F376501

General Info

Members Datasets Scaffolds Average Seq Length
269 196 538 183

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0064729|Ga0501034_0064729_1552_2145
Length 197
Sequence VVKQDERIEETIVINDIKSDAEKKMKKSLEALHSAFNKIRTGRAHPAILDSVMVNYYGQETPLKQVASVNVEDNRTLTVSPWEKNLVPTIEKAIMTSDLGLNPATSGDLIRVPMPMLTEETRKEMVKQAKADAEHGRVSIRNARRDANSMLKDLLKEKEISEDELRKGEEEVQKLTDKYIAEVEKMLKVKEEDLMAV

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
90 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
111 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
119 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
123 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
124 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
171 2511231024 Pseudomonas sp. GM84 Isolate Nodule
172 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
173 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
174 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
175 2765235841 Pseudomonas putida AA7 Isolate Unclassified
176 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
177 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
178 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
179 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
180 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
181 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
182 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
183 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
184 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
185 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
186 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
187 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
188 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
189 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
190 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
191 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
192 8052494512 Pseudomonas putida LD6 Isolate Unclassified
193 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
194 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
195 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
196 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.59
Metatranscriptomes 0.74
Isolates 9.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 1.49
Rhizoplane 4.46
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0064729 3300049571 Bacteria 3670
2 SwRhRL2b_contig_694250 2162886007 Bacteria 830
3 Ga0055536_1015857 3300003781 Bacteria 2553
4 Ga0065704_10013472 3300005289 Bacteria 1993
5 Ga0065704_10017555 3300005289 Bacteria 2085
6 Ga0065704_10207776 3300005289 Bacteria 1120
7 Ga0070658_10412364 3300005327 Unclassified 1161
8 Ga0070683_100606539 3300005329 Bacteria 1048
9 Ga0070670_101215321 3300005331 Unclassified 689
10 Ga0070677_10498273 3300005333 Bacteria 660
11 Ga0070666_10011774 3300005335 Bacteria 5499
12 Ga0068868_100782063 3300005338 Unclassified 860
13 Ga0070669_100002436 3300005353 Bacteria 13474
14 Ga0070669_100735430 3300005353 Bacteria 835
15 Ga0070675_100140367 3300005354 Bacteria 2065
16 Ga0070675_100189266 3300005354 Bacteria 1782
17 Ga0070671_100000013 3300005355 Bacteria 173287
18 Ga0070671_100223142 3300005355 Bacteria 1599
19 Ga0070673_100176865 3300005364 Bacteria 1825
20 Ga0070673_100493054 3300005364 Bacteria 1107
21 Ga0070667_100000015 3300005367 Bacteria 238203
22 Ga0070714_100199047 3300005435 Unclassified 1832
23 Ga0068867_100584671 3300005459 Unclassified 972
24 Ga0070685_10000004 3300005466 Bacteria 246215
25 Ga0070698_100333454 3300005471 Bacteria 1448
26 Ga0070684_101402216 3300005535 Bacteria 658
27 Ga0070672_100930630 3300005543 Bacteria 769
28 Ga0070693_100419604 3300005547 Bacteria 932
29 Ga0070665_100012903 3300005548 Bacteria 8416
30 Ga0068855_100418524 3300005563 Bacteria 1466
31 Ga0070664_100825250 3300005564 Bacteria 868
32 Ga0068852_101130564 3300005616 Unclassified 804
33 Ga0068859_100008974 3300005617 Bacteria 10098
34 Ga0068864_100000072 3300005618 Bacteria 110066
35 Ga0068851_10577655 3300005834 Bacteria 682
36 Ga0068863_100310590 3300005841 Bacteria 1530
37 Ga0068858_100103385 3300005842 Bacteria 2657
38 Ga0068860_100000271 3300005843 Bacteria 75530
39 Ga0068862_100174430 3300005844 Bacteria 1926
40 Ga0068862_100567784 3300005844 Bacteria 1085
41 Ga0075432_10241257 3300006058 Bacteria 730
42 Ga0075369_10304569 3300006186 Unclassified 744
43 Ga0075430_100016037 3300006846 Bacteria 6380
44 Ga0075430_100138881 3300006846 Bacteria 2024
45 Ga0075431_100136364 3300006847 Bacteria 2530
46 Ga0075431_100251713 3300006847 Bacteria 1795
47 Ga0075429_100154318 3300006880 Bacteria 2011
48 Ga0097620_100008974 3300006931 Bacteria 10098
49 Ga0099823_1005145 3300006944 Bacteria 12975
50 Ga0099823_1068167 3300006944 Bacteria 1647
51 Ga0105251_10059083 3300009011 Bacteria 1809
52 Ga0105251_10074057 3300009011 Bacteria 1582
53 Ga0105251_10133606 3300009011 Bacteria 1124
54 Ga0105244_10074262 3300009036 Bacteria 1692
55 Ga0105244_10101110 3300009036 Bacteria 1410
56 Ga0105244_10168068 3300009036 Bacteria 1045
57 Ga0105244_10223832 3300009036 Bacteria 882
58 Ga0105250_10035323 3300009092 Bacteria 2005
59 Ga0105250_10043261 3300009092 Bacteria 1805
60 Ga0105247_10011331 3300009101 Bacteria 5379
61 Ga0114129_11605661 3300009147 Unclassified 796
62 Ga0105243_10274497 3300009148 Bacteria 1515
63 Ga0105243_10274498 3300009148 Bacteria 1515
64 Ga0105248_10279503 3300009177 Bacteria 1879
65 Ga0105238_10648063 3300009551 Bacteria 1066
66 Ga0105238_11112416 3300009551 Bacteria 813
67 Ga0105249_11020408 3300009553 Bacteria 896
68 Ga0105239_10527868 3300010375 Bacteria 1343
69 Ga0105239_11314459 3300010375 Bacteria 834
70 Ga0157373_10232034 3300013100 Bacteria 1303
71 Ga0157373_11006921 3300013100 Bacteria 622
72 Ga0157370_10020234 3300013104 Bacteria 6649
73 Ga0157370_10342646 3300013104 Bacteria 1378
74 Ga0157374_10585390 3300013296 Unclassified 1125
75 Ga0157378_10738694 3300013297 Bacteria 1006
76 Ga0157372_10003896 3300013307 Bacteria 16036
77 Ga0157372_10066438 3300013307 Bacteria 4052
78 Ga0157372_10121025 3300013307 Bacteria 3006
79 Ga0157372_10900707 3300013307 Bacteria 1026
80 Ga0157372_11031611 3300013307 Bacteria 952
81 Ga0163163_10000118 3300014325 Bacteria 84379
82 Ga0157379_10169488 3300014968 Bacteria 1971
83 Ga0207425_1020932 3300025245 Bacteria 1392
84 Ga0209676_1000916 3300025292 Bacteria 36772
85 Ga0207696_1000164 3300025711 Bacteria 106057
86 Ga0207696_1010206 3300025711 Bacteria 3458
87 Ga0207696_1012464 3300025711 Bacteria 3005
88 Ga0207655_1001759 3300025728 Bacteria 18987
89 Ga0207655_1033908 3300025728 Bacteria 2305
90 Ga0207655_1056555 3300025728 Bacteria 1546
91 Ga0207655_1059725 3300025728 Bacteria 1482
92 Ga0207655_1079754 3300025728 Bacteria 1185
93 Ga0207713_1011826 3300025735 Bacteria 4712
94 Ga0207713_1035852 3300025735 Bacteria 2136
95 Ga0207713_1057409 3300025735 Bacteria 1505
96 Ga0207682_10015463 3300025893 Bacteria 2970
97 Ga0207710_10186969 3300025900 Bacteria 1019
98 Ga0207680_10038697 3300025903 Bacteria 2762
99 Ga0207645_10259444 3300025907 Unclassified 1151
100 Ga0207705_10378644 3300025909 Unclassified 1093
101 Ga0207681_10002041 3300025923 Bacteria 12952
102 Ga0207694_10832429 3300025924 Unclassified 780
103 Ga0207650_10000013 3300025925 Bacteria 409471
104 Ga0207650_10887222 3300025925 Unclassified 757
105 Ga0207659_10400264 3300025926 Bacteria 1148
106 Ga0207659_10858604 3300025926 Bacteria 780
107 Ga0207664_10129878 3300025929 Bacteria 2120
108 Ga0207644_10000015 3300025931 Bacteria 179880
109 Ga0207644_10191736 3300025931 Bacteria 1607
110 Ga0207706_10349531 3300025933 Bacteria 1286
111 Ga0207709_10178142 3300025935 Bacteria 1499
112 Ga0207709_10200555 3300025935 Bacteria 1425
113 Ga0207669_10056495 3300025937 Bacteria 2384
114 Ga0207691_10473276 3300025940 Bacteria 1065
115 Ga0207711_10000103 3300025941 Bacteria 90172
116 Ga0207711_10000277 3300025941 Bacteria 55359
117 Ga0207661_10414675 3300025944 Bacteria 1223
118 Ga0207651_10218503 3300025960 Bacteria 1539
119 Ga0207712_10586416 3300025961 Bacteria 963
120 Ga0207658_10000005 3300025986 Bacteria 408341
121 Ga0207677_10807195 3300026023 Unclassified 840
122 Ga0207703_10005017 3300026035 Bacteria 10732
123 Ga0207641_10014806 3300026088 Bacteria 6393
124 Ga0207648_10551929 3300026089 Bacteria 1058
125 Ga0207676_10000010 3300026095 Bacteria 519402
126 Ga0207675_101508860 3300026118 Unclassified 693
127 Ga0209389_1003256 3300027296 Bacteria 12985
128 Ga0209971_1001142 3300027682 Bacteria 6713
129 Ga0209974_10002118 3300027876 Bacteria 7263
130 Ga0268266_10001307 3300028379 Bacteria 30263
131 Ga0268266_10011282 3300028379 Bacteria 7776
132 Ga0268266_10404323 3300028379 Bacteria 1291
133 Ga0268265_10001515 3300028380 Bacteria 19408
134 Ga0268265_10516351 3300028380 Bacteria 1128
135 Ga0268264_10000036 3300028381 Bacteria 392994
136 Ga0265324_10152337 3300029957 Bacteria 785
137 Ga0265339_10365907 3300031249 Bacteria 678
138 Ga0307408_100000042 3300031548 Bacteria 172505
139 Ga0316576_10025375 3300031727 Bacteria 4149
140 Ga0316576_10041780 3300031727 Bacteria 3303
141 Ga0316576_10047640 3300031727 Bacteria 3106
142 Ga0316576_10956975 3300031727 Bacteria 611
143 Ga0316578_10018268 3300031728 Bacteria 3838
144 Ga0316578_10151875 3300031728 Bacteria 1395
145 Ga0316577_10022272 3300031733 Bacteria 3518
146 Ga0307410_10155625 3300031852 Bacteria 1707
147 Ga0307416_100204838 3300032002 Unclassified 1876
148 Ga0316580_10044096 3300032139 Bacteria 1376
149 Ga0316574_0005602 3300035398 Bacteria 6711
150 Ga0316574_0042546 3300035398 Bacteria 2803
151 Ga0316574_0130457 3300035398 Bacteria 1617
152 Ga0316584_0044691 3300036712 Bacteria 3304
153 Ga0395899_0165771 3300037312 Bacteria 1559
154 Ga0395900_0018581 3300037418 Bacteria 7090
155 Ga0395901_1832267 3300038443 Unclassified 555
156 Ga0439438_002786 3300041405 Bacteria 7318
157 Ga0439438_019366 3300041405 Bacteria 1923
158 Ga0439447_002283 3300041407 Bacteria 7041
159 Ga0439461_0028974 3300041410 Bacteria 1143
160 Ga0439466_0002286 3300041411 Bacteria 7519
161 Ga0451787_493771 3300041441 Unclassified 828
162 Ga0451795_0299074 3300041456 Unclassified 809
163 Ga0451795_0399164 3300041456 Bacteria 1176
164 Ga0451795_1023846 3300041456 Unclassified 2111
165 Ga0451795_1614724 3300041456 Unclassified 762
166 Ga0451802_2066254 3300041460 Unclassified 849
167 Ga0451855_0628583 3300041511 Bacteria 874
168 Ga0439431_0004888 3300041997 Bacteria 2955
169 Ga0439431_0042479 3300041997 Bacteria 1161
170 Ga0439437_004137 3300042000 Bacteria 1578
171 Ga0439432_002084 3300042006 Bacteria 7550
172 Ga0439432_002805 3300042006 Bacteria 6495
173 Ga0439452_019132 3300042010 Bacteria 1815
174 Ga0450911_000008 3300042115 Bacteria 168304
175 Ga0450900_004026 3300042136 Bacteria 1668
176 Ga0450904_000727 3300042139 Bacteria 5761
177 Ga0450905_010691 3300042142 Bacteria 1274
178 Ga0439446_0017432 3300042156 Bacteria 2007
179 Ga0439434_0004422 3300042435 Bacteria 4109
180 Ga0439434_0099091 3300042435 Bacteria 938
181 Ga0439459_0007443 3300042438 Bacteria 1849
182 Ga0439464_0019764 3300042439 Bacteria 1840
183 Ga0439464_0028043 3300042439 Bacteria 1568
184 Ga0450916_000732 3300042530 Bacteria 3019
185 Ga0450916_004455 3300042530 Bacteria 1581
186 Ga0451577_0894782 3300042876 Unclassified 799
187 Ga0453683_0070802 3300044673 Unclassified 2181
188 Ga0453683_0085034 3300044673 Bacteria 1982
189 Ga0453683_0129296 3300044673 Bacteria 1591
190 Ga0453683_0309741 3300044673 Unclassified 1011
191 Ga0453683_0696159 3300044673 Bacteria 666
192 Ga0453684_0106831 3300044712 Bacteria 3410
193 Ga0453684_0217267 3300044712 Bacteria 2217
194 Ga0453684_0355392 3300044712 Bacteria 1651
195 Ga0453684_0491722 3300044712 Bacteria 1360
196 Ga0451576_0000003 3300045051 Bacteria 1550573
197 Ga0495653_0177077 3300046463 Bacteria 1467
198 Ga0495580_0528230 3300046472 Bacteria 786
199 Ga0495582_0272072 3300046473 Bacteria 972
200 Ga0495596_0125225 3300046500 Bacteria 997
201 Ga0495620_0000003 3300046515 Bacteria 345923
202 Ga0495630_0001744 3300046517 Bacteria 15191
203 Ga0495632_0005859 3300046519 Bacteria 8028
204 Ga0495643_0000712 3300046522 Bacteria 38101
205 Ga0495643_0008742 3300046522 Bacteria 6385
206 Ga0495648_0011710 3300046524 Bacteria 6581
207 Ga0495666_0168486 3300046526 Bacteria 1013
208 Ga0495586_0425341 3300046535 Unclassified 765
209 Ga0496109_0478435 3300048912 Bacteria 1176
210 Ga0496110_0367655 3300048913 Bacteria 1310
211 Ga0496114_0339932 3300048917 Bacteria 1327
212 Ga0496116_0138519 3300048919 Bacteria 1373
213 Ga0496117_0016215 3300048920 Bacteria 6296
214 Ga0496117_0131800 3300048920 Bacteria 1513
215 Ga0496118_0021388 3300048921 Bacteria 5694
216 Ga0496119_0000207 3300048922 Bacteria 83748
217 Ga0496119_0205510 3300048922 Bacteria 1016
218 Ga0496120_0001363 3300048923 Bacteria 29968
219 Ga0496121_0118367 3300048924 Bacteria 2005
220 Ga0496121_0170880 3300048924 Bacteria 1579
221 Ga0496122_0161570 3300048925 Bacteria 1365
222 Ga0496123_0194703 3300048926 Bacteria 1045
223 Ga0496124_0027019 3300048927 Bacteria 5163
224 Ga0496124_0041281 3300048927 Bacteria 3982
225 Ga0496124_0136556 3300048927 Bacteria 1941
226 Ga0496125_0007893 3300048928 Bacteria 11239
227 Ga0496126_0443135 3300048929 Bacteria 1046
228 Ga0501308_030210 3300049128 Bacteria 724
229 Ga0501314_012754 3300049530 Bacteria 809
230 Ga0501034_0014288 3300049571 Bacteria 8182
231 Ga0501034_0014888 3300049571 Bacteria 7999
232 Ga0501047_0191367 3300049581 Bacteria 1909
233 Ga0501225_0063171 3300049705 Bacteria 1044
234 Ga0501080_0074071 3300049742 Bacteria 3168
235 Ga0501044_0025742 3300049823 Bacteria 6237
236 Ga0501226_000005 3300049853 Bacteria 271019
237 nmdc:mga09592_453806_c1 3300050508 Bacteria 1106
238 nmdc:mga0qj67_214985_c1 3300050509 Bacteria 1561
239 nmdc:mga0qj67_297132_c1 3300050509 Bacteria 1309
240 nmdc:mga06r32_228023_c1 3300050510 Bacteria 1851
241 nmdc:mga06r32_258386_c1 3300050510 Bacteria 1729
242 nmdc:mga0sz30_268476_c1 3300050516 Unclassified 760
243 Ga0500659_0007453 3300053135 Bacteria 6038
244 2511375531 2511231024 Bacteria 5835885
245 2555245886 2554235231 Bacteria 5215788
246 2600446506 2600254954 Bacteria 5100516
247 2602010431 2600255389 Bacteria 5275336
248 2765582323 2765235841 Bacteria 6137024
249 2807409826 2806310737 Bacteria 5751088
250 2807458174 2806310745 Bacteria 5742165
251 2808904840 2808606373 Bacteria 4423627
252 2812371023 2811994881 Bacteria 6298475
253 2823422976 2823421272 Bacteria 5372474
254 2890806669 2890804823 Bacteria 3717572
255 2919158802 2919155634 Bacteria 4860545
256 2919505632 2919501602 Bacteria 5286340
257 2923525130 2923519811 Bacteria 6298479
258 2926067309 2926063275 Bacteria 5285848
259 3007808638 3007803356 Bacteria 5931491
260 3007874440 3007872151 Bacteria 5268868
261 640487493 640427133 Bacteria 4567418
262 8002745868 8002745576 Bacteria 4840272
263 8034964095 8034962539 Bacteria 4884839
264 8036737634 8036736890 Bacteria 2944828
265 8052495775 8052494512 Bacteria 5765634
266 8054929585 8054929484 Bacteria 5599761
267 8056120163 8056115690 Bacteria 5527654
268 8056141777 8056137416 Bacteria 6147080
269 8057162602 8057160832 Bacteria 3268302
270 Ga0501034_0064729
271 SwRhRL2b_contig_694250
272 Ga0055536_1015857
273 Ga0065704_10013472
274 Ga0065704_10017555
275 Ga0065704_10207776
276 Ga0070658_10412364
277 Ga0070683_100606539
278 Ga0070670_101215321
279 Ga0070677_10498273
280 Ga0070666_10011774
281 Ga0068868_100782063
282 Ga0070669_100002436
283 Ga0070669_100735430
284 Ga0070675_100140367
285 Ga0070675_100189266
286 Ga0070671_100000013
287 Ga0070671_100223142
288 Ga0070673_100176865
289 Ga0070673_100493054
290 Ga0070667_100000015
291 Ga0070714_100199047
292 Ga0068867_100584671
293 Ga0070685_10000004
294 Ga0070698_100333454
295 Ga0070684_101402216
296 Ga0070672_100930630
297 Ga0070693_100419604
298 Ga0070665_100012903
299 Ga0068855_100418524
300 Ga0070664_100825250
301 Ga0068852_101130564
302 Ga0068859_100008974
303 Ga0068864_100000072
304 Ga0068851_10577655
305 Ga0068863_100310590
306 Ga0068858_100103385
307 Ga0068860_100000271
308 Ga0068862_100174430
309 Ga0068862_100567784
310 Ga0075432_10241257
311 Ga0075369_10304569
312 Ga0075430_100016037
313 Ga0075430_100138881
314 Ga0075431_100136364
315 Ga0075431_100251713
316 Ga0075429_100154318
317 Ga0097620_100008974
318 Ga0099823_1005145
319 Ga0099823_1068167
320 Ga0105251_10059083
321 Ga0105251_10074057
322 Ga0105251_10133606
323 Ga0105244_10074262
324 Ga0105244_10101110
325 Ga0105244_10168068
326 Ga0105244_10223832
327 Ga0105250_10035323
328 Ga0105250_10043261
329 Ga0105247_10011331
330 Ga0114129_11605661
331 Ga0105243_10274497
332 Ga0105243_10274498
333 Ga0105248_10279503
334 Ga0105238_10648063
335 Ga0105238_11112416
336 Ga0105249_11020408
337 Ga0105239_10527868
338 Ga0105239_11314459
339 Ga0157373_10232034
340 Ga0157373_11006921
341 Ga0157370_10020234
342 Ga0157370_10342646
343 Ga0157374_10585390
344 Ga0157378_10738694
345 Ga0157372_10003896
346 Ga0157372_10066438
347 Ga0157372_10121025
348 Ga0157372_10900707
349 Ga0157372_11031611
350 Ga0163163_10000118
351 Ga0157379_10169488
352 Ga0207425_1020932
353 Ga0209676_1000916
354 Ga0207696_1000164
355 Ga0207696_1010206
356 Ga0207696_1012464
357 Ga0207655_1001759
358 Ga0207655_1033908
359 Ga0207655_1056555
360 Ga0207655_1059725
361 Ga0207655_1079754
362 Ga0207713_1011826
363 Ga0207713_1035852
364 Ga0207713_1057409
365 Ga0207682_10015463
366 Ga0207710_10186969
367 Ga0207680_10038697
368 Ga0207645_10259444
369 Ga0207705_10378644
370 Ga0207681_10002041
371 Ga0207694_10832429
372 Ga0207650_10000013
373 Ga0207650_10887222
374 Ga0207659_10400264
375 Ga0207659_10858604
376 Ga0207664_10129878
377 Ga0207644_10000015
378 Ga0207644_10191736
379 Ga0207706_10349531
380 Ga0207709_10178142
381 Ga0207709_10200555
382 Ga0207669_10056495
383 Ga0207691_10473276
384 Ga0207711_10000103
385 Ga0207711_10000277
386 Ga0207661_10414675
387 Ga0207651_10218503
388 Ga0207712_10586416
389 Ga0207658_10000005
390 Ga0207677_10807195
391 Ga0207703_10005017
392 Ga0207641_10014806
393 Ga0207648_10551929
394 Ga0207676_10000010
395 Ga0207675_101508860
396 Ga0209389_1003256
397 Ga0209971_1001142
398 Ga0209974_10002118
399 Ga0268266_10001307
400 Ga0268266_10011282
401 Ga0268266_10404323
402 Ga0268265_10001515
403 Ga0268265_10516351
404 Ga0268264_10000036
405 Ga0265324_10152337
406 Ga0265339_10365907
407 Ga0307408_100000042
408 Ga0316576_10025375
409 Ga0316576_10041780
410 Ga0316576_10047640
411 Ga0316576_10956975
412 Ga0316578_10018268
413 Ga0316578_10151875
414 Ga0316577_10022272
415 Ga0307410_10155625
416 Ga0307416_100204838
417 Ga0316580_10044096
418 Ga0316574_0005602
419 Ga0316574_0042546
420 Ga0316574_0130457
421 Ga0316584_0044691
422 Ga0395899_0165771
423 Ga0395900_0018581
424 Ga0395901_1832267
425 Ga0439438_002786
426 Ga0439438_019366
427 Ga0439447_002283
428 Ga0439461_0028974
429 Ga0439466_0002286
430 Ga0451787_493771
431 Ga0451795_0299074
432 Ga0451795_0399164
433 Ga0451795_1023846
434 Ga0451795_1614724
435 Ga0451802_2066254
436 Ga0451855_0628583
437 Ga0439431_0004888
438 Ga0439431_0042479
439 Ga0439437_004137
440 Ga0439432_002084
441 Ga0439432_002805
442 Ga0439452_019132
443 Ga0450911_000008
444 Ga0450900_004026
445 Ga0450904_000727
446 Ga0450905_010691
447 Ga0439446_0017432
448 Ga0439434_0004422
449 Ga0439434_0099091
450 Ga0439459_0007443
451 Ga0439464_0019764
452 Ga0439464_0028043
453 Ga0450916_000732
454 Ga0450916_004455
455 Ga0451577_0894782
456 Ga0453683_0070802
457 Ga0453683_0085034
458 Ga0453683_0129296
459 Ga0453683_0309741
460 Ga0453683_0696159
461 Ga0453684_0106831
462 Ga0453684_0217267
463 Ga0453684_0355392
464 Ga0453684_0491722
465 Ga0451576_0000003
466 Ga0495653_0177077
467 Ga0495580_0528230
468 Ga0495582_0272072
469 Ga0495596_0125225
470 Ga0495620_0000003
471 Ga0495630_0001744
472 Ga0495632_0005859
473 Ga0495643_0000712
474 Ga0495643_0008742
475 Ga0495648_0011710
476 Ga0495666_0168486
477 Ga0495586_0425341
478 Ga0496109_0478435
479 Ga0496110_0367655
480 Ga0496114_0339932
481 Ga0496116_0138519
482 Ga0496117_0016215
483 Ga0496117_0131800
484 Ga0496118_0021388
485 Ga0496119_0000207
486 Ga0496119_0205510
487 Ga0496120_0001363
488 Ga0496121_0118367
489 Ga0496121_0170880
490 Ga0496122_0161570
491 Ga0496123_0194703
492 Ga0496124_0027019
493 Ga0496124_0041281
494 Ga0496124_0136556
495 Ga0496125_0007893
496 Ga0496126_0443135
497 Ga0501308_030210
498 Ga0501314_012754
499 Ga0501034_0014288
500 Ga0501034_0014888
501 Ga0501047_0191367
502 Ga0501225_0063171
503 Ga0501080_0074071
504 Ga0501044_0025742
505 Ga0501226_000005
506 nmdc:mga09592_453806_c1
507 nmdc:mga0qj67_214985_c1
508 nmdc:mga0qj67_297132_c1
509 nmdc:mga06r32_228023_c1
510 nmdc:mga06r32_258386_c1
511 nmdc:mga0sz30_268476_c1
512 Ga0500659_0007453
513 2511375531
514 2555245886
515 2600446506
516 2602010431
517 2765582323
518 2807409826
519 2807458174
520 2808904840
521 2812371023
522 2823422976
523 2890806669
524 2919158802
525 2919505632
526 2923525130
527 2926067309
528 3007808638
529 3007874440
530 640487493
531 8002745868
532 8034964095
533 8036737634
534 8052495775
535 8054929585
536 8056120163
537 8056141777
538 8057162602

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

32

195

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9417 1 185
5mlc-assembly1.cif.gz_9 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9189 103 185
5jsn-assembly2.cif.gz_D bcl2-inhibitor complex 0.9188 1 182
3lhp-assembly1.cif.gz_S crystal structure of hiv epitope-scaffold 4e10_d0_1isea_004_n 4e10 fv complex 0.9146 1 183
5jsb-assembly1.cif.gz_B crystal structure of mcl1-inhibitor complex 0.9139 103 182
ID Description Score Start End Superfamily
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9973 31 105 3.30.1360.40
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9915 3 185 1.10.132.20
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9877 106 179 1.10.132.20
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9842 31 105 3.30.1360.40
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9836 3 185 1.10.132.20
ID Description Score Start End GO Terms
AF-A0A3B9XQ89-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9928 1 184 GO:0002184
GO:0005829
GO:0043023
AF-A0A420VBI8-F1-model_v4 Multifunctional fusion protein [Includes: Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK); Ribosome-recycling factor (RRF) (Ribosome-releasing factor)] 0.9876 1 185 GO:0005524
GO:0005737
GO:0006225
GO:0006415
GO:0033862
GO:0044210
AF-A0A2A4RE35-F1-model_v4 Ribosome recycling factor 0.9872 1 129 GO:0002184
GO:0005829
GO:0043023
AF-Q7MIG3-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.987 1 185 GO:0002184
GO:0005829
GO:0043023
AF-A0A6L8FMD9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.987 14 185 GO:0005737
GO:0006415
GO:0043023

Map