F376501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 196 | 538 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0064729|Ga0501034_0064729_1552_2145 |
| Length | 197 |
| Sequence | VVKQDERIEETIVINDIKSDAEKKMKKSLEALHSAFNKIRTGRAHPAILDSVMVNYYGQETPLKQVASVNVEDNRTLTVSPWEKNLVPTIEKAIMTSDLGLNPATSGDLIRVPMPMLTEETRKEMVKQAKADAEHGRVSIRNARRDANSMLKDLLKEKEISEDELRKGEEEVQKLTDKYIAEVEKMLKVKEEDLMAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 35 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 90 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 98 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 99 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 100 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 104 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 110 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 111 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 112 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 113 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 117 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 118 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 119 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 120 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 121 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 122 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 123 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 124 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 125 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 126 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 127 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 128 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 129 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 132 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 149 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 152 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 155 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 163 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 171 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 172 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 173 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 174 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 175 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 176 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 177 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 178 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 179 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 180 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 181 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 182 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 183 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 184 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 185 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 186 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 187 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 188 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 189 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 190 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 191 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 192 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 193 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 194 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 195 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 196 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.59 |
| Metatranscriptomes | 0.74 |
| Isolates | 9.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.23 |
| Nodule | 1.49 |
| Rhizoplane | 4.46 |
| Rhizosphere | 81.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0064729 | 3300049571 | Bacteria | 3670 |
| 2 | SwRhRL2b_contig_694250 | 2162886007 | Bacteria | 830 |
| 3 | Ga0055536_1015857 | 3300003781 | Bacteria | 2553 |
| 4 | Ga0065704_10013472 | 3300005289 | Bacteria | 1993 |
| 5 | Ga0065704_10017555 | 3300005289 | Bacteria | 2085 |
| 6 | Ga0065704_10207776 | 3300005289 | Bacteria | 1120 |
| 7 | Ga0070658_10412364 | 3300005327 | Unclassified | 1161 |
| 8 | Ga0070683_100606539 | 3300005329 | Bacteria | 1048 |
| 9 | Ga0070670_101215321 | 3300005331 | Unclassified | 689 |
| 10 | Ga0070677_10498273 | 3300005333 | Bacteria | 660 |
| 11 | Ga0070666_10011774 | 3300005335 | Bacteria | 5499 |
| 12 | Ga0068868_100782063 | 3300005338 | Unclassified | 860 |
| 13 | Ga0070669_100002436 | 3300005353 | Bacteria | 13474 |
| 14 | Ga0070669_100735430 | 3300005353 | Bacteria | 835 |
| 15 | Ga0070675_100140367 | 3300005354 | Bacteria | 2065 |
| 16 | Ga0070675_100189266 | 3300005354 | Bacteria | 1782 |
| 17 | Ga0070671_100000013 | 3300005355 | Bacteria | 173287 |
| 18 | Ga0070671_100223142 | 3300005355 | Bacteria | 1599 |
| 19 | Ga0070673_100176865 | 3300005364 | Bacteria | 1825 |
| 20 | Ga0070673_100493054 | 3300005364 | Bacteria | 1107 |
| 21 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 22 | Ga0070714_100199047 | 3300005435 | Unclassified | 1832 |
| 23 | Ga0068867_100584671 | 3300005459 | Unclassified | 972 |
| 24 | Ga0070685_10000004 | 3300005466 | Bacteria | 246215 |
| 25 | Ga0070698_100333454 | 3300005471 | Bacteria | 1448 |
| 26 | Ga0070684_101402216 | 3300005535 | Bacteria | 658 |
| 27 | Ga0070672_100930630 | 3300005543 | Bacteria | 769 |
| 28 | Ga0070693_100419604 | 3300005547 | Bacteria | 932 |
| 29 | Ga0070665_100012903 | 3300005548 | Bacteria | 8416 |
| 30 | Ga0068855_100418524 | 3300005563 | Bacteria | 1466 |
| 31 | Ga0070664_100825250 | 3300005564 | Bacteria | 868 |
| 32 | Ga0068852_101130564 | 3300005616 | Unclassified | 804 |
| 33 | Ga0068859_100008974 | 3300005617 | Bacteria | 10098 |
| 34 | Ga0068864_100000072 | 3300005618 | Bacteria | 110066 |
| 35 | Ga0068851_10577655 | 3300005834 | Bacteria | 682 |
| 36 | Ga0068863_100310590 | 3300005841 | Bacteria | 1530 |
| 37 | Ga0068858_100103385 | 3300005842 | Bacteria | 2657 |
| 38 | Ga0068860_100000271 | 3300005843 | Bacteria | 75530 |
| 39 | Ga0068862_100174430 | 3300005844 | Bacteria | 1926 |
| 40 | Ga0068862_100567784 | 3300005844 | Bacteria | 1085 |
| 41 | Ga0075432_10241257 | 3300006058 | Bacteria | 730 |
| 42 | Ga0075369_10304569 | 3300006186 | Unclassified | 744 |
| 43 | Ga0075430_100016037 | 3300006846 | Bacteria | 6380 |
| 44 | Ga0075430_100138881 | 3300006846 | Bacteria | 2024 |
| 45 | Ga0075431_100136364 | 3300006847 | Bacteria | 2530 |
| 46 | Ga0075431_100251713 | 3300006847 | Bacteria | 1795 |
| 47 | Ga0075429_100154318 | 3300006880 | Bacteria | 2011 |
| 48 | Ga0097620_100008974 | 3300006931 | Bacteria | 10098 |
| 49 | Ga0099823_1005145 | 3300006944 | Bacteria | 12975 |
| 50 | Ga0099823_1068167 | 3300006944 | Bacteria | 1647 |
| 51 | Ga0105251_10059083 | 3300009011 | Bacteria | 1809 |
| 52 | Ga0105251_10074057 | 3300009011 | Bacteria | 1582 |
| 53 | Ga0105251_10133606 | 3300009011 | Bacteria | 1124 |
| 54 | Ga0105244_10074262 | 3300009036 | Bacteria | 1692 |
| 55 | Ga0105244_10101110 | 3300009036 | Bacteria | 1410 |
| 56 | Ga0105244_10168068 | 3300009036 | Bacteria | 1045 |
| 57 | Ga0105244_10223832 | 3300009036 | Bacteria | 882 |
| 58 | Ga0105250_10035323 | 3300009092 | Bacteria | 2005 |
| 59 | Ga0105250_10043261 | 3300009092 | Bacteria | 1805 |
| 60 | Ga0105247_10011331 | 3300009101 | Bacteria | 5379 |
| 61 | Ga0114129_11605661 | 3300009147 | Unclassified | 796 |
| 62 | Ga0105243_10274497 | 3300009148 | Bacteria | 1515 |
| 63 | Ga0105243_10274498 | 3300009148 | Bacteria | 1515 |
| 64 | Ga0105248_10279503 | 3300009177 | Bacteria | 1879 |
| 65 | Ga0105238_10648063 | 3300009551 | Bacteria | 1066 |
| 66 | Ga0105238_11112416 | 3300009551 | Bacteria | 813 |
| 67 | Ga0105249_11020408 | 3300009553 | Bacteria | 896 |
| 68 | Ga0105239_10527868 | 3300010375 | Bacteria | 1343 |
| 69 | Ga0105239_11314459 | 3300010375 | Bacteria | 834 |
| 70 | Ga0157373_10232034 | 3300013100 | Bacteria | 1303 |
| 71 | Ga0157373_11006921 | 3300013100 | Bacteria | 622 |
| 72 | Ga0157370_10020234 | 3300013104 | Bacteria | 6649 |
| 73 | Ga0157370_10342646 | 3300013104 | Bacteria | 1378 |
| 74 | Ga0157374_10585390 | 3300013296 | Unclassified | 1125 |
| 75 | Ga0157378_10738694 | 3300013297 | Bacteria | 1006 |
| 76 | Ga0157372_10003896 | 3300013307 | Bacteria | 16036 |
| 77 | Ga0157372_10066438 | 3300013307 | Bacteria | 4052 |
| 78 | Ga0157372_10121025 | 3300013307 | Bacteria | 3006 |
| 79 | Ga0157372_10900707 | 3300013307 | Bacteria | 1026 |
| 80 | Ga0157372_11031611 | 3300013307 | Bacteria | 952 |
| 81 | Ga0163163_10000118 | 3300014325 | Bacteria | 84379 |
| 82 | Ga0157379_10169488 | 3300014968 | Bacteria | 1971 |
| 83 | Ga0207425_1020932 | 3300025245 | Bacteria | 1392 |
| 84 | Ga0209676_1000916 | 3300025292 | Bacteria | 36772 |
| 85 | Ga0207696_1000164 | 3300025711 | Bacteria | 106057 |
| 86 | Ga0207696_1010206 | 3300025711 | Bacteria | 3458 |
| 87 | Ga0207696_1012464 | 3300025711 | Bacteria | 3005 |
| 88 | Ga0207655_1001759 | 3300025728 | Bacteria | 18987 |
| 89 | Ga0207655_1033908 | 3300025728 | Bacteria | 2305 |
| 90 | Ga0207655_1056555 | 3300025728 | Bacteria | 1546 |
| 91 | Ga0207655_1059725 | 3300025728 | Bacteria | 1482 |
| 92 | Ga0207655_1079754 | 3300025728 | Bacteria | 1185 |
| 93 | Ga0207713_1011826 | 3300025735 | Bacteria | 4712 |
| 94 | Ga0207713_1035852 | 3300025735 | Bacteria | 2136 |
| 95 | Ga0207713_1057409 | 3300025735 | Bacteria | 1505 |
| 96 | Ga0207682_10015463 | 3300025893 | Bacteria | 2970 |
| 97 | Ga0207710_10186969 | 3300025900 | Bacteria | 1019 |
| 98 | Ga0207680_10038697 | 3300025903 | Bacteria | 2762 |
| 99 | Ga0207645_10259444 | 3300025907 | Unclassified | 1151 |
| 100 | Ga0207705_10378644 | 3300025909 | Unclassified | 1093 |
| 101 | Ga0207681_10002041 | 3300025923 | Bacteria | 12952 |
| 102 | Ga0207694_10832429 | 3300025924 | Unclassified | 780 |
| 103 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 104 | Ga0207650_10887222 | 3300025925 | Unclassified | 757 |
| 105 | Ga0207659_10400264 | 3300025926 | Bacteria | 1148 |
| 106 | Ga0207659_10858604 | 3300025926 | Bacteria | 780 |
| 107 | Ga0207664_10129878 | 3300025929 | Bacteria | 2120 |
| 108 | Ga0207644_10000015 | 3300025931 | Bacteria | 179880 |
| 109 | Ga0207644_10191736 | 3300025931 | Bacteria | 1607 |
| 110 | Ga0207706_10349531 | 3300025933 | Bacteria | 1286 |
| 111 | Ga0207709_10178142 | 3300025935 | Bacteria | 1499 |
| 112 | Ga0207709_10200555 | 3300025935 | Bacteria | 1425 |
| 113 | Ga0207669_10056495 | 3300025937 | Bacteria | 2384 |
| 114 | Ga0207691_10473276 | 3300025940 | Bacteria | 1065 |
| 115 | Ga0207711_10000103 | 3300025941 | Bacteria | 90172 |
| 116 | Ga0207711_10000277 | 3300025941 | Bacteria | 55359 |
| 117 | Ga0207661_10414675 | 3300025944 | Bacteria | 1223 |
| 118 | Ga0207651_10218503 | 3300025960 | Bacteria | 1539 |
| 119 | Ga0207712_10586416 | 3300025961 | Bacteria | 963 |
| 120 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 121 | Ga0207677_10807195 | 3300026023 | Unclassified | 840 |
| 122 | Ga0207703_10005017 | 3300026035 | Bacteria | 10732 |
| 123 | Ga0207641_10014806 | 3300026088 | Bacteria | 6393 |
| 124 | Ga0207648_10551929 | 3300026089 | Bacteria | 1058 |
| 125 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 126 | Ga0207675_101508860 | 3300026118 | Unclassified | 693 |
| 127 | Ga0209389_1003256 | 3300027296 | Bacteria | 12985 |
| 128 | Ga0209971_1001142 | 3300027682 | Bacteria | 6713 |
| 129 | Ga0209974_10002118 | 3300027876 | Bacteria | 7263 |
| 130 | Ga0268266_10001307 | 3300028379 | Bacteria | 30263 |
| 131 | Ga0268266_10011282 | 3300028379 | Bacteria | 7776 |
| 132 | Ga0268266_10404323 | 3300028379 | Bacteria | 1291 |
| 133 | Ga0268265_10001515 | 3300028380 | Bacteria | 19408 |
| 134 | Ga0268265_10516351 | 3300028380 | Bacteria | 1128 |
| 135 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 136 | Ga0265324_10152337 | 3300029957 | Bacteria | 785 |
| 137 | Ga0265339_10365907 | 3300031249 | Bacteria | 678 |
| 138 | Ga0307408_100000042 | 3300031548 | Bacteria | 172505 |
| 139 | Ga0316576_10025375 | 3300031727 | Bacteria | 4149 |
| 140 | Ga0316576_10041780 | 3300031727 | Bacteria | 3303 |
| 141 | Ga0316576_10047640 | 3300031727 | Bacteria | 3106 |
| 142 | Ga0316576_10956975 | 3300031727 | Bacteria | 611 |
| 143 | Ga0316578_10018268 | 3300031728 | Bacteria | 3838 |
| 144 | Ga0316578_10151875 | 3300031728 | Bacteria | 1395 |
| 145 | Ga0316577_10022272 | 3300031733 | Bacteria | 3518 |
| 146 | Ga0307410_10155625 | 3300031852 | Bacteria | 1707 |
| 147 | Ga0307416_100204838 | 3300032002 | Unclassified | 1876 |
| 148 | Ga0316580_10044096 | 3300032139 | Bacteria | 1376 |
| 149 | Ga0316574_0005602 | 3300035398 | Bacteria | 6711 |
| 150 | Ga0316574_0042546 | 3300035398 | Bacteria | 2803 |
| 151 | Ga0316574_0130457 | 3300035398 | Bacteria | 1617 |
| 152 | Ga0316584_0044691 | 3300036712 | Bacteria | 3304 |
| 153 | Ga0395899_0165771 | 3300037312 | Bacteria | 1559 |
| 154 | Ga0395900_0018581 | 3300037418 | Bacteria | 7090 |
| 155 | Ga0395901_1832267 | 3300038443 | Unclassified | 555 |
| 156 | Ga0439438_002786 | 3300041405 | Bacteria | 7318 |
| 157 | Ga0439438_019366 | 3300041405 | Bacteria | 1923 |
| 158 | Ga0439447_002283 | 3300041407 | Bacteria | 7041 |
| 159 | Ga0439461_0028974 | 3300041410 | Bacteria | 1143 |
| 160 | Ga0439466_0002286 | 3300041411 | Bacteria | 7519 |
| 161 | Ga0451787_493771 | 3300041441 | Unclassified | 828 |
| 162 | Ga0451795_0299074 | 3300041456 | Unclassified | 809 |
| 163 | Ga0451795_0399164 | 3300041456 | Bacteria | 1176 |
| 164 | Ga0451795_1023846 | 3300041456 | Unclassified | 2111 |
| 165 | Ga0451795_1614724 | 3300041456 | Unclassified | 762 |
| 166 | Ga0451802_2066254 | 3300041460 | Unclassified | 849 |
| 167 | Ga0451855_0628583 | 3300041511 | Bacteria | 874 |
| 168 | Ga0439431_0004888 | 3300041997 | Bacteria | 2955 |
| 169 | Ga0439431_0042479 | 3300041997 | Bacteria | 1161 |
| 170 | Ga0439437_004137 | 3300042000 | Bacteria | 1578 |
| 171 | Ga0439432_002084 | 3300042006 | Bacteria | 7550 |
| 172 | Ga0439432_002805 | 3300042006 | Bacteria | 6495 |
| 173 | Ga0439452_019132 | 3300042010 | Bacteria | 1815 |
| 174 | Ga0450911_000008 | 3300042115 | Bacteria | 168304 |
| 175 | Ga0450900_004026 | 3300042136 | Bacteria | 1668 |
| 176 | Ga0450904_000727 | 3300042139 | Bacteria | 5761 |
| 177 | Ga0450905_010691 | 3300042142 | Bacteria | 1274 |
| 178 | Ga0439446_0017432 | 3300042156 | Bacteria | 2007 |
| 179 | Ga0439434_0004422 | 3300042435 | Bacteria | 4109 |
| 180 | Ga0439434_0099091 | 3300042435 | Bacteria | 938 |
| 181 | Ga0439459_0007443 | 3300042438 | Bacteria | 1849 |
| 182 | Ga0439464_0019764 | 3300042439 | Bacteria | 1840 |
| 183 | Ga0439464_0028043 | 3300042439 | Bacteria | 1568 |
| 184 | Ga0450916_000732 | 3300042530 | Bacteria | 3019 |
| 185 | Ga0450916_004455 | 3300042530 | Bacteria | 1581 |
| 186 | Ga0451577_0894782 | 3300042876 | Unclassified | 799 |
| 187 | Ga0453683_0070802 | 3300044673 | Unclassified | 2181 |
| 188 | Ga0453683_0085034 | 3300044673 | Bacteria | 1982 |
| 189 | Ga0453683_0129296 | 3300044673 | Bacteria | 1591 |
| 190 | Ga0453683_0309741 | 3300044673 | Unclassified | 1011 |
| 191 | Ga0453683_0696159 | 3300044673 | Bacteria | 666 |
| 192 | Ga0453684_0106831 | 3300044712 | Bacteria | 3410 |
| 193 | Ga0453684_0217267 | 3300044712 | Bacteria | 2217 |
| 194 | Ga0453684_0355392 | 3300044712 | Bacteria | 1651 |
| 195 | Ga0453684_0491722 | 3300044712 | Bacteria | 1360 |
| 196 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 197 | Ga0495653_0177077 | 3300046463 | Bacteria | 1467 |
| 198 | Ga0495580_0528230 | 3300046472 | Bacteria | 786 |
| 199 | Ga0495582_0272072 | 3300046473 | Bacteria | 972 |
| 200 | Ga0495596_0125225 | 3300046500 | Bacteria | 997 |
| 201 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 202 | Ga0495630_0001744 | 3300046517 | Bacteria | 15191 |
| 203 | Ga0495632_0005859 | 3300046519 | Bacteria | 8028 |
| 204 | Ga0495643_0000712 | 3300046522 | Bacteria | 38101 |
| 205 | Ga0495643_0008742 | 3300046522 | Bacteria | 6385 |
| 206 | Ga0495648_0011710 | 3300046524 | Bacteria | 6581 |
| 207 | Ga0495666_0168486 | 3300046526 | Bacteria | 1013 |
| 208 | Ga0495586_0425341 | 3300046535 | Unclassified | 765 |
| 209 | Ga0496109_0478435 | 3300048912 | Bacteria | 1176 |
| 210 | Ga0496110_0367655 | 3300048913 | Bacteria | 1310 |
| 211 | Ga0496114_0339932 | 3300048917 | Bacteria | 1327 |
| 212 | Ga0496116_0138519 | 3300048919 | Bacteria | 1373 |
| 213 | Ga0496117_0016215 | 3300048920 | Bacteria | 6296 |
| 214 | Ga0496117_0131800 | 3300048920 | Bacteria | 1513 |
| 215 | Ga0496118_0021388 | 3300048921 | Bacteria | 5694 |
| 216 | Ga0496119_0000207 | 3300048922 | Bacteria | 83748 |
| 217 | Ga0496119_0205510 | 3300048922 | Bacteria | 1016 |
| 218 | Ga0496120_0001363 | 3300048923 | Bacteria | 29968 |
| 219 | Ga0496121_0118367 | 3300048924 | Bacteria | 2005 |
| 220 | Ga0496121_0170880 | 3300048924 | Bacteria | 1579 |
| 221 | Ga0496122_0161570 | 3300048925 | Bacteria | 1365 |
| 222 | Ga0496123_0194703 | 3300048926 | Bacteria | 1045 |
| 223 | Ga0496124_0027019 | 3300048927 | Bacteria | 5163 |
| 224 | Ga0496124_0041281 | 3300048927 | Bacteria | 3982 |
| 225 | Ga0496124_0136556 | 3300048927 | Bacteria | 1941 |
| 226 | Ga0496125_0007893 | 3300048928 | Bacteria | 11239 |
| 227 | Ga0496126_0443135 | 3300048929 | Bacteria | 1046 |
| 228 | Ga0501308_030210 | 3300049128 | Bacteria | 724 |
| 229 | Ga0501314_012754 | 3300049530 | Bacteria | 809 |
| 230 | Ga0501034_0014288 | 3300049571 | Bacteria | 8182 |
| 231 | Ga0501034_0014888 | 3300049571 | Bacteria | 7999 |
| 232 | Ga0501047_0191367 | 3300049581 | Bacteria | 1909 |
| 233 | Ga0501225_0063171 | 3300049705 | Bacteria | 1044 |
| 234 | Ga0501080_0074071 | 3300049742 | Bacteria | 3168 |
| 235 | Ga0501044_0025742 | 3300049823 | Bacteria | 6237 |
| 236 | Ga0501226_000005 | 3300049853 | Bacteria | 271019 |
| 237 | nmdc:mga09592_453806_c1 | 3300050508 | Bacteria | 1106 |
| 238 | nmdc:mga0qj67_214985_c1 | 3300050509 | Bacteria | 1561 |
| 239 | nmdc:mga0qj67_297132_c1 | 3300050509 | Bacteria | 1309 |
| 240 | nmdc:mga06r32_228023_c1 | 3300050510 | Bacteria | 1851 |
| 241 | nmdc:mga06r32_258386_c1 | 3300050510 | Bacteria | 1729 |
| 242 | nmdc:mga0sz30_268476_c1 | 3300050516 | Unclassified | 760 |
| 243 | Ga0500659_0007453 | 3300053135 | Bacteria | 6038 |
| 244 | 2511375531 | 2511231024 | Bacteria | 5835885 |
| 245 | 2555245886 | 2554235231 | Bacteria | 5215788 |
| 246 | 2600446506 | 2600254954 | Bacteria | 5100516 |
| 247 | 2602010431 | 2600255389 | Bacteria | 5275336 |
| 248 | 2765582323 | 2765235841 | Bacteria | 6137024 |
| 249 | 2807409826 | 2806310737 | Bacteria | 5751088 |
| 250 | 2807458174 | 2806310745 | Bacteria | 5742165 |
| 251 | 2808904840 | 2808606373 | Bacteria | 4423627 |
| 252 | 2812371023 | 2811994881 | Bacteria | 6298475 |
| 253 | 2823422976 | 2823421272 | Bacteria | 5372474 |
| 254 | 2890806669 | 2890804823 | Bacteria | 3717572 |
| 255 | 2919158802 | 2919155634 | Bacteria | 4860545 |
| 256 | 2919505632 | 2919501602 | Bacteria | 5286340 |
| 257 | 2923525130 | 2923519811 | Bacteria | 6298479 |
| 258 | 2926067309 | 2926063275 | Bacteria | 5285848 |
| 259 | 3007808638 | 3007803356 | Bacteria | 5931491 |
| 260 | 3007874440 | 3007872151 | Bacteria | 5268868 |
| 261 | 640487493 | 640427133 | Bacteria | 4567418 |
| 262 | 8002745868 | 8002745576 | Bacteria | 4840272 |
| 263 | 8034964095 | 8034962539 | Bacteria | 4884839 |
| 264 | 8036737634 | 8036736890 | Bacteria | 2944828 |
| 265 | 8052495775 | 8052494512 | Bacteria | 5765634 |
| 266 | 8054929585 | 8054929484 | Bacteria | 5599761 |
| 267 | 8056120163 | 8056115690 | Bacteria | 5527654 |
| 268 | 8056141777 | 8056137416 | Bacteria | 6147080 |
| 269 | 8057162602 | 8057160832 | Bacteria | 3268302 |
| 270 | Ga0501034_0064729 | |||
| 271 | SwRhRL2b_contig_694250 | |||
| 272 | Ga0055536_1015857 | |||
| 273 | Ga0065704_10013472 | |||
| 274 | Ga0065704_10017555 | |||
| 275 | Ga0065704_10207776 | |||
| 276 | Ga0070658_10412364 | |||
| 277 | Ga0070683_100606539 | |||
| 278 | Ga0070670_101215321 | |||
| 279 | Ga0070677_10498273 | |||
| 280 | Ga0070666_10011774 | |||
| 281 | Ga0068868_100782063 | |||
| 282 | Ga0070669_100002436 | |||
| 283 | Ga0070669_100735430 | |||
| 284 | Ga0070675_100140367 | |||
| 285 | Ga0070675_100189266 | |||
| 286 | Ga0070671_100000013 | |||
| 287 | Ga0070671_100223142 | |||
| 288 | Ga0070673_100176865 | |||
| 289 | Ga0070673_100493054 | |||
| 290 | Ga0070667_100000015 | |||
| 291 | Ga0070714_100199047 | |||
| 292 | Ga0068867_100584671 | |||
| 293 | Ga0070685_10000004 | |||
| 294 | Ga0070698_100333454 | |||
| 295 | Ga0070684_101402216 | |||
| 296 | Ga0070672_100930630 | |||
| 297 | Ga0070693_100419604 | |||
| 298 | Ga0070665_100012903 | |||
| 299 | Ga0068855_100418524 | |||
| 300 | Ga0070664_100825250 | |||
| 301 | Ga0068852_101130564 | |||
| 302 | Ga0068859_100008974 | |||
| 303 | Ga0068864_100000072 | |||
| 304 | Ga0068851_10577655 | |||
| 305 | Ga0068863_100310590 | |||
| 306 | Ga0068858_100103385 | |||
| 307 | Ga0068860_100000271 | |||
| 308 | Ga0068862_100174430 | |||
| 309 | Ga0068862_100567784 | |||
| 310 | Ga0075432_10241257 | |||
| 311 | Ga0075369_10304569 | |||
| 312 | Ga0075430_100016037 | |||
| 313 | Ga0075430_100138881 | |||
| 314 | Ga0075431_100136364 | |||
| 315 | Ga0075431_100251713 | |||
| 316 | Ga0075429_100154318 | |||
| 317 | Ga0097620_100008974 | |||
| 318 | Ga0099823_1005145 | |||
| 319 | Ga0099823_1068167 | |||
| 320 | Ga0105251_10059083 | |||
| 321 | Ga0105251_10074057 | |||
| 322 | Ga0105251_10133606 | |||
| 323 | Ga0105244_10074262 | |||
| 324 | Ga0105244_10101110 | |||
| 325 | Ga0105244_10168068 | |||
| 326 | Ga0105244_10223832 | |||
| 327 | Ga0105250_10035323 | |||
| 328 | Ga0105250_10043261 | |||
| 329 | Ga0105247_10011331 | |||
| 330 | Ga0114129_11605661 | |||
| 331 | Ga0105243_10274497 | |||
| 332 | Ga0105243_10274498 | |||
| 333 | Ga0105248_10279503 | |||
| 334 | Ga0105238_10648063 | |||
| 335 | Ga0105238_11112416 | |||
| 336 | Ga0105249_11020408 | |||
| 337 | Ga0105239_10527868 | |||
| 338 | Ga0105239_11314459 | |||
| 339 | Ga0157373_10232034 | |||
| 340 | Ga0157373_11006921 | |||
| 341 | Ga0157370_10020234 | |||
| 342 | Ga0157370_10342646 | |||
| 343 | Ga0157374_10585390 | |||
| 344 | Ga0157378_10738694 | |||
| 345 | Ga0157372_10003896 | |||
| 346 | Ga0157372_10066438 | |||
| 347 | Ga0157372_10121025 | |||
| 348 | Ga0157372_10900707 | |||
| 349 | Ga0157372_11031611 | |||
| 350 | Ga0163163_10000118 | |||
| 351 | Ga0157379_10169488 | |||
| 352 | Ga0207425_1020932 | |||
| 353 | Ga0209676_1000916 | |||
| 354 | Ga0207696_1000164 | |||
| 355 | Ga0207696_1010206 | |||
| 356 | Ga0207696_1012464 | |||
| 357 | Ga0207655_1001759 | |||
| 358 | Ga0207655_1033908 | |||
| 359 | Ga0207655_1056555 | |||
| 360 | Ga0207655_1059725 | |||
| 361 | Ga0207655_1079754 | |||
| 362 | Ga0207713_1011826 | |||
| 363 | Ga0207713_1035852 | |||
| 364 | Ga0207713_1057409 | |||
| 365 | Ga0207682_10015463 | |||
| 366 | Ga0207710_10186969 | |||
| 367 | Ga0207680_10038697 | |||
| 368 | Ga0207645_10259444 | |||
| 369 | Ga0207705_10378644 | |||
| 370 | Ga0207681_10002041 | |||
| 371 | Ga0207694_10832429 | |||
| 372 | Ga0207650_10000013 | |||
| 373 | Ga0207650_10887222 | |||
| 374 | Ga0207659_10400264 | |||
| 375 | Ga0207659_10858604 | |||
| 376 | Ga0207664_10129878 | |||
| 377 | Ga0207644_10000015 | |||
| 378 | Ga0207644_10191736 | |||
| 379 | Ga0207706_10349531 | |||
| 380 | Ga0207709_10178142 | |||
| 381 | Ga0207709_10200555 | |||
| 382 | Ga0207669_10056495 | |||
| 383 | Ga0207691_10473276 | |||
| 384 | Ga0207711_10000103 | |||
| 385 | Ga0207711_10000277 | |||
| 386 | Ga0207661_10414675 | |||
| 387 | Ga0207651_10218503 | |||
| 388 | Ga0207712_10586416 | |||
| 389 | Ga0207658_10000005 | |||
| 390 | Ga0207677_10807195 | |||
| 391 | Ga0207703_10005017 | |||
| 392 | Ga0207641_10014806 | |||
| 393 | Ga0207648_10551929 | |||
| 394 | Ga0207676_10000010 | |||
| 395 | Ga0207675_101508860 | |||
| 396 | Ga0209389_1003256 | |||
| 397 | Ga0209971_1001142 | |||
| 398 | Ga0209974_10002118 | |||
| 399 | Ga0268266_10001307 | |||
| 400 | Ga0268266_10011282 | |||
| 401 | Ga0268266_10404323 | |||
| 402 | Ga0268265_10001515 | |||
| 403 | Ga0268265_10516351 | |||
| 404 | Ga0268264_10000036 | |||
| 405 | Ga0265324_10152337 | |||
| 406 | Ga0265339_10365907 | |||
| 407 | Ga0307408_100000042 | |||
| 408 | Ga0316576_10025375 | |||
| 409 | Ga0316576_10041780 | |||
| 410 | Ga0316576_10047640 | |||
| 411 | Ga0316576_10956975 | |||
| 412 | Ga0316578_10018268 | |||
| 413 | Ga0316578_10151875 | |||
| 414 | Ga0316577_10022272 | |||
| 415 | Ga0307410_10155625 | |||
| 416 | Ga0307416_100204838 | |||
| 417 | Ga0316580_10044096 | |||
| 418 | Ga0316574_0005602 | |||
| 419 | Ga0316574_0042546 | |||
| 420 | Ga0316574_0130457 | |||
| 421 | Ga0316584_0044691 | |||
| 422 | Ga0395899_0165771 | |||
| 423 | Ga0395900_0018581 | |||
| 424 | Ga0395901_1832267 | |||
| 425 | Ga0439438_002786 | |||
| 426 | Ga0439438_019366 | |||
| 427 | Ga0439447_002283 | |||
| 428 | Ga0439461_0028974 | |||
| 429 | Ga0439466_0002286 | |||
| 430 | Ga0451787_493771 | |||
| 431 | Ga0451795_0299074 | |||
| 432 | Ga0451795_0399164 | |||
| 433 | Ga0451795_1023846 | |||
| 434 | Ga0451795_1614724 | |||
| 435 | Ga0451802_2066254 | |||
| 436 | Ga0451855_0628583 | |||
| 437 | Ga0439431_0004888 | |||
| 438 | Ga0439431_0042479 | |||
| 439 | Ga0439437_004137 | |||
| 440 | Ga0439432_002084 | |||
| 441 | Ga0439432_002805 | |||
| 442 | Ga0439452_019132 | |||
| 443 | Ga0450911_000008 | |||
| 444 | Ga0450900_004026 | |||
| 445 | Ga0450904_000727 | |||
| 446 | Ga0450905_010691 | |||
| 447 | Ga0439446_0017432 | |||
| 448 | Ga0439434_0004422 | |||
| 449 | Ga0439434_0099091 | |||
| 450 | Ga0439459_0007443 | |||
| 451 | Ga0439464_0019764 | |||
| 452 | Ga0439464_0028043 | |||
| 453 | Ga0450916_000732 | |||
| 454 | Ga0450916_004455 | |||
| 455 | Ga0451577_0894782 | |||
| 456 | Ga0453683_0070802 | |||
| 457 | Ga0453683_0085034 | |||
| 458 | Ga0453683_0129296 | |||
| 459 | Ga0453683_0309741 | |||
| 460 | Ga0453683_0696159 | |||
| 461 | Ga0453684_0106831 | |||
| 462 | Ga0453684_0217267 | |||
| 463 | Ga0453684_0355392 | |||
| 464 | Ga0453684_0491722 | |||
| 465 | Ga0451576_0000003 | |||
| 466 | Ga0495653_0177077 | |||
| 467 | Ga0495580_0528230 | |||
| 468 | Ga0495582_0272072 | |||
| 469 | Ga0495596_0125225 | |||
| 470 | Ga0495620_0000003 | |||
| 471 | Ga0495630_0001744 | |||
| 472 | Ga0495632_0005859 | |||
| 473 | Ga0495643_0000712 | |||
| 474 | Ga0495643_0008742 | |||
| 475 | Ga0495648_0011710 | |||
| 476 | Ga0495666_0168486 | |||
| 477 | Ga0495586_0425341 | |||
| 478 | Ga0496109_0478435 | |||
| 479 | Ga0496110_0367655 | |||
| 480 | Ga0496114_0339932 | |||
| 481 | Ga0496116_0138519 | |||
| 482 | Ga0496117_0016215 | |||
| 483 | Ga0496117_0131800 | |||
| 484 | Ga0496118_0021388 | |||
| 485 | Ga0496119_0000207 | |||
| 486 | Ga0496119_0205510 | |||
| 487 | Ga0496120_0001363 | |||
| 488 | Ga0496121_0118367 | |||
| 489 | Ga0496121_0170880 | |||
| 490 | Ga0496122_0161570 | |||
| 491 | Ga0496123_0194703 | |||
| 492 | Ga0496124_0027019 | |||
| 493 | Ga0496124_0041281 | |||
| 494 | Ga0496124_0136556 | |||
| 495 | Ga0496125_0007893 | |||
| 496 | Ga0496126_0443135 | |||
| 497 | Ga0501308_030210 | |||
| 498 | Ga0501314_012754 | |||
| 499 | Ga0501034_0014288 | |||
| 500 | Ga0501034_0014888 | |||
| 501 | Ga0501047_0191367 | |||
| 502 | Ga0501225_0063171 | |||
| 503 | Ga0501080_0074071 | |||
| 504 | Ga0501044_0025742 | |||
| 505 | Ga0501226_000005 | |||
| 506 | nmdc:mga09592_453806_c1 | |||
| 507 | nmdc:mga0qj67_214985_c1 | |||
| 508 | nmdc:mga0qj67_297132_c1 | |||
| 509 | nmdc:mga06r32_228023_c1 | |||
| 510 | nmdc:mga06r32_258386_c1 | |||
| 511 | nmdc:mga0sz30_268476_c1 | |||
| 512 | Ga0500659_0007453 | |||
| 513 | 2511375531 | |||
| 514 | 2555245886 | |||
| 515 | 2600446506 | |||
| 516 | 2602010431 | |||
| 517 | 2765582323 | |||
| 518 | 2807409826 | |||
| 519 | 2807458174 | |||
| 520 | 2808904840 | |||
| 521 | 2812371023 | |||
| 522 | 2823422976 | |||
| 523 | 2890806669 | |||
| 524 | 2919158802 | |||
| 525 | 2919505632 | |||
| 526 | 2923525130 | |||
| 527 | 2926067309 | |||
| 528 | 3007808638 | |||
| 529 | 3007874440 | |||
| 530 | 640487493 | |||
| 531 | 8002745868 | |||
| 532 | 8034964095 | |||
| 533 | 8036737634 | |||
| 534 | 8052495775 | |||
| 535 | 8054929585 | |||
| 536 | 8056120163 | |||
| 537 | 8056141777 | |||
| 538 | 8057162602 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lf9-assembly1.cif.gz_A | crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c | 0.9417 | 1 | 185 |
| 5mlc-assembly1.cif.gz_9 | cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions | 0.9189 | 103 | 185 |
| 5jsn-assembly2.cif.gz_D | bcl2-inhibitor complex | 0.9188 | 1 | 182 |
| 3lhp-assembly1.cif.gz_S | crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex | 0.9146 | 1 | 183 |
| 5jsb-assembly1.cif.gz_B | crystal structure of mcl1-inhibitor complex | 0.9139 | 103 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A805_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9973 | 31 | 105 | 3.30.1360.40 |
| 1is1A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9915 | 3 | 185 | 1.10.132.20 |
| 4kc6A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9877 | 106 | 179 | 1.10.132.20 |
| af_P0A805_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9842 | 31 | 105 | 3.30.1360.40 |
| 1iseA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9836 | 3 | 185 | 1.10.132.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9XQ89-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9928 | 1 | 184 |
GO:0002184
GO:0005829 GO:0043023 |
| AF-A0A420VBI8-F1-model_v4 | Multifunctional fusion protein [Includes: Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK); Ribosome-recycling factor (RRF) (Ribosome-releasing factor)] | 0.9876 | 1 | 185 |
GO:0005524
GO:0005737 GO:0006225 GO:0006415 GO:0033862 GO:0044210 |
| AF-A0A2A4RE35-F1-model_v4 | Ribosome recycling factor | 0.9872 | 1 | 129 |
GO:0002184
GO:0005829 GO:0043023 |
| AF-Q7MIG3-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.987 | 1 | 185 |
GO:0002184
GO:0005829 GO:0043023 |
| AF-A0A6L8FMD9-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.987 | 14 | 185 |
GO:0005737
GO:0006415 GO:0043023 |