624_0000135
439 Ga0495624_0055606
440 Ga0495670_0106340
441 Ga0495600_0083327
442 Ga0495604_0000771
443 Ga0495604_0116101
444 Ga0495672_0071992
445 Ga0495676_0000809
446 Ga0495676_0164611
447 Ga0495676_0398486
448 Ga0495680_0000023
449 Ga0495680_0013737
450 Ga0495680_0063026
451 Ga0495675_0000046
452 Ga0495675_0014044
453 Ga0495673_0062580
454 Ga0495684_0167988
455 Ga0495686_0019239
456 Ga0495602_0000010
457 Ga0495602_0001039
458 Ga0496101_0146790
459 Ga0496103_0120837
460 Ga0496104_0158221
461 Ga0496104_0175066
462 Ga0496105_0092427
463 Ga0496106_0000013
464 Ga0496106_0053546
465 Ga0496107_0053573
466 Ga0496107_0125200
467 Ga0496108_0000024
468 Ga0496109_0000033
469 Ga0496110_0000128
470 Ga0496110_0006319
471 Ga0496110_0017994
472 Ga0496111_0000022
473 Ga0496111_0062644
474 Ga0496112_0000002
475 Ga0496113_0000038
476 Ga0496114_0000010
477 Ga0496114_0087349
478 Ga0496115_0000088
479 Ga0496115_0127757
480 Ga0496118_0073541
481 Ga0496118_0244874
482 Ga0496119_0002276
483 Ga0496119_0007144
484 Ga0496119_0032777
485 Ga0496119_0033074
486 Ga0496120_0017258
487 Ga0496121_0006671
488 Ga0496121_0016296
489 Ga0496121_0061106
490 Ga0496121_0346139
491 Ga0496124_0169129
492 Ga0496125_0126068
493 Ga0496126_0028104
494 Ga0496126_0035073
495 Ga0501031_0000044
496 Ga0501032_0000300
497 Ga0501033_0000393
498 Ga0501034_0000867
499 Ga0501034_0003292
500 Ga0501036_0003202
501 Ga0501037_0000305
502 Ga0501038_0000310
503 Ga0501039_0020751
504 Ga0501040_0080472
505 Ga0501043_0000350
506 Ga0501046_0000166
507 Ga0501047_0000512
508 Ga0501048_0000160
509 Ga0501067_0076124
510 Ga0501067_0165709
511 Ga0501068_0000214
512 Ga0501069_0000257
513 Ga0501070_0004054
514 Ga0501071_0000378
515 Ga0501072_0105915
516 Ga0501073_0002542
517 Ga0501074_0000153
518 Ga0501075_0007396
519 Ga0501076_0103102
520 Ga0501079_0000638
521 Ga0501080_0001105
522 Ga0501083_0000324
523 Ga0501083_0015691
524 Ga0501035_0000545
525 Ga0501044_0000653
526 Ga0501044_0019455
527 Ga0501045_0009337
528 nmdc:mga0rr50_425378_c1
529 Ga0495601_0000012
530 Ga0495655_0001608
531 Ga0495595_0000001
532 Ga0495595_0007924
533 Ga0495619_0000120
534 Ga0495619_0016464
535 Ga0500566_0013018
536 Ga0500616_0003135
537 Ga0501084_0080162
538 Ga0501082_0027989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.6832 88 157
7w02-assembly1.cif.gz_A cryo-em structure of atp-bound abca3 0.6702 5 62
7s7t-assembly1.cif.gz_A inicsnfr3a nicotine sensor comprising periplasmic binding sequence plus fluorescent sequence with varenicline bound 0.6193 86 174
3hn0-assembly1.cif.gz_A crystal structure of an abc transporter (bdi_1369) from parabacteroides distasonis at 1.75 a resolution 0.6103 1 174
4n6d-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site 0.602 4 173
ID Description Score Start End Superfamily
3vv5A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7685 86 161 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7612 89 157 3.40.190.10
3mwbB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7544 88 162 3.40.190.10
4lubB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7503 4 84 3.40.190.10
2qmwA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7421 6 83 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7G6XQK8-F1-model_v4 LysR family transcriptional regulator 0.944 3 192
AF-A0A2T2ZTH0-F1-model_v4 Uncharacterized protein 0.9325 84 163
AF-A0A7G6XQK8-F1-model_v4 LysR family transcriptional regulator 0.9163 3 192
AF-A0A838V0M2-F1-model_v4 Uncharacterized protein 0.9129 1 199
AF-A0A838V0M2-F1-model_v4 Uncharacterized protein 0.8998 1 199

Map