F376552

General Info

Members Datasets Scaffolds Average Seq Length
269 166 538 125

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000009|Ga0500616_0000009_504959_505414
Length 151
Sequence MHFPIFRFSPIFGPLKISLTTLKFPLNMNIPDSLKYTKDHEWVKIEGNTATVGITDFAQGELGDIVYVDITSVGQEIAAHEIFGTVEAVKTVSDLYMPVGGKVLELNAILDGSPEKVNEDPYGDGWMIKIQISGSTNDLLSAAQYKELIGK

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
139 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
140 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
143 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
144 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
145 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
149 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
152 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
164 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 1.12
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 16.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000009 3300053153 Bacteria 779095
2 SwRhRL2b_contig_1759593 2162886007 Bacteria 266684
3 JGI24736J21556_1033868 3300001904 Unclassified 788
4 JGI24746J21847_1036130 3300001977 Bacteria 684
5 JGI24737J22298_10151344 3300001990 Unclassified 685
6 rootH1_10028492 3300003316 Bacteria 13537
7 rootH2_10000767 3300003320 Bacteria 103925
8 rootH2_10080527 3300003320 Bacteria 4897
9 rootH2_10147035 3300003320 Bacteria 2969
10 rootL2_10004785 3300003322 Bacteria 19054
11 rootL2_10042068 3300003322 Bacteria 14556
12 rootL2_10073219 3300003322 Bacteria 3982
13 rootH1_10000606 3300003323 Bacteria 38865
14 rootH1_10001507 3300003323 Bacteria 79355
15 rootH1_10008472 3300003323 Bacteria 18181
16 rootH1_10052348 3300003323 Bacteria 2385
17 rootH1_10052349 3300003323 Bacteria 2415
18 rootH1_10072596 3300003323 Bacteria 5936
19 rootH1_10167191 3300003323 Bacteria 3700
20 rootH1_10179536 3300003323 Bacteria 2491
21 Ga0055530_10082010 3300003791 Bacteria 675
22 Ga0065165_1001227 3300005262 Bacteria 29406
23 Ga0065165_1016469 3300005262 Bacteria 2766
24 Ga0065704_10070133 3300005289 Bacteria 1266035
25 Ga0065712_10188956 3300005290 Bacteria 1157
26 Ga0065715_10117379 3300005293 Bacteria 2350
27 Ga0070658_10100916 3300005327 Bacteria 2386
28 Ga0070658_11100598 3300005327 Bacteria 691
29 Ga0070658_11296021 3300005327 Bacteria 633
30 Ga0070683_100342567 3300005329 Bacteria 1423
31 Ga0070683_102093952 3300005329 Unclassified 543
32 Ga0070670_100091646 3300005331 Unclassified 2613
33 Ga0070670_100162564 3300005331 Bacteria 1935
34 Ga0070670_100287923 3300005331 Bacteria 1435
35 Ga0070682_101199883 3300005337 Archaea 640
36 Ga0070660_100033239 3300005339 Bacteria 3886
37 Ga0070660_100893000 3300005339 Bacteria 749
38 Ga0070660_101132160 3300005339 Unclassified 663
39 Ga0070671_100072402 3300005355 Bacteria 2878
40 Ga0070671_100177197 3300005355 Bacteria 1804
41 Ga0070673_102021005 3300005364 Bacteria 547
42 Ga0070659_100001893 3300005366 Bacteria 14974
43 Ga0070659_100028618 3300005366 Bacteria 4305
44 Ga0070659_101424391 3300005366 Unclassified 616
45 Ga0070667_100690051 3300005367 Unclassified 944
46 Ga0070706_101040890 3300005467 Unclassified 754
47 Ga0070684_100377671 3300005535 Bacteria 1305
48 Ga0068853_100138717 3300005539 Unclassified 2182
49 Ga0068853_100612227 3300005539 Bacteria 1035
50 Ga0068853_100648235 3300005539 Bacteria 1005
51 Ga0068853_100778843 3300005539 Bacteria 915
52 Ga0068853_101070209 3300005539 Bacteria 777
53 Ga0068853_101747277 3300005539 Unclassified 603
54 Ga0070672_100223406 3300005543 Bacteria 1580
55 Ga0070665_100001634 3300005548 Bacteria 25840
56 Ga0068855_100438308 3300005563 Bacteria 1427
57 Ga0070664_100107128 3300005564 Bacteria 2436
58 Ga0070664_100421630 3300005564 Bacteria 1222
59 Ga0068857_100107931 3300005577 Unclassified 2501
60 Ga0068857_100349622 3300005577 Unclassified 1369
61 Ga0068857_100606942 3300005577 Bacteria 1035
62 Ga0068857_100863947 3300005577 Bacteria 866
63 Ga0068854_100084390 3300005578 Bacteria 2350
64 Ga0068856_100587243 3300005614 Bacteria 1135
65 Ga0068856_101205050 3300005614 Bacteria 773
66 Ga0068852_100127915 3300005616 Bacteria 2335
67 Ga0068852_100291541 3300005616 Bacteria 1576
68 Ga0068852_100999965 3300005616 Unclassified 855
69 Ga0068852_101327889 3300005616 Bacteria 741
70 Ga0068859_100491007 3300005617 Unclassified 1323
71 Ga0068864_101010555 3300005618 Bacteria 825
72 Ga0068864_101861395 3300005618 Bacteria 607
73 Ga0068861_100384306 3300005719 Unclassified 1241
74 Ga0068851_10013246 3300005834 Bacteria 3902
75 Ga0068862_102673315 3300005844 Bacteria 511
76 Ga0081539_10129347 3300005985 Bacteria 1243
77 Ga0075428_100010645 3300006844 Bacteria 10221
78 Ga0075430_100203669 3300006846 Bacteria 1643
79 Ga0075431_100718787 3300006847 Bacteria 976
80 Ga0097620_100491054 3300006931 Unclassified 1323
81 Ga0099795_10516731 3300007788 Unclassified 559
82 Ga0105240_10006415 3300009093 Bacteria 17296
83 Ga0105240_12579129 3300009093 Bacteria 525
84 Ga0111539_10082897 3300009094 Bacteria 3771
85 Ga0111539_10108763 3300009094 Bacteria 3254
86 Ga0114129_10959817 3300009147 Bacteria 1079
87 Ga0105241_10190925 3300009174 Bacteria 1705
88 Ga0105237_10086307 3300009545 Bacteria 3128
89 Ga0105237_10109528 3300009545 Bacteria 2754
90 Ga0105238_10402081 3300009551 Bacteria 1363
91 Ga0105239_10684620 3300010375 Bacteria 1172
92 Ga0105239_10684622 3300010375 Bacteria 1172
93 Ga0157371_10005209 3300013102 Bacteria 11052
94 Ga0157371_10823010 3300013102 Bacteria 701
95 Ga0157370_10656499 3300013104 Unclassified 958
96 Ga0157370_11428401 3300013104 Bacteria 622
97 Ga0157369_10208942 3300013105 Bacteria 2047
98 Ga0157369_10444477 3300013105 Unclassified 1343
99 Ga0157374_10131068 3300013296 Unclassified 2426
100 Ga0157372_10022039 3300013307 Bacteria 6888
101 Ga0157372_10065195 3300013307 Bacteria 4089
102 Ga0157372_10101582 3300013307 Bacteria 3283
103 Ga0157372_10164426 3300013307 Bacteria 2566
104 Ga0157372_10209050 3300013307 Bacteria 2261
105 Ga0157372_10259521 3300013307 Bacteria 2018
106 Ga0157372_10315053 3300013307 Bacteria 1821
107 Ga0157372_10329635 3300013307 Bacteria 1777
108 Ga0157372_10681535 3300013307 Bacteria 1196
109 Ga0157372_10949805 3300013307 Bacteria 997
110 Ga0157372_11173382 3300013307 Bacteria 888
111 Ga0157372_11490252 3300013307 Bacteria 779
112 Ga0157372_11749286 3300013307 Unclassified 715
113 Ga0157375_13172057 3300013308 Bacteria 548
114 Ga0163163_10015885 3300014325 Bacteria 6973
115 Ga0163163_10600579 3300014325 Bacteria 1164
116 Ga0157380_10951977 3300014326 Bacteria 889
117 Ga0157380_11191517 3300014326 Bacteria 805
118 Ga0157377_10026055 3300014745 Bacteria 3125
119 Ga0209050_1002749 3300025298 Bacteria 14163
120 Ga0209257_1075894 3300025304 Bacteria 874
121 Ga0207656_10305377 3300025321 Bacteria 788
122 Ga0207647_10003135 3300025904 Bacteria 12418
123 Ga0207647_10053587 3300025904 Bacteria 2485
124 Ga0207705_10275132 3300025909 Bacteria 1288
125 Ga0207705_10503719 3300025909 Bacteria 941
126 Ga0207695_10007166 3300025913 Bacteria 14269
127 Ga0207671_10000728 3300025914 Bacteria 41791
128 Ga0207671_10583948 3300025914 Bacteria 891
129 Ga0207657_10706282 3300025919 Bacteria 783
130 Ga0207657_11356229 3300025919 Bacteria 535
131 Ga0207652_11472756 3300025921 Bacteria 585
132 Ga0207681_11532009 3300025923 Bacteria 559
133 Ga0207694_10107942 3300025924 Bacteria 2212
134 Ga0207650_10007076 3300025925 Bacteria 7646
135 Ga0207644_10045941 3300025931 Bacteria 3109
136 Ga0207644_10069655 3300025931 Unclassified 2569
137 Ga0207690_10017905 3300025932 Bacteria 4336
138 Ga0207690_10057990 3300025932 Bacteria 2617
139 Ga0207690_11229933 3300025932 Unclassified 625
140 Ga0207709_10001606 3300025935 Bacteria 15395
141 Ga0207661_10353354 3300025944 Bacteria 1326
142 Ga0207661_11715732 3300025944 Bacteria 573
143 Ga0207661_11900594 3300025944 Unclassified 541
144 Ga0207679_10048066 3300025945 Unclassified 3104
145 Ga0207679_10122709 3300025945 Bacteria 2071
146 Ga0207651_10844043 3300025960 Bacteria 814
147 Ga0207651_11774582 3300025960 Bacteria 555
148 Ga0207658_10485256 3300025986 Bacteria 1099
149 Ga0207639_10086344 3300026041 Unclassified 2498
150 Ga0207639_10505620 3300026041 Bacteria 1105
151 Ga0207639_10547690 3300026041 Bacteria 1062
152 Ga0207639_10737408 3300026041 Bacteria 915
153 Ga0207648_11045756 3300026089 Bacteria 765
154 Ga0207676_10356794 3300026095 Bacteria 1354
155 Ga0207674_10181309 3300026116 Unclassified 2057
156 Ga0207674_11244147 3300026116 Bacteria 714
157 Ga0207675_100663663 3300026118 Unclassified 1050
158 Ga0207698_10036510 3300026142 Bacteria 3608
159 Ga0207698_10276294 3300026142 Bacteria 1551
160 Ga0207698_11559521 3300026142 Bacteria 676
161 Ga0268266_10001407 3300028379 Bacteria 28741
162 Ga0307517_10477451 3300028786 Bacteria 640
163 Ga0265327_10000006 3300031251 Bacteria 693716
164 Ga0265327_10000038 3300031251 Bacteria 292416
165 Ga0265327_10002974 3300031251 Bacteria 16860
166 Ga0265327_10059291 3300031251 Bacteria 1961
167 Ga0307513_10122136 3300031456 Bacteria 2569
168 Ga0307509_10702372 3300031507 Bacteria 678
169 Ga0307408_100043471 3300031548 Bacteria 3197
170 Ga0307408_100793915 3300031548 Bacteria 859
171 Ga0307405_10106099 3300031731 Bacteria 1894
172 Ga0307406_10243647 3300031901 Bacteria 1350
173 Ga0307407_10043096 3300031903 Bacteria 2535
174 Ga0307412_10130730 3300031911 Bacteria 1823
175 Ga0307412_11658281 3300031911 Bacteria 585
176 Ga0307416_100000031 3300032002 Bacteria 159059
177 Ga0307416_100001911 3300032002 Bacteria 11624
178 Ga0307416_102770379 3300032002 Bacteria 586
179 Ga0307414_10311313 3300032004 Bacteria 1336
180 Ga0307411_11022159 3300032005 Unclassified 741
181 Ga0307415_100000951 3300032126 Bacteria 13333
182 Ga0307415_100661739 3300032126 Unclassified 938
183 Ga0395899_0039370 3300037312 Bacteria 3538
184 Ga0395900_0086607 3300037418 Bacteria 3219
185 Ga0395900_0194917 3300037418 Unclassified 2053
186 Ga0395905_0003427 3300037471 Bacteria 16971
187 Ga0395905_0014030 3300037471 Bacteria 7661
188 Ga0395905_0066812 3300037471 Bacteria 3367
189 Ga0395905_0110429 3300037471 Bacteria 2582
190 Ga0395905_0650237 3300037471 Bacteria 956
191 Ga0395905_0703621 3300037471 Bacteria 913
192 Ga0395901_0063048 3300038443 Bacteria 3857
193 Ga0451800_1526366 3300041459 Bacteria 578
194 Ga0451833_1286260 3300041491 Bacteria 705
195 Ga0439435_0040983 3300042436 Bacteria 1296
196 Ga0451577_0000547 3300042876 Bacteria 61495
197 Ga0451577_0000939 3300042876 Bacteria 42828
198 Ga0451577_0008113 3300042876 Bacteria 10249
199 Ga0451577_0088817 3300042876 Bacteria 2758
200 Ga0451577_0697868 3300042876 Bacteria 919
201 Ga0466972_0490792 3300044658 Bacteria 578
202 Ga0466982_0108672 3300044672 Bacteria 1716
203 Ga0453684_0000039 3300044712 Bacteria 697730
204 Ga0453684_0032545 3300044712 Bacteria 7295
205 Ga0453684_0528484 3300044712 Bacteria 1302
206 Ga0453684_2279841 3300044712 Bacteria 539
207 Ga0466970_0725773 3300044765 Bacteria 580
208 Ga0466957_1150673 3300044842 Bacteria 560
209 Ga0451576_0004317 3300045051 Bacteria 18569
210 Ga0451576_0059412 3300045051 Bacteria 3991
211 Ga0451576_0588118 3300045051 Bacteria 1170
212 Ga0466967_2010913 3300045976 Bacteria 574
213 Ga0495638_0000001 3300046460 Bacteria 1114121
214 Ga0495632_0209812 3300046519 Bacteria 884
215 Ga0495643_0014118 3300046522 Bacteria 4761
216 Ga0495633_0080047 3300046558 Bacteria 1521
217 Ga0495668_0023534 3300046616 Bacteria 3511
218 Ga0495661_0565553 3300046665 Bacteria 537
219 Ga0495670_0413009 3300046691 Bacteria 730
220 Ga0495636_0000022 3300047318 Bacteria 72235
221 Ga0496110_0391976 3300048913 Unclassified 1266
222 Ga0496115_0039839 3300048918 Bacteria 3733
223 Ga0496122_0000188 3300048925 Bacteria 143808
224 Ga0496123_0021919 3300048926 Bacteria 4946
225 Ga0501291_012965 3300049514 Unclassified 1227
226 Ga0501033_0582832 3300049570 Bacteria 768
227 Ga0501040_0638210 3300049576 Bacteria 770
228 Ga0501068_0535807 3300049584 Unclassified 761
229 Ga0501073_0215995 3300049589 Bacteria 1325
230 Ga0501076_0057286 3300049592 Bacteria 3094
231 Ga0501077_0009097 3300049593 Bacteria 6165
232 Ga0501201_022698 3300049651 Unclassified 674
233 Ga0501202_012394 3300049652 Unclassified 1608
234 Ga0501217_166501 3300049661 Unclassified 668
235 Ga0501217_320474 3300049661 Bacteria 516
236 Ga0501222_004522 3300049662 Bacteria 1889
237 Ga0501240_019407 3300049673 Unclassified 1010
238 Ga0501242_005824 3300049674 Unclassified 1396
239 Ga0501249_012041 3300049679 Bacteria 1825
240 Ga0501250_000575 3300049680 Bacteria 2564
241 Ga0501251_002135 3300049681 Bacteria 1891
242 Ga0501251_008755 3300049681 Unclassified 1151
243 Ga0501253_033886 3300049683 Bacteria 991
244 Ga0501257_006726 3300049686 Bacteria 2557
245 Ga0501225_0025047 3300049705 Unclassified 1642
246 Ga0501079_0130072 3300049741 Bacteria 1959
247 Ga0501263_001472 3300049760 Bacteria 2226
248 Ga0501266_001621 3300049763 Bacteria 2868
249 Ga0501266_013282 3300049763 Bacteria 1070
250 Ga0501266_021230 3300049763 Unclassified 887
251 Ga0501268_006478 3300049765 Bacteria 1720
252 Ga0501270_043996 3300049767 Unclassified 787
253 Ga0501276_002755 3300049773 Unclassified 1251
254 Ga0501283_096686 3300049779 Bacteria 571
255 Ga0501035_0268576 3300049822 Bacteria 1444
256 Ga0501044_0024855 3300049823 Bacteria 6354
257 Ga0501044_1584116 3300049823 Bacteria 520
258 Ga0501284_01186 3300050005 Bacteria 1371
259 nmdc:mga09592_1172246_c1 3300050508 Bacteria 636
260 nmdc:mga0qj67_972812_c1 3300050509 Bacteria 667
261 nmdc:mga06r32_125475_c1 3300050510 Bacteria 2535
262 nmdc:mga08y16_180231_c1 3300050511 Bacteria 2194
263 nmdc:mga08y16_32296_c1 3300050511 Bacteria 5504
264 Ga0500651_0626195 3300053093 Unclassified 581
265 Ga0500556_0121796 3300053104 Bacteria 1018
266 Ga0500557_004929 3300053105 Bacteria 2865
267 Ga0500655_004610 3300053133 Bacteria 2477
268 Ga0500645_161727 3300053730 Bacteria 614
269 Ga0501084_0487416 3300054114 Bacteria 1042
270 Ga0500616_0000009
271 SwRhRL2b_contig_1759593
272 JGI24736J21556_1033868
273 JGI24746J21847_1036130
274 JGI24737J22298_10151344
275 rootH1_10028492
276 rootH2_10000767
277 rootH2_10080527
278 rootH2_10147035
279 rootL2_10004785
280 rootL2_10042068
281 rootL2_10073219
282 rootH1_10000606
283 rootH1_10001507
284 rootH1_10008472
285 rootH1_10052348
286 rootH1_10052349
287 rootH1_10072596
288 rootH1_10167191
289 rootH1_10179536
290 Ga0055530_10082010
291 Ga0065165_1001227
292 Ga0065165_1016469
293 Ga0065704_10070133
294 Ga0065712_10188956
295 Ga0065715_10117379
296 Ga0070658_10100916
297 Ga0070658_11100598
298 Ga0070658_11296021
299 Ga0070683_100342567
300 Ga0070683_102093952
301 Ga0070670_100091646
302 Ga0070670_100162564
303 Ga0070670_100287923
304 Ga0070682_101199883
305 Ga0070660_100033239
306 Ga0070660_100893000
307 Ga0070660_101132160
308 Ga0070671_100072402
309 Ga0070671_100177197
310 Ga0070673_102021005
311 Ga0070659_100001893
312 Ga0070659_100028618
313 Ga0070659_101424391
314 Ga0070667_100690051
315 Ga0070706_101040890
316 Ga0070684_100377671
317 Ga0068853_100138717
318 Ga0068853_100612227
319 Ga0068853_100648235
320 Ga0068853_100778843
321 Ga0068853_101070209
322 Ga0068853_101747277
323 Ga0070672_100223406
324 Ga0070665_100001634
325 Ga0068855_100438308
326 Ga0070664_100107128
327 Ga0070664_100421630
328 Ga0068857_100107931
329 Ga0068857_100349622
330 Ga0068857_100606942
331 Ga0068857_100863947
332 Ga0068854_100084390
333 Ga0068856_100587243
334 Ga0068856_101205050
335 Ga0068852_100127915
336 Ga0068852_100291541
337 Ga0068852_100999965
338 Ga0068852_101327889
339 Ga0068859_100491007
340 Ga0068864_101010555
341 Ga0068864_101861395
342 Ga0068861_100384306
343 Ga0068851_10013246
344 Ga0068862_102673315
345 Ga0081539_10129347
346 Ga0075428_100010645
347 Ga0075430_100203669
348 Ga0075431_100718787
349 Ga0097620_100491054
350 Ga0099795_10516731
351 Ga0105240_10006415
352 Ga0105240_12579129
353 Ga0111539_10082897
354 Ga0111539_10108763
355 Ga0114129_10959817
356 Ga0105241_10190925
357 Ga0105237_10086307
358 Ga0105237_10109528
359 Ga0105238_10402081
360 Ga0105239_10684620
361 Ga0105239_10684622
362 Ga0157371_10005209
363 Ga0157371_10823010
364 Ga0157370_10656499
365 Ga0157370_11428401
366 Ga0157369_10208942
367 Ga0157369_10444477
368 Ga0157374_10131068
369 Ga0157372_10022039
370 Ga0157372_10065195
371 Ga0157372_10101582
372 Ga0157372_10164426
373 Ga0157372_10209050
374 Ga0157372_10259521
375 Ga0157372_10315053
376 Ga0157372_10329635
377 Ga0157372_10681535
378 Ga0157372_10949805
379 Ga0157372_11173382
380 Ga0157372_11490252
381 Ga0157372_11749286
382 Ga0157375_13172057
383 Ga0163163_10015885
384 Ga0163163_10600579
385 Ga0157380_10951977
386 Ga0157380_11191517
387 Ga0157377_10026055
388 Ga0209050_1002749
389 Ga0209257_1075894
390 Ga0207656_10305377
391 Ga0207647_10003135
392 Ga0207647_10053587
393 Ga0207705_10275132
394 Ga0207705_10503719
395 Ga0207695_10007166
396 Ga0207671_10000728
397 Ga0207671_10583948
398 Ga0207657_10706282
399 Ga0207657_11356229
400 Ga0207652_11472756
401 Ga0207681_11532009
402 Ga0207694_10107942
403 Ga0207650_10007076
404 Ga0207644_10045941
405 Ga0207644_10069655
406 Ga0207690_10017905
407 Ga0207690_10057990
408 Ga0207690_11229933
409 Ga0207709_10001606
410 Ga0207661_10353354
411 Ga0207661_11715732
412 Ga0207661_11900594
413 Ga0207679_10048066
414 Ga0207679_10122709
415 Ga0207651_10844043
416 Ga0207651_11774582
417 Ga0207658_10485256
418 Ga0207639_10086344
419 Ga0207639_10505620
420 Ga0207639_10547690
421 Ga0207639_10737408
422 Ga0207648_11045756
423 Ga0207676_10356794
424 Ga0207674_10181309
425 Ga0207674_11244147
426 Ga0207675_100663663
427 Ga0207698_10036510
428 Ga0207698_10276294
429 Ga0207698_11559521
430 Ga0268266_10001407
431 Ga0307517_10477451
432 Ga0265327_10000006
433 Ga0265327_10000038
434 Ga0265327_10002974
435 Ga0265327_10059291
436 Ga0307513_10122136
437 Ga0307509_10702372
438 Ga0307408_100043471
439 Ga0307408_100793915
440 Ga0307405_10106099
441 Ga0307406_10243647
442 Ga0307407_10043096
443 Ga0307412_10130730
444 Ga0307412_11658281
445 Ga0307416_100000031
446 Ga0307416_100001911
447 Ga0307416_102770379
448 Ga0307414_10311313
449 Ga0307411_11022159
450 Ga0307415_100000951
451 Ga0307415_100661739
452 Ga0395899_0039370
453 Ga0395900_0086607
454 Ga0395900_0194917
455 Ga0395905_0003427
456 Ga0395905_0014030
457 Ga0395905_0066812
458 Ga0395905_0110429
459 Ga0395905_0650237
460 Ga0395905_0703621
461 Ga0395901_0063048
462 Ga0451800_1526366
463 Ga0451833_1286260
464 Ga0439435_0040983
465 Ga0451577_0000547
466 Ga0451577_0000939
467 Ga0451577_0008113
468 Ga0451577_0088817
469 Ga0451577_0697868
470 Ga0466972_0490792
471 Ga0466982_0108672
472 Ga0453684_0000039
473 Ga0453684_0032545
474 Ga0453684_0528484
475 Ga0453684_2279841
476 Ga0466970_0725773
477 Ga0466957_1150673
478 Ga0451576_0004317
479 Ga0451576_0059412
480 Ga0451576_0588118
481 Ga0466967_2010913
482 Ga0495638_0000001
483 Ga0495632_0209812
484 Ga0495643_0014118
485 Ga0495633_0080047
486 Ga0495668_0023534
487 Ga0495661_0565553
488 Ga0495670_0413009
489 Ga0495636_0000022
490 Ga0496110_0391976
491 Ga0496115_0039839
492 Ga0496122_0000188
493 Ga0496123_0021919
494 Ga0501291_012965
495 Ga0501033_0582832
496 Ga0501040_0638210
497 Ga0501068_0535807
498 Ga0501073_0215995
499 Ga0501076_0057286
500 Ga0501077_0009097
501 Ga0501201_022698
502 Ga0501202_012394
503 Ga0501217_166501
504 Ga0501217_320474
505 Ga0501222_004522
506 Ga0501240_019407
507 Ga0501242_005824
508 Ga0501249_012041
509 Ga0501250_000575
510 Ga0501251_002135
511 Ga0501251_008755
512 Ga0501253_033886
513 Ga0501257_006726
514 Ga0501225_0025047
515 Ga0501079_0130072
516 Ga0501263_001472
517 Ga0501266_001621
518 Ga0501266_013282
519 Ga0501266_021230
520 Ga0501268_006478
521 Ga0501270_043996
522 Ga0501276_002755
523 Ga0501283_096686
524 Ga0501035_0268576
525 Ga0501044_0024855
526 Ga0501044_1584116
527 Ga0501284_01186
528 nmdc:mga09592_1172246_c1
529 nmdc:mga0qj67_972812_c1
530 nmdc:mga06r32_125475_c1
531 nmdc:mga08y16_180231_c1
532 nmdc:mga08y16_32296_c1
533 Ga0500651_0626195
534 Ga0500556_0121796
535 Ga0500557_004929
536 Ga0500655_004610
537 Ga0500645_161727
538 Ga0501084_0487416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

34

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9784 2 124
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9755 1 123
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9748 6 124
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.96 2 124
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9555 2 124
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9744 6 124 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9696 7 122 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9687 6 125 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9527 20 125 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9427 5 125 2.40.50.100
ID Description Score Start End GO Terms
AF-I4AGP6-F1-model_v4 Glycine cleavage system H protein 1 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A7D4ULF5-F1-model_v4 Glycine cleavage system H protein 0.9993 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A1H9G454-F1-model_v4 Glycine cleavage system H protein 0.9988 1 124 GO:0005829
GO:0005960
GO:0019464
AF-A0A3E1Y9Y3-F1-model_v4 Glycine cleavage system H protein 0.9985 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A3M7TI61-F1-model_v4 Glycine cleavage system H protein 0.9972 1 125 GO:0005829
GO:0005960
GO:0019464

Map