F376495

General Info

Members Datasets Scaffolds Average Seq Length
269 210 255 115

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0011312|Ga0501031_0011312_1976_2362
Length 128
Sequence MTSSDDMGAPGGSGAPAIDPAVPPSGTGCASCDADGGWWFHLRRCAACGRIGCCDSSPGRHASAHAAATGHPVVRSFEPGEDWFWDYAREQYVEQGPQLAAPQSHPADQAVPGPSDRVPPDWRDRLNR

Samples

Sample ID Description Type Environment
1 2643221613 Oerskovia sp. Root22 Isolate Unclassified
2 2643221620 Nocardioides sp. Root240 Isolate Unclassified
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
5 2643221721 Oerskovia sp. Root918 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2738541305 Nocardioides sp. CF167 Isolate Unclassified
8 2739367898 Nocardioides sp. CF479 Isolate Unclassified
9 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
10 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
11 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
12 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
123 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
210 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 1.49
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0.37
Rhizoplane 8.92
Rhizosphere 75.46
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10105490 3300005288 Bacteria 1565
2 Ga0070658_11357493 3300005327 Bacteria 617
3 Ga0070683_100446602 3300005329 Bacteria 1234
4 Ga0070682_100436737 3300005337 Bacteria 999
5 Ga0070660_100456866 3300005339 Bacteria 1060
6 Ga0070689_101728054 3300005340 Bacteria 570
7 Ga0070668_100087386 3300005347 Bacteria 2453
8 Ga0070674_100874640 3300005356 Bacteria 781
9 Ga0070674_101470873 3300005356 Bacteria 612
10 Ga0070688_101093544 3300005365 Bacteria 637
11 Ga0070709_10254820 3300005434 Bacteria 1266
12 Ga0070709_10664240 3300005434 Bacteria 808
13 Ga0070714_100013261 3300005435 Bacteria 6599
14 Ga0070714_100163068 3300005435 Bacteria 2018
15 Ga0070713_100006733 3300005436 Bacteria 8003
16 Ga0070710_10033354 3300005437 Bacteria 2796
17 Ga0070711_100759655 3300005439 Bacteria 820
18 Ga0070663_102051945 3300005455 Bacteria 515
19 Ga0070678_100755295 3300005456 Bacteria 880
20 Ga0070678_101376628 3300005456 Bacteria 658
21 Ga0070706_100120536 3300005467 Bacteria 2445
22 Ga0070684_100370299 3300005535 Bacteria 1319
23 Ga0070672_101477836 3300005543 Bacteria 609
24 Ga0070665_100044756 3300005548 Bacteria 4444
25 Ga0068855_101433382 3300005563 Bacteria 711
26 Ga0070664_100391342 3300005564 Bacteria 1270
27 Ga0068857_100799553 3300005577 Bacteria 900
28 Ga0068852_101506504 3300005616 Bacteria 695
29 Ga0068864_100001367 3300005618 Bacteria 20249
30 Ga0068863_100879414 3300005841 Bacteria 896
31 Ga0068858_100775522 3300005842 Bacteria 935
32 Ga0081455_10111834 3300005937 Bacteria 2169
33 Ga0070717_11707807 3300006028 Bacteria 570
34 Ga0075365_10208338 3300006038 Bacteria 1370
35 Ga0075365_10476804 3300006038 Bacteria 881
36 Ga0075365_10890647 3300006038 Bacteria 627
37 Ga0075364_10245521 3300006051 Bacteria 1216
38 Ga0075367_10040181 3300006178 Bacteria 2730
39 Ga0075367_10989699 3300006178 Bacteria 537
40 Ga0097621_102229193 3300006237 Bacteria 524
41 Ga0075370_10178869 3300006353 Bacteria 1248
42 Ga0075428_100310397 3300006844 Bacteria 1695
43 Ga0075428_100815137 3300006844 Bacteria 992
44 Ga0075430_100178334 3300006846 Bacteria 1767
45 Ga0075431_100370934 3300006847 Bacteria 1436
46 Ga0075429_100227318 3300006880 Bacteria 1634
47 Ga0075435_100908524 3300007076 Bacteria 768
48 Ga0105240_12739319 3300009093 Bacteria 508
49 Ga0111539_11269574 3300009094 Bacteria 855
50 Ga0105245_11194031 3300009098 Bacteria 809
51 Ga0114129_10030872 3300009147 Bacteria 7579
52 Ga0114129_10147787 3300009147 Bacteria 3218
53 Ga0105241_11793570 3300009174 Bacteria 599
54 Ga0105248_10053540 3300009177 Bacteria 4528
55 Ga0105238_11370454 3300009551 Bacteria 734
56 Ga0105249_12646900 3300009553 Bacteria 574
57 Ga0157369_10605270 3300013105 Bacteria 1131
58 Ga0163162_10885565 3300013306 Bacteria 1006
59 Ga0157372_10534389 3300013307 Bacteria 1367
60 Ga0157375_11872185 3300013308 Bacteria 712
61 Ga0163163_10006430 3300014325 Bacteria 10270
62 Ga0157377_11328603 3300014745 Bacteria 563
63 Ga0157379_10489722 3300014968 Bacteria 1139
64 Ga0157379_10623095 3300014968 Bacteria 1008
65 Ga0163161_11236020 3300017792 Bacteria 647
66 Ga0206353_10241447 3300020082 Bacteria 872
67 Ga0206353_10458366 3300020082 Bacteria 636
68 Ga0206353_11122694 3300020082 Bacteria 589
69 Ga0206353_11443137 3300020082 Bacteria 1654
70 Ga0213875_10355932 3300021388 Bacteria 696
71 Ga0224572_1023400 3300024225 Unclassified 1187
72 Ga0207692_10189042 3300025898 Bacteria 1204
73 Ga0207699_10222198 3300025906 Bacteria 1290
74 Ga0207699_11299551 3300025906 Bacteria 538
75 Ga0207705_10927581 3300025909 Bacteria 674
76 Ga0207707_10949682 3300025912 Bacteria 708
77 Ga0207693_10542183 3300025915 Bacteria 907
78 Ga0207663_10518808 3300025916 Bacteria 928
79 Ga0207663_10794441 3300025916 Bacteria 753
80 Ga0207662_10100871 3300025918 Bacteria 1788
81 Ga0207657_10147862 3300025919 Bacteria 1915
82 Ga0207700_10652473 3300025928 Bacteria 938
83 Ga0207664_10105586 3300025929 Bacteria 2334
84 Ga0207669_10498234 3300025937 Bacteria 974
85 Ga0207669_10562696 3300025937 Bacteria 922
86 Ga0207665_10559709 3300025939 Bacteria 889
87 Ga0207711_10102565 3300025941 Bacteria 2533
88 Ga0207679_10047733 3300025945 Bacteria 3113
89 Ga0207667_10988195 3300025949 Bacteria 829
90 Ga0207712_10892207 3300025961 Bacteria 785
91 Ga0207703_10542807 3300026035 Bacteria 1095
92 Ga0207641_10219226 3300026088 Bacteria 1763
93 Ga0207676_10019724 3300026095 Bacteria 4924
94 Ga0207674_10161666 3300026116 Bacteria 2193
95 Ga0207683_10420446 3300026121 Bacteria 1231
96 Ga0265356_1016860 3300028017 Unclassified 791
97 Ga0307515_10132458 3300028794 Bacteria 2735
98 Ga0265325_10005990 3300031241 Bacteria 7440
99 Ga0265339_10108921 3300031249 Bacteria 1435
100 Ga0265327_10261733 3300031251 Bacteria 768
101 Ga0265316_10047304 3300031344 Bacteria 3404
102 Ga0265313_10044612 3300031595 Bacteria 2163
103 Ga0316575_10043046 3300031665 Bacteria 1789
104 Ga0316575_10106950 3300031665 Bacteria 1140
105 Ga0316576_10069947 3300031727 Bacteria 2588
106 Ga0307516_10496933 3300031730 Bacteria 874
107 Ga0307413_10358602 3300031824 Bacteria 1128
108 Ga0307413_10917427 3300031824 Bacteria 745
109 Ga0307413_11079134 3300031824 Bacteria 692
110 Ga0307410_10089694 3300031852 Bacteria 2179
111 Ga0307410_10318669 3300031852 Bacteria 1233
112 Ga0326468_10050282 3300031889 Bacteria 629
113 Ga0307409_100112270 3300031995 Bacteria 2288
114 Ga0307409_100930511 3300031995 Bacteria 884
115 Ga0307414_10359745 3300032004 Bacteria 1252
116 Ga0307415_101808993 3300032126 Bacteria 591
117 Ga0307415_101812912 3300032126 Bacteria 591
118 Ga0316574_0081038 3300035398 Bacteria 2061
119 Ga0373947_0117844 3300035725 Bacteria 1685
120 Ga0373937_0680597 3300036401 Bacteria 975
121 Ga0373925_1006008 3300037068 Bacteria 686
122 Ga0395898_0157935 3300037466 Bacteria 2169
123 Ga0395905_1852870 3300037471 Bacteria 509
124 Ga0436364_0258533 3300037853 Bacteria 1968
125 Ga0395901_1156098 3300038443 Bacteria 742
126 Ga0451791_1836936 3300041451 Bacteria 3390
127 Ga0451793_1332788 3300041452 Bacteria 2144
128 Ga0451793_1539198 3300041452 Bacteria 533
129 Ga0451797_1079791 3300041453 Bacteria 646
130 Ga0451807_1259144 3300041486 Bacteria 762
131 Ga0451833_1082831 3300041491 Bacteria 676
132 Ga0451837_1064060 3300041494 Bacteria 2438
133 Ga0451845_0123657 3300041501 Bacteria 1256
134 Ga0451851_0432861 3300041507 Bacteria 649
135 Ga0451855_0697121 3300041511 Bacteria 538
136 Ga0451853_3344155 3300041512 Bacteria 591
137 Ga0450900_032641 3300042136 Bacteria 761
138 Ga0439435_0078660 3300042436 Bacteria 987
139 Ga0466969_0010461 3300044656 Bacteria 4918
140 Ga0466972_0000835 3300044658 Bacteria 14773
141 Ga0466965_0037536 3300044683 Bacteria 2379
142 Ga0466965_0086735 3300044683 Bacteria 1588
143 Ga0466965_0607667 3300044683 Bacteria 622
144 Ga0466966_0176457 3300044684 Bacteria 1297
145 Ga0466961_0014635 3300044693 Bacteria 5039
146 Ga0466971_0024185 3300044719 Bacteria 2710
147 Ga0466971_0259843 3300044719 Bacteria 828
148 Ga0466970_0107082 3300044765 Bacteria 1525
149 Ga0466960_0173512 3300044901 Bacteria 1165
150 Ga0466960_0483601 3300044901 Bacteria 723
151 Ga0466959_0220875 3300045049 Bacteria 1314
152 Ga0466967_1820154 3300045976 Bacteria 606
153 Ga0495629_0054278 3300046459 Bacteria 2803
154 Ga0495629_0186730 3300046459 Bacteria 1436
155 Ga0495651_0396617 3300046462 Bacteria 902
156 Ga0495653_0277732 3300046463 Bacteria 1100
157 Ga0495653_0526454 3300046463 Bacteria 734
158 Ga0495608_0200054 3300046511 Bacteria 1259
159 Ga0495630_0430274 3300046517 Bacteria 1011
160 Ga0495656_0701765 3300046615 Bacteria 544
161 Ga0495635_0339144 3300046663 Bacteria 1004
162 Ga0495658_0332651 3300046683 Bacteria 964
163 Ga0495680_0695350 3300047322 Bacteria 672
164 Ga0496102_0005160 3300048905 Bacteria 11083
165 Ga0496103_0042128 3300048906 Bacteria 2808
166 Ga0496104_0111445 3300048907 Bacteria 2623
167 Ga0496104_1226418 3300048907 Bacteria 653
168 Ga0496105_0123785 3300048908 Bacteria 2131
169 Ga0496108_0398560 3300048911 Bacteria 1202
170 Ga0496108_0554430 3300048911 Bacteria 1002
171 Ga0496108_0732550 3300048911 Bacteria 856
172 Ga0496109_0014732 3300048912 Bacteria 6803
173 Ga0496109_1166169 3300048912 Bacteria 707
174 Ga0496110_0184520 3300048913 Bacteria 1894
175 Ga0496111_0116762 3300048914 Bacteria 1968
176 Ga0496112_0091176 3300048915 Bacteria 3016
177 Ga0496112_0391300 3300048915 Bacteria 1330
178 Ga0496112_1870480 3300048915 Bacteria 512
179 Ga0496113_0004049 3300048916 Bacteria 8928
180 Ga0496113_0719701 3300048916 Bacteria 796
181 Ga0496114_0056861 3300048917 Bacteria 3265
182 Ga0496114_0125436 3300048917 Bacteria 2213
183 Ga0496118_0246583 3300048921 Bacteria 1018
184 Ga0496121_0093955 3300048924 Bacteria 2334
185 Ga0496124_0141632 3300048927 Bacteria 1897
186 Ga0496126_0117425 3300048929 Bacteria 2311
187 Ga0501031_0011312 3300049568 Bacteria 5815
188 Ga0501031_0204267 3300049568 Bacteria 1289
189 Ga0501032_0017873 3300049569 Bacteria 4975
190 Ga0501033_0079266 3300049570 Bacteria 2410
191 Ga0501034_0004496 3300049571 Bacteria 15498
192 Ga0501036_0309171 3300049572 Bacteria 1322
193 Ga0501036_0322576 3300049572 Bacteria 1290
194 Ga0501037_0006849 3300049573 Bacteria 8325
195 Ga0501037_0539649 3300049573 Bacteria 788
196 Ga0501038_0200416 3300049574 Bacteria 1602
197 Ga0501042_0092307 3300049578 Bacteria 2174
198 Ga0501042_0156635 3300049578 Bacteria 1643
199 Ga0501042_0691141 3300049578 Bacteria 742
200 Ga0501042_1412368 3300049578 Bacteria 508
201 Ga0501043_0109769 3300049579 Bacteria 2166
202 Ga0501046_0004510 3300049580 Bacteria 12619
203 Ga0501047_0003281 3300049581 Bacteria 15320
204 Ga0501048_0017499 3300049582 Bacteria 5277
205 Ga0501067_0239688 3300049583 Bacteria 1009
206 Ga0501068_0163838 3300049584 Bacteria 1402
207 Ga0501070_0000727 3300049586 Bacteria 30087
208 Ga0501070_0676832 3300049586 Bacteria 817
209 Ga0501071_0055229 3300049587 Bacteria 2867
210 Ga0501071_0245588 3300049587 Bacteria 1350
211 Ga0501071_0878043 3300049587 Bacteria 692
212 Ga0501072_0039634 3300049588 Bacteria 3698
213 Ga0501072_0352031 3300049588 Bacteria 1169
214 Ga0501072_1304891 3300049588 Bacteria 562
215 Ga0501073_0048050 3300049589 Bacteria 2997
216 Ga0501073_0541592 3300049589 Bacteria 804
217 Ga0501074_0202539 3300049590 Bacteria 1414
218 Ga0501075_0032648 3300049591 Bacteria 3869
219 Ga0501076_0137473 3300049592 Bacteria 1984
220 Ga0501076_0178676 3300049592 Bacteria 1730
221 Ga0501077_0029535 3300049593 Bacteria 3485
222 Ga0501079_0160414 3300049741 Bacteria 1753
223 Ga0501080_0090790 3300049742 Bacteria 2837
224 Ga0501081_0359069 3300049743 Bacteria 1074
225 Ga0501081_1174530 3300049743 Bacteria 581
226 Ga0501083_0304185 3300049744 Bacteria 1037
227 Ga0501035_0001946 3300049822 Bacteria 20676
228 Ga0501035_0004756 3300049822 Bacteria 12892
229 Ga0501044_0002025 3300049823 Bacteria 23362
230 Ga0501045_0848134 3300049824 Bacteria 672
231 nmdc:mga00v17_160056_c1 3300050491 Bacteria 1449
232 nmdc:mga00v17_505894_c1 3300050491 Bacteria 783
233 nmdc:mga0yw44_193231_c1 3300050492 Bacteria 1343
234 nmdc:mga0yw44_415798_c1 3300050492 Bacteria 910
235 nmdc:mga0yw44_807979_c1 3300050492 Bacteria 637
236 nmdc:mga06z11_476008_c1 3300050494 Bacteria 756
237 nmdc:mga07m45_192082_c1 3300050496 Bacteria 1187
238 nmdc:mga05p37_42641_c1 3300050507 Bacteria 5577
239 nmdc:mga05p37_982703_c1 3300050507 Unclassified 899
240 nmdc:mga09592_127860_c1 3300050508 Bacteria 2185
241 nmdc:mga0qj67_44588_c1 3300050509 Bacteria 3496
242 nmdc:mga06r32_288233_c1 3300050510 Bacteria 1629
243 nmdc:mga08y16_1065591_c1 3300050511 Bacteria 785
244 Ga0495601_0614771 3300053077 Bacteria 697
245 Ga0495619_0034558 3300053085 Bacteria 3287
246 Ga0495619_0355826 3300053085 Bacteria 1013
247 Ga0500644_0000271 3300053088 Bacteria 29196
248 Ga0500559_0025241 3300053136 Bacteria 2529
249 Ga0500616_0073657 3300053153 Bacteria 1733
250 Ga0501084_0256694 3300054114 Bacteria 1475
251 Ga0501084_0377238 3300054114 Bacteria 1198
252 Ga0501082_0122259 3300060353 Bacteria 2257
253 Ga0501082_1904711 3300060353 Bacteria 518
254 Ga0466962_0051069 3300061719 Bacteria 1977
255 Ga0530510_0165651 3300061734 Bacteria 1636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100456866 Ga0070660_1004568662 102
2 3300005535 Ga0070684_100370299 Ga0070684_1003702991 102
3 3300020082 Ga0206353_11443137 Ga0206353_114431373 102
4 3300025919 Ga0207657_10147862 Ga0207657_101478623 102
5 3300041511 Ga0451855_0697121 Ga0451855_0697121_30_377 103
6 3300031730 Ga0307516_10496933 Ga0307516_104969332 104
7 3300053088 Ga0500644_0000271 Ga0500644_0000271_14662_14979 105
8 3300041453 Ga0451797_1079791 Ga0451797_1079791_315_635 106
9 3300049578 Ga0501042_1412368 Ga0501042_1412368_85_438 106
10 3300025918 Ga0207662_10100871 Ga0207662_101008712 108
11 3300044765 Ga0466970_0107082 Ga0466970_0107082_234_581 108
12 3300050491 nmdc:mga00v17_160056_c1 nmdc:mga00v17_160056_c1_605_931 108
13 iso_pu_bacteria 2884994152 2884997082 109
14 3300009098 Ga0105245_11194031 Ga0105245_111940311 110
15 3300013307 Ga0157372_10534389 Ga0157372_105343891 110
16 3300014745 Ga0157377_11328603 Ga0157377_113286031 110
17 3300020082 Ga0206353_11122694 Ga0206353_111226942 110
18 3300048911 Ga0496108_0398560 Ga0496108_0398560_26_370 110
19 3300048912 Ga0496109_1166169 Ga0496109_1166169_23_367 110
20 iso_pu_bacteria 2643221620 2644115278 110
21 iso_pu_bacteria 2643221690 2644503932 110
22 iso_pu_bacteria 2643221694 2644527006 110
23 iso_pu_bacteria 2643221722 2644670261 110
24 iso_pu_bacteria 2738541305 2738870250 110
25 iso_pu_bacteria 2739367898 2740168769 110
26 iso_pu_bacteria 2857481737 2857483525 110
27 iso_pu_bacteria 2939582691 2939585043 110
28 iso_pu_bacteria 8033684223 8033688638 110
29 3300005543 Ga0070672_101477836 Ga0070672_1014778361 111
30 3300045976 Ga0466967_1820154 Ga0466967_1820154_231_587 111
31 3300005548 Ga0070665_100044756 Ga0070665_1000447562 112
32 3300020082 Ga0206353_10241447 Ga0206353_102414471 112
33 3300041512 Ga0451853_3344155 Ga0451853_3344155_33_371 112
34 3300005356 Ga0070674_100874640 Ga0070674_1008746402 113
35 3300005356 Ga0070674_101470873 Ga0070674_1014708732 113
36 3300005456 Ga0070678_100755295 Ga0070678_1007552951 113
37 3300006038 Ga0075365_10208338 Ga0075365_102083382 113
38 3300006038 Ga0075365_10476804 Ga0075365_104768042 113
39 3300006051 Ga0075364_10245521 Ga0075364_102455212 113
40 3300006178 Ga0075367_10040181 Ga0075367_100401814 113
41 3300006353 Ga0075370_10178869 Ga0075370_101788692 113
42 3300017792 Ga0163161_11236020 Ga0163161_112360201 113
43 3300025937 Ga0207669_10498234 Ga0207669_104982341 113
44 3300025961 Ga0207712_10892207 Ga0207712_108922072 113
45 3300026121 Ga0207683_10420446 Ga0207683_104204461 113
46 3300031727 Ga0316576_10069947 Ga0316576_100699474 113
47 3300031824 Ga0307413_10917427 Ga0307413_109174272 113
48 3300031889 Ga0326468_10050282 Ga0326468_100502821 113
49 3300031995 Ga0307409_100930511 Ga0307409_1009305112 113
50 3300032004 Ga0307414_10359745 Ga0307414_103597452 113
51 3300032126 Ga0307415_101808993 Ga0307415_1018089931 113
52 3300032126 Ga0307415_101812912 Ga0307415_1018129122 113
53 3300041451 Ga0451791_1836936 Ga0451791_1836936_1467_1808 113
54 3300041491 Ga0451833_1082831 Ga0451833_1082831_131_472 113
55 3300041494 Ga0451837_1064060 Ga0451837_1064060_276_617 113
56 3300048911 Ga0496108_0732550 Ga0496108_0732550_36_377 113
57 3300048917 Ga0496114_0056861 Ga0496114_0056861_2878_3219 113
58 3300049587 Ga0501071_0878043 Ga0501071_0878043_334_675 113
59 3300050491 nmdc:mga00v17_505894_c1 nmdc:mga00v17_505894_c1_227_568 113
60 3300050492 nmdc:mga0yw44_415798_c1 nmdc:mga0yw44_415798_c1_197_538 113
61 3300050494 nmdc:mga06z11_476008_c1 nmdc:mga06z11_476008_c1_338_679 113
62 3300050496 nmdc:mga07m45_192082_c1 nmdc:mga07m45_192082_c1_143_484 113
63 3300053136 Ga0500559_0025241 Ga0500559_0025241_1562_1903 113
64 3300005327 Ga0070658_11357493 Ga0070658_113574931 114
65 3300005329 Ga0070683_100446602 Ga0070683_1004466022 114
66 3300005337 Ga0070682_100436737 Ga0070682_1004367372 114
67 3300005340 Ga0070689_101728054 Ga0070689_1017280541 114
68 3300005434 Ga0070709_10664240 Ga0070709_106642401 114
69 3300005435 Ga0070714_100163068 Ga0070714_1001630682 114
70 3300005439 Ga0070711_100759655 Ga0070711_1007596551 114
71 3300005563 Ga0068855_101433382 Ga0068855_1014333821 114
72 3300005564 Ga0070664_100391342 Ga0070664_1003913421 114
73 3300005577 Ga0068857_100799553 Ga0068857_1007995532 114
74 3300005616 Ga0068852_101506504 Ga0068852_1015065042 114
75 3300005618 Ga0068864_100001367 Ga0068864_1000013675 114
76 3300005841 Ga0068863_100879414 Ga0068863_1008794142 114
77 3300005842 Ga0068858_100775522 Ga0068858_1007755221 114
78 3300006237 Ga0097621_102229193 Ga0097621_1022291931 114
79 3300006844 Ga0075428_100310397 Ga0075428_1003103972 114
80 3300006846 Ga0075430_100178334 Ga0075430_1001783343 114
81 3300006847 Ga0075431_100370934 Ga0075431_1003709343 114
82 3300006880 Ga0075429_100227318 Ga0075429_1002273182 114
83 3300007076 Ga0075435_100908524 Ga0075435_1009085241 114
84 3300009094 Ga0111539_11269574 Ga0111539_112695742 114
85 3300009147 Ga0114129_10030872 Ga0114129_100308728 114
86 3300009177 Ga0105248_10053540 Ga0105248_100535404 114
87 3300009551 Ga0105238_11370454 Ga0105238_113704542 114
88 3300009553 Ga0105249_12646900 Ga0105249_126469001 114
89 3300013105 Ga0157369_10605270 Ga0157369_106052702 114
90 3300013308 Ga0157375_11872185 Ga0157375_118721852 114
91 3300014325 Ga0163163_10006430 Ga0163163_100064305 114
92 3300014968 Ga0157379_10489722 Ga0157379_104897223 114
93 3300014968 Ga0157379_10623095 Ga0157379_106230951 114
94 3300020082 Ga0206353_10458366 Ga0206353_104583662 114
95 3300024225 Ga0224572_1023400 Ga0224572_10234002 114
96 3300025906 Ga0207699_11299551 Ga0207699_112995512 114
97 3300025909 Ga0207705_10927581 Ga0207705_109275811 114
98 3300025912 Ga0207707_10949682 Ga0207707_109496821 114
99 3300025915 Ga0207693_10542183 Ga0207693_105421832 114
100 3300025916 Ga0207663_10518808 Ga0207663_105188082 114
101 3300025937 Ga0207669_10562696 Ga0207669_105626963 114
102 3300025941 Ga0207711_10102565 Ga0207711_101025654 114
103 3300025945 Ga0207679_10047733 Ga0207679_100477332 114
104 3300025949 Ga0207667_10988195 Ga0207667_109881952 114
105 3300026035 Ga0207703_10542807 Ga0207703_105428072 114
106 3300026088 Ga0207641_10219226 Ga0207641_102192265 114
107 3300026095 Ga0207676_10019724 Ga0207676_100197244 114
108 3300026116 Ga0207674_10161666 Ga0207674_101616664 114
109 3300028017 Ga0265356_1016860 Ga0265356_10168602 114
110 3300031824 Ga0307413_11079134 Ga0307413_110791341 114
111 3300031852 Ga0307410_10089694 Ga0307410_100896942 114
112 3300031852 Ga0307410_10318669 Ga0307410_103186692 114
113 3300031995 Ga0307409_100112270 Ga0307409_1001122703 114
114 3300035725 Ga0373947_0117844 Ga0373947_0117844_40_384 114
115 3300037068 Ga0373925_1006008 Ga0373925_1006008_281_625 114
116 3300041452 Ga0451793_1332788 Ga0451793_1332788_1785_2129 114
117 3300042436 Ga0439435_0078660 Ga0439435_0078660_196_549 114
118 3300044683 Ga0466965_0086735 Ga0466965_0086735_650_994 114
119 3300044901 Ga0466960_0173512 Ga0466960_0173512_308_652 114
120 3300046459 Ga0495629_0054278 Ga0495629_0054278_758_1102 114
121 3300046459 Ga0495629_0186730 Ga0495629_0186730_1025_1369 114
122 3300046462 Ga0495651_0396617 Ga0495651_0396617_233_577 114
123 3300046517 Ga0495630_0430274 Ga0495630_0430274_251_595 114
124 3300046663 Ga0495635_0339144 Ga0495635_0339144_604_948 114
125 3300047322 Ga0495680_0695350 Ga0495680_0695350_222_566 114
126 3300048907 Ga0496104_0111445 Ga0496104_0111445_1715_2059 114
127 3300048908 Ga0496105_0123785 Ga0496105_0123785_1599_1943 114
128 3300048911 Ga0496108_0554430 Ga0496108_0554430_536_880 114
129 3300048912 Ga0496109_0014732 Ga0496109_0014732_1209_1553 114
130 3300048913 Ga0496110_0184520 Ga0496110_0184520_65_409 114
131 3300048914 Ga0496111_0116762 Ga0496111_0116762_1290_1634 114
132 3300048915 Ga0496112_0091176 Ga0496112_0091176_918_1262 114
133 3300048915 Ga0496112_0391300 Ga0496112_0391300_474_818 114
134 3300048916 Ga0496113_0004049 Ga0496113_0004049_6935_7279 114
135 3300048916 Ga0496113_0719701 Ga0496113_0719701_349_693 114
136 3300049569 Ga0501032_0017873 Ga0501032_0017873_1692_2045 114
137 3300049570 Ga0501033_0079266 Ga0501033_0079266_1101_1454 114
138 3300049571 Ga0501034_0004496 Ga0501034_0004496_10595_10948 114
139 3300049573 Ga0501037_0006849 Ga0501037_0006849_3010_3363 114
140 3300049574 Ga0501038_0200416 Ga0501038_0200416_64_417 114
141 3300049579 Ga0501043_0109769 Ga0501043_0109769_1761_2114 114
142 3300049580 Ga0501046_0004510 Ga0501046_0004510_10617_10970 114
143 3300049581 Ga0501047_0003281 Ga0501047_0003281_2674_3027 114
144 3300049582 Ga0501048_0017499 Ga0501048_0017499_1333_1686 114
145 3300049586 Ga0501070_0000727 Ga0501070_0000727_28678_29031 114
146 3300049589 Ga0501073_0541592 Ga0501073_0541592_119_472 114
147 3300049822 Ga0501035_0001946 Ga0501035_0001946_5844_6197 114
148 3300049823 Ga0501044_0002025 Ga0501044_0002025_5015_5368 114
149 3300050507 nmdc:mga05p37_42641_c1 nmdc:mga05p37_42641_c1_1051_1395 114
150 3300050508 nmdc:mga09592_127860_c1 nmdc:mga09592_127860_c1_293_637 114
151 3300050509 nmdc:mga0qj67_44588_c1 nmdc:mga0qj67_44588_c1_2047_2391 114
152 3300050510 nmdc:mga06r32_288233_c1 nmdc:mga06r32_288233_c1_235_579 114
153 3300050511 nmdc:mga08y16_1065591_c1 nmdc:mga08y16_1065591_c1_392_745 114
154 3300053085 Ga0495619_0034558 Ga0495619_0034558_162_506 114
155 3300005434 Ga0070709_10254820 Ga0070709_102548202 115
156 3300005435 Ga0070714_100013261 Ga0070714_1000132617 115
157 3300005436 Ga0070713_100006733 Ga0070713_1000067337 115
158 3300005437 Ga0070710_10033354 Ga0070710_100333542 115
159 3300005467 Ga0070706_100120536 Ga0070706_1001205362 115
160 3300005937 Ga0081455_10111834 Ga0081455_101118342 115
161 3300006028 Ga0070717_11707807 Ga0070717_117078072 115
162 3300006178 Ga0075367_10989699 Ga0075367_109896991 115
163 3300006844 Ga0075428_100815137 Ga0075428_1008151372 115
164 3300009093 Ga0105240_12739319 Ga0105240_127393191 115
165 3300009147 Ga0114129_10147787 Ga0114129_101477874 115
166 3300009174 Ga0105241_11793570 Ga0105241_117935701 115
167 3300021388 Ga0213875_10355932 Ga0213875_103559322 115
168 3300025898 Ga0207692_10189042 Ga0207692_101890422 115
169 3300025906 Ga0207699_10222198 Ga0207699_102221982 115
170 3300025916 Ga0207663_10794441 Ga0207663_107944411 115
171 3300025928 Ga0207700_10652473 Ga0207700_106524731 115
172 3300025929 Ga0207664_10105586 Ga0207664_101055861 115
173 3300025939 Ga0207665_10559709 Ga0207665_105597091 115
174 3300031251 Ga0265327_10261733 Ga0265327_102617332 115
175 3300031665 Ga0316575_10043046 Ga0316575_100430463 115
176 3300036401 Ga0373937_0680597 Ga0373937_0680597_499_852 115
177 3300037853 Ga0436364_0258533 Ga0436364_0258533_1015_1362 115
178 3300041486 Ga0451807_1259144 Ga0451807_1259144_330_686 115
179 3300041501 Ga0451845_0123657 Ga0451845_0123657_259_606 115
180 3300041507 Ga0451851_0432861 Ga0451851_0432861_75_422 115
181 3300044656 Ga0466969_0010461 Ga0466969_0010461_1873_2223 115
182 3300044658 Ga0466972_0000835 Ga0466972_0000835_11363_11713 115
183 3300044683 Ga0466965_0037536 Ga0466965_0037536_1506_1856 115
184 3300044683 Ga0466965_0607667 Ga0466965_0607667_134_496 115
185 3300044684 Ga0466966_0176457 Ga0466966_0176457_200_550 115
186 3300044693 Ga0466961_0014635 Ga0466961_0014635_3544_3894 115
187 3300044719 Ga0466971_0024185 Ga0466971_0024185_1964_2314 115
188 3300046463 Ga0495653_0277732 Ga0495653_0277732_60_407 115
189 3300046511 Ga0495608_0200054 Ga0495608_0200054_465_818 115
190 3300046615 Ga0495656_0701765 Ga0495656_0701765_116_496 115
191 3300048905 Ga0496102_0005160 Ga0496102_0005160_7277_7624 115
192 3300048906 Ga0496103_0042128 Ga0496103_0042128_2199_2546 115
193 3300048915 Ga0496112_1870480 Ga0496112_1870480_19_405 115
194 3300048921 Ga0496118_0246583 Ga0496118_0246583_216_563 115
195 3300048924 Ga0496121_0093955 Ga0496121_0093955_1259_1606 115
196 3300049568 Ga0501031_0204267 Ga0501031_0204267_598_945 115
197 3300049572 Ga0501036_0309171 Ga0501036_0309171_787_1134 115
198 3300049573 Ga0501037_0539649 Ga0501037_0539649_24_377 115
199 3300049578 Ga0501042_0691141 Ga0501042_0691141_185_532 115
200 3300049583 Ga0501067_0239688 Ga0501067_0239688_515_862 115
201 3300049584 Ga0501068_0163838 Ga0501068_0163838_173_520 115
202 3300049587 Ga0501071_0245588 Ga0501071_0245588_554_901 115
203 3300049588 Ga0501072_0039634 Ga0501072_0039634_577_924 115
204 3300049589 Ga0501073_0048050 Ga0501073_0048050_348_695 115
205 3300049592 Ga0501076_0137473 Ga0501076_0137473_1184_1531 115
206 3300049593 Ga0501077_0029535 Ga0501077_0029535_3008_3355 115
207 3300049741 Ga0501079_0160414 Ga0501079_0160414_1104_1451 115
208 3300049742 Ga0501080_0090790 Ga0501080_0090790_641_988 115
209 3300049743 Ga0501081_1174530 Ga0501081_1174530_126_473 115
210 3300049744 Ga0501083_0304185 Ga0501083_0304185_439_786 115
211 3300049822 Ga0501035_0004756 Ga0501035_0004756_5425_5778 115
212 3300050507 nmdc:mga05p37_982703_c1 nmdc:mga05p37_982703_c1_230_577 115
213 3300053077 Ga0495601_0614771 Ga0495601_0614771_261_608 115
214 3300053085 Ga0495619_0355826 Ga0495619_0355826_223_576 115
215 3300053153 Ga0500616_0073657 Ga0500616_0073657_643_990 115
216 3300054114 Ga0501084_0377238 Ga0501084_0377238_674_1021 115
217 3300060353 Ga0501082_1904711 Ga0501082_1904711_75_422 115
218 3300061719 Ga0466962_0051069 Ga0466962_0051069_1028_1378 115
219 iso_pu_bacteria 2643221613 2644081399 115
220 iso_pu_bacteria 2643221721 2644664532 115
221 iso_pu_bacteria 2935890801 2935894049 115
222 3300005347 Ga0070668_100087386 Ga0070668_1000873862 116
223 3300005365 Ga0070688_101093544 Ga0070688_1010935442 116
224 3300005455 Ga0070663_102051945 Ga0070663_1020519451 116
225 3300005456 Ga0070678_101376628 Ga0070678_1013766281 116
226 3300006038 Ga0075365_10890647 Ga0075365_108906472 116
227 3300013306 Ga0163162_10885565 Ga0163162_108855652 116
228 3300028794 Ga0307515_10132458 Ga0307515_101324582 116
229 3300031241 Ga0265325_10005990 Ga0265325_100059909 116
230 3300031249 Ga0265339_10108921 Ga0265339_101089211 116
231 3300031344 Ga0265316_10047304 Ga0265316_100473044 116
232 3300031595 Ga0265313_10044612 Ga0265313_100446124 116
233 3300037466 Ga0395898_0157935 Ga0395898_0157935_71_430 116
234 3300037471 Ga0395905_1852870 Ga0395905_1852870_112_474 116
235 3300038443 Ga0395901_1156098 Ga0395901_1156098_192_548 116
236 3300041452 Ga0451793_1539198 Ga0451793_1539198_68_430 116
237 3300044719 Ga0466971_0259843 Ga0466971_0259843_223_594 116
238 3300044901 Ga0466960_0483601 Ga0466960_0483601_353_703 116
239 3300045049 Ga0466959_0220875 Ga0466959_0220875_278_649 116
240 3300046463 Ga0495653_0526454 Ga0495653_0526454_141_503 116
241 3300046683 Ga0495658_0332651 Ga0495658_0332651_464_826 116
242 3300048907 Ga0496104_1226418 Ga0496104_1226418_276_638 116
243 3300048917 Ga0496114_0125436 Ga0496114_0125436_1714_2076 116
244 3300049572 Ga0501036_0322576 Ga0501036_0322576_73_429 116
245 3300049578 Ga0501042_0092307 Ga0501042_0092307_14_367 116
246 3300049578 Ga0501042_0156635 Ga0501042_0156635_371_727 116
247 3300049587 Ga0501071_0055229 Ga0501071_0055229_1449_1802 116
248 3300049588 Ga0501072_0352031 Ga0501072_0352031_589_942 116
249 3300049588 Ga0501072_1304891 Ga0501072_1304891_31_387 116
250 3300049590 Ga0501074_0202539 Ga0501074_0202539_530_883 116
251 3300049591 Ga0501075_0032648 Ga0501075_0032648_2185_2538 116
252 3300049592 Ga0501076_0178676 Ga0501076_0178676_199_555 116
253 3300049743 Ga0501081_0359069 Ga0501081_0359069_711_1064 116
254 3300049824 Ga0501045_0848134 Ga0501045_0848134_154_510 116
255 3300050492 nmdc:mga0yw44_193231_c1 nmdc:mga0yw44_193231_c1_443_793 116
256 3300050492 nmdc:mga0yw44_807979_c1 nmdc:mga0yw44_807979_c1_234_584 116
257 3300054114 Ga0501084_0256694 Ga0501084_0256694_769_1122 116
258 3300060353 Ga0501082_0122259 Ga0501082_0122259_957_1310 116
259 3300061734 Ga0530510_0165651 Ga0530510_0165651_187_543 116
260 iso_pu_bacteria 8054609563 8054611678 116
261 3300005288 Ga0065714_10105490 Ga0065714_101054902 117
262 3300031665 Ga0316575_10106950 Ga0316575_101069502 117
263 3300031824 Ga0307413_10358602 Ga0307413_103586021 117
264 3300035398 Ga0316574_0081038 Ga0316574_0081038_403_756 117
265 3300042136 Ga0450900_032641 Ga0450900_032641_253_633 117
266 3300048927 Ga0496124_0141632 Ga0496124_0141632_1054_1428 117
267 3300048929 Ga0496126_0117425 Ga0496126_0117425_1128_1517 117
268 3300049568 Ga0501031_0011312 Ga0501031_0011312_1976_2362 117
269 3300049586 Ga0501070_0676832 Ga0501070_0676832_335_706 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

29

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fk5-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module 0.8612 31 82
6aqr-assembly1.cif.gz_A saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin 0.8597 31 82
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.856 30 84
6t9l-assembly1.cif.gz_K saga dub module bound to a ubiqitinated nucleosome 0.8346 31 82
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.8223 6 85
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.945 11 82 3.30.40.10
af_Q9GRV2_34_127_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9174 19 84 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9006 31 82 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8865 18 84 3.30.40.10
af_Q9VVR1_1_121_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8792 17 82 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A4R3DAI5-F1-model_v4 deleted 1.007 29 82
AF-A0A841NYZ2-F1-model_v4 deleted 1.002 35 82
AF-A0A541BA33-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9991 8 113 GO:0008270
AF-A0A1X7MXB8-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9988 7 116 GO:0008270
GO:0016787
AF-A0A4P8PUS0-F1-model_v4 UBP-type domain-containing protein 0.9984 8 114 GO:0008270

Feature Viewer

pLDDT pTM Quality
94.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map