F376575

General Info

Members Datasets Scaffolds Average Seq Length
269 194 538 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581304|2585257867
Length 276
Sequence FCDVVRPAVAVYIWEVSKQRKSKPMKTVLITGCSSGFGLETARYFLERDWNVVATMRRPRPDVLPQSDRLRMIALDVTDADSIRNAVELAGPIDVLVNNAGIGWLNALEGTPMDTVRDLFETNTIGTMAMTQAVLPQFRARREGVIVNVTSTVTLKPLHLLSAYTASKAAVNAFTEVLALELAPFNIRARLVLPGRAPDTRFGENAQSRMREAASGFPEPYAELVQSIFAQWAEQPADQITRAVDVAEAIWRSATDPSCPMRLPAGTDAVALAAQV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
157 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
158 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
159 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
160 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
161 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
162 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
163 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
164 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
165 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
166 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
167 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
168 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
169 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
170 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
171 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
172 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
173 2818991457 Xanthomonas translucens 569 Isolate Unclassified
174 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
175 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
176 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
177 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
178 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
179 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
180 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
181 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
182 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
183 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
184 2904424332 Duganella sp. 1411 Isolate Rhizosphere
185 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
186 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
187 2919085039 Luteibacter sp. 1214 Isolate Unclassified
188 2919404418 Luteibacter sp. 3190 Isolate Unclassified
189 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
190 2928163908 Burkholderia sp. 567 Isolate Unclassified
191 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
192 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
193 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
194 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.5
Metatranscriptomes 0.37
Isolates 14.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.47
Nodule 2.23
Rhizoplane 7.43
Rhizosphere 45.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2661064 2162886007 Bacteria 9256
2 JGI25162J39368_1000328 3300002737 Bacteria 41728
3 JGI25151J46595_10024808 3300003187 Bacteria 2448
4 JGI25165J46597_1000543 3300003214 Bacteria 34671
5 rootH2_10056573 3300003320 Bacteria 2344
6 rootH1_10023100 3300003323 Bacteria 3285
7 JGI25160J50197_1000037 3300003354 Bacteria 162757
8 Ga0006562J51391_1064121 3300003578 Bacteria 1346
9 Ga0055533_1001040 3300003756 Bacteria 8028
10 Ga0055532_1000231 3300003758 Bacteria 41528
11 Ga0055527_1000188 3300003760 Bacteria 41528
12 Ga0055535_1000592 3300003761 Bacteria 29980
13 Ga0055542_1004297 3300003762 Bacteria 3507
14 Ga0055529_1004065 3300003763 Bacteria 2285
15 Ga0058692_1000028 3300003856 Bacteria 193757
16 Ga0065165_1000668 3300005262 Bacteria 49417
17 Ga0065704_10070292 3300005289 Bacteria 38337
18 Ga0070658_10066074 3300005327 Bacteria 2954
19 Ga0070683_100469064 3300005329 Bacteria 1202
20 Ga0070670_100001975 3300005331 Bacteria 16781
21 Ga0070660_100000361 3300005339 Bacteria 30309
22 Ga0070659_100000078 3300005366 Bacteria 74646
23 Ga0070663_100001118 3300005455 Bacteria 14751
24 Ga0070663_100244130 3300005455 Bacteria 1419
25 Ga0068855_100154659 3300005563 Bacteria 2606
26 Ga0068857_100053009 3300005577 Bacteria 3599
27 Ga0068852_100049181 3300005616 Bacteria 3606
28 Ga0068858_100844277 3300005842 Bacteria 894
29 Ga0075364_10012226 3300006051 Bacteria 5244
30 Ga0075366_10247888 3300006195 Bacteria 1086
31 Ga0105251_10000075 3300009011 Bacteria 94904
32 Ga0105251_10024598 3300009011 Bacteria 3090
33 Ga0105250_10041042 3300009092 Bacteria 1855
34 Ga0105240_10006962 3300009093 Bacteria 16517
35 Ga0105240_10007101 3300009093 Bacteria 16325
36 Ga0105237_10027009 3300009545 Bacteria 5862
37 Ga0105237_10062702 3300009545 Bacteria 3717
38 Ga0105238_10039043 3300009551 Bacteria 4817
39 Ga0105238_10185516 3300009551 Bacteria 2056
40 Ga0105239_10044770 3300010375 Bacteria 4850
41 Ga0157370_10034099 3300013104 Bacteria 4959
42 Ga0157370_10417080 3300013104 Bacteria 1235
43 Ga0157372_10154438 3300013307 Bacteria 2650
44 Ga0182006_1000522 3300015261 Bacteria 29222
45 Ga0182006_1054838 3300015261 Bacteria 1523
46 Ga0182005_1000004 3300015265 Bacteria 609645
47 Ga0182005_1001161 3300015265 Bacteria 10905
48 Ga0182005_1008657 3300015265 Bacteria 2989
49 Ga0163161_10186154 3300017792 Bacteria 1594
50 Ga0209760_103056 3300025207 Bacteria 1509
51 Ga0209674_100155 3300025226 Bacteria 91885
52 Ga0209674_106127 3300025226 Bacteria 1678
53 Ga0209672_100020 3300025228 Bacteria 429003
54 Ga0209147_100024 3300025229 Bacteria 429003
55 Ga0207427_107248 3300025231 Bacteria 1316
56 Ga0209437_100051 3300025233 Bacteria 392523
57 Ga0209258_100121 3300025242 Bacteria 180843
58 Ga0209148_1000458 3300025254 Bacteria 44146
59 Ga0209148_1001123 3300025254 Bacteria 15827
60 Ga0209759_1000138 3300025256 Bacteria 125136
61 Ga0209233_1000069 3300025261 Bacteria 367639
62 Ga0209233_1011612 3300025261 Bacteria 2591
63 Ga0209455_1000263 3300025272 Bacteria 60487
64 Ga0209025_1000079 3300025294 Bacteria 270973
65 Ga0209758_1053433 3300025297 Bacteria 1388
66 Ga0207426_1000004 3300025302 Bacteria 1047900
67 Ga0209051_1004251 3300025303 Bacteria 8920
68 Ga0207713_1004521 3300025735 Bacteria 9009
69 Ga0207695_10000328 3300025913 Bacteria 113378
70 Ga0207695_10103454 3300025913 Bacteria 2839
71 Ga0207671_10030100 3300025914 Bacteria 4049
72 Ga0207671_10095979 3300025914 Bacteria 2239
73 Ga0207657_10000035 3300025919 Bacteria 125384
74 Ga0207694_10022992 3300025924 Bacteria 4731
75 Ga0207650_10026629 3300025925 Bacteria 4127
76 Ga0207690_10000007 3300025932 Bacteria 388533
77 Ga0207706_10269951 3300025933 Bacteria 1484
78 Ga0207709_10001926 3300025935 Bacteria 13633
79 Ga0207709_10489737 3300025935 Bacteria 957
80 Ga0207679_10433408 3300025945 Bacteria 1162
81 Ga0207667_10043062 3300025949 Bacteria 4793
82 Ga0207703_10694899 3300026035 Bacteria 967
83 Ga0207678_10000064 3300026067 Bacteria 83470
84 Ga0207678_10368033 3300026067 Bacteria 1241
85 Ga0207702_10149283 3300026078 Bacteria 2125
86 Ga0207698_10041860 3300026142 Bacteria 3418
87 Ga0209371_1000025 3300027312 Bacteria 450640
88 Ga0209371_1001418 3300027312 Bacteria 16379
89 Ga0209371_1001443 3300027312 Bacteria 16146
90 Ga0307517_10022636 3300028786 Bacteria 7864
91 Ga0307517_10123911 3300028786 Bacteria 1896
92 Ga0268256_1000027 3300030500 Bacteria 450640
93 Ga0268256_1002229 3300030500 Bacteria 10188
94 Ga0268256_1011377 3300030500 Bacteria 2817
95 Ga0307513_10071917 3300031456 Bacteria 3607
96 Ga0307408_100054357 3300031548 Bacteria 2895
97 Ga0307516_10010267 3300031730 Bacteria 10312
98 Ga0307405_10235258 3300031731 Bacteria 1353
99 Ga0307406_10016788 3300031901 Bacteria 4259
100 Ga0307412_10009087 3300031911 Bacteria 5695
101 Ga0307414_10212105 3300032004 Bacteria 1583
102 Ga0307414_10422781 3300032004 Bacteria 1162
103 Ga0307510_10000181 3300033180 Bacteria 54100
104 Ga0307510_10030169 3300033180 Bacteria 6152
105 Ga0307510_10205090 3300033180 Bacteria 1500
106 Ga0373960_0020303 3300035121 Bacteria 1755
107 Ga0373931_0054105 3300035691 Bacteria 2144
108 Ga0395905_0218452 3300037471 Bacteria 1784
109 Ga0395901_0917519 3300038443 Bacteria 857
110 Ga0436361_0690733 3300039447 Bacteria 1043
111 Ga0439436_0000009 3300041404 Bacteria 108375
112 Ga0439461_0005981 3300041410 Bacteria 2103
113 Ga0439466_0023087 3300041411 Bacteria 2190
114 Ga0439465_0001193 3300041413 Bacteria 8357
115 Ga0439465_0002056 3300041413 Bacteria 6599
116 Ga0451787_100051 3300041441 Bacteria 848
117 Ga0451793_1920026 3300041452 Bacteria 2866
118 Ga0451800_1458579 3300041459 Bacteria 2216
119 Ga0451802_1146121 3300041460 Bacteria 1487
120 Ga0451807_1506508 3300041486 Bacteria 1995
121 Ga0451853_0182881 3300041512 Bacteria 2103
122 Ga0439445_0007928 3300042004 Bacteria 2476
123 Ga0466982_0000045 3300044672 Bacteria 38024
124 Ga0466961_0144497 3300044693 Bacteria 1488
125 Ga0466957_0136051 3300044842 Bacteria 1579
126 Ga0466958_0000830 3300045836 Bacteria 13658
127 Ga0495638_0000346 3300046460 Bacteria 58330
128 Ga0495638_0134234 3300046460 Bacteria 1451
129 Ga0495650_0000399 3300046471 Bacteria 72364
130 Ga0495650_0001592 3300046471 Bacteria 21240
131 Ga0495650_0003026 3300046471 Bacteria 12688
132 Ga0495650_0008191 3300046471 Bacteria 6143
133 Ga0495650_0015083 3300046471 Bacteria 3982
134 Ga0495650_0026434 3300046471 Bacteria 2700
135 Ga0495582_0004182 3300046473 Bacteria 8115
136 Ga0495607_0008989 3300046501 Bacteria 6797
137 Ga0495607_0041974 3300046501 Bacteria 2714
138 Ga0495583_0018984 3300046506 Bacteria 3601
139 Ga0495606_0005337 3300046507 Bacteria 12355
140 Ga0495610_0000024 3300046512 Bacteria 304748
141 Ga0495610_0001774 3300046512 Bacteria 18868
142 Ga0495620_0025584 3300046515 Bacteria 2790
143 Ga0495628_0008629 3300046516 Bacteria 8732
144 Ga0495668_0001184 3300046616 Bacteria 26516
145 Ga0495611_0137182 3300046648 Bacteria 1142
146 Ga0495625_0001608 3300046660 Bacteria 26653
147 Ga0495661_0026579 3300046665 Bacteria 3727
148 Ga0495657_0007089 3300046675 Bacteria 8694
149 Ga0495624_0004602 3300046690 Bacteria 10062
150 Ga0495649_0040212 3300046694 Bacteria 2562
151 Ga0495660_0006156 3300046810 Bacteria 7121
152 Ga0495660_0037220 3300046810 Bacteria 2711
153 Ga0495660_0049872 3300046810 Bacteria 2283
154 Ga0495672_0000036 3300047320 Bacteria 279648
155 Ga0495679_023446 3300047446 Bacteria 2093
156 Ga0495679_055592 3300047446 Bacteria 1175
157 Ga0495686_0011019 3300047472 Bacteria 6394
158 Ga0495686_0128596 3300047472 Bacteria 1504
159 Ga0496100_0000070 3300048903 Bacteria 56600
160 Ga0496101_0000044 3300048904 Bacteria 161295
161 Ga0496101_0138500 3300048904 Bacteria 1853
162 Ga0496102_0000715 3300048905 Bacteria 32824
163 Ga0496103_0000213 3300048906 Bacteria 58012
164 Ga0496104_0030385 3300048907 Bacteria 5020
165 Ga0496104_0086835 3300048907 Bacteria 2987
166 Ga0496105_0051870 3300048908 Bacteria 3387
167 Ga0496105_0198400 3300048908 Bacteria 1638
168 Ga0496112_0348521 3300048915 Bacteria 1423
169 Ga0496114_0131561 3300048917 Bacteria 2161
170 Ga0496116_0000216 3300048919 Bacteria 108542
171 Ga0496117_0000098 3300048920 Bacteria 196331
172 Ga0496117_0005443 3300048920 Bacteria 13371
173 Ga0496117_0007740 3300048920 Bacteria 10382
174 Ga0496117_0015510 3300048920 Bacteria 6490
175 Ga0496117_0017153 3300048920 Bacteria 6060
176 Ga0496118_0000608 3300048921 Bacteria 58952
177 Ga0496118_0000625 3300048921 Bacteria 58119
178 Ga0496118_0002026 3300048921 Bacteria 28649
179 Ga0496118_0002119 3300048921 Bacteria 27797
180 Ga0496118_0010724 3300048921 Bacteria 9034
181 Ga0496119_0002070 3300048922 Bacteria 22680
182 Ga0496119_0004204 3300048922 Bacteria 14460
183 Ga0496119_0146713 3300048922 Bacteria 1268
184 Ga0496120_0002568 3300048923 Bacteria 18100
185 Ga0496120_0003369 3300048923 Bacteria 14648
186 Ga0496121_0000246 3300048924 Bacteria 114919
187 Ga0496121_0000644 3300048924 Bacteria 65162
188 Ga0496121_0018059 3300048924 Bacteria 7142
189 Ga0496121_0038538 3300048924 Bacteria 4228
190 Ga0496121_0221258 3300048924 Bacteria 1333
191 Ga0496122_0001796 3300048925 Bacteria 32863
192 Ga0496122_0003728 3300048925 Bacteria 19672
193 Ga0496122_0015531 3300048925 Bacteria 7271
194 Ga0496122_0033399 3300048925 Bacteria 4233
195 Ga0496122_0188789 3300048925 Bacteria 1219
196 Ga0496122_0294265 3300048925 Bacteria 879
197 Ga0496123_0002974 3300048926 Bacteria 19685
198 Ga0496123_0005440 3300048926 Bacteria 12823
199 Ga0496123_0021311 3300048926 Bacteria 5041
200 Ga0496123_0032903 3300048926 Bacteria 3742
201 Ga0496123_0080838 3300048926 Bacteria 1978
202 Ga0496123_0085292 3300048926 Bacteria 1900
203 Ga0496123_0091764 3300048926 Bacteria 1800
204 Ga0496123_0169778 3300048926 Bacteria 1152
205 Ga0496123_0346287 3300048926 Bacteria 693
206 Ga0496124_0000023 3300048927 Bacteria 415226
207 Ga0496124_0004196 3300048927 Bacteria 16963
208 Ga0496124_0078024 3300048927 Bacteria 2730
209 Ga0496124_0106006 3300048927 Bacteria 2270
210 Ga0496125_0071638 3300048928 Bacteria 2706
211 Ga0496126_0007073 3300048929 Bacteria 12359
212 Ga0496126_0103660 3300048929 Bacteria 2486
213 Ga0496126_0338366 3300048929 Bacteria 1233
214 Ga0495678_000770 3300049459 Bacteria 28951
215 nmdc:mga00v17_36778_c1 3300050491 Bacteria 2920
216 nmdc:mga0k408_80510_c1 3300050493 Bacteria 1907
217 nmdc:mga07m45_89187_c1 3300050496 Bacteria 1766
218 Ga0500635_0111958 3300053080 Bacteria 1015
219 Ga0500572_117946 3300053111 Bacteria 858
220 Ga0500594_0005854 3300053118 Bacteria 2737
221 Ga0500607_013384 3300053121 Bacteria 4789
222 Ga0500618_014166 3300053125 Bacteria 2043
223 Ga0500642_0014673 3300053130 Bacteria 2922
224 Ga0500658_0001403 3300053134 Bacteria 9716
225 Ga0500559_0000038 3300053136 Bacteria 109922
226 Ga0500559_0018600 3300053136 Bacteria 2935
227 Ga0500564_083698 3300053138 Bacteria 1427
228 Ga0500622_0001043 3300053156 Bacteria 23134
229 Ga0500622_0076912 3300053156 Bacteria 1677
230 Ga0500636_0001531 3300053177 Bacteria 12586
231 Ga0500661_008439 3300055283 Bacteria 1896
232 2585257867 2582581304 Bacteria 5831370
233 2509076479 2508501114 Bacteria 7082538
234 2511248133 2511231003 Bacteria 5606035
235 2515687178 2515154123 Bacteria 6387382
236 2523469634 2523231067 Bacteria 5230452
237 2527075843 2526164713 Bacteria 6780608
238 2585901130 2585427608 Bacteria 6544331
239 2588294768 2588253510 Bacteria 6901809
240 2595446269 2593339238 Bacteria 4182970
241 2599747352 2599185240 Bacteria 7968121
242 2600209023 2599185355 Bacteria 7968906
243 2676745051 2675903129 Bacteria 7964495
244 2739351603 2738543031 Bacteria 5769731
245 2787436737 2786546517 Bacteria 6614109
246 2809147119 2808606418 Bacteria 6724496
247 2819562737 2818991440 Bacteria 4774720
248 2819661469 2818991457 Bacteria 5323295
249 2842325415 2842324504 Bacteria 9364110
250 2842349694 2842348783 Bacteria 9002918
251 2842455070 2842454564 Bacteria 8730687
252 2842921986 2842918807 Bacteria 4289178
253 2852653737 2852653556 Bacteria 4050083
254 2852687336 2852684882 Bacteria 5463342
255 2854902202 2854896431 Bacteria 5869725
256 2870073451 2870068957 Bacteria 8925310
257 2885271747 2885270888 Bacteria 9831543
258 2902409033 2902405164 Bacteria 6784948
259 2904424859 2904424332 Bacteria 7633521
260 2904463347 2904463128 Bacteria 4775606
261 2904541946 2904541872 Bacteria 8915136
262 2919085301 2919085039 Bacteria 4532964
263 2919407983 2919404418 Bacteria 4232372
264 2928158447 2928157003 Bacteria 7522202
265 2928167338 2928163908 Bacteria 7561269
266 2929167235 2929160207 Bacteria 9075316
267 2981991915 2981990288 Bacteria 7590678
268 8020953195 8020945358 Bacteria 8467355
269 8046773045 8046767195 Bacteria 7547379
270 SwRhRL2b_contig_2661064
271 JGI25162J39368_1000328
272 JGI25151J46595_10024808
273 JGI25165J46597_1000543
274 rootH2_10056573
275 rootH1_10023100
276 JGI25160J50197_1000037
277 Ga0006562J51391_1064121
278 Ga0055533_1001040
279 Ga0055532_1000231
280 Ga0055527_1000188
281 Ga0055535_1000592
282 Ga0055542_1004297
283 Ga0055529_1004065
284 Ga0058692_1000028
285 Ga0065165_1000668
286 Ga0065704_10070292
287 Ga0070658_10066074
288 Ga0070683_100469064
289 Ga0070670_100001975
290 Ga0070660_100000361
291 Ga0070659_100000078
292 Ga0070663_100001118
293 Ga0070663_100244130
294 Ga0068855_100154659
295 Ga0068857_100053009
296 Ga0068852_100049181
297 Ga0068858_100844277
298 Ga0075364_10012226
299 Ga0075366_10247888
300 Ga0105251_10000075
301 Ga0105251_10024598
302 Ga0105250_10041042
303 Ga0105240_10006962
304 Ga0105240_10007101
305 Ga0105237_10027009
306 Ga0105237_10062702
307 Ga0105238_10039043
308 Ga0105238_10185516
309 Ga0105239_10044770
310 Ga0157370_10034099
311 Ga0157370_10417080
312 Ga0157372_10154438
313 Ga0182006_1000522
314 Ga0182006_1054838
315 Ga0182005_1000004
316 Ga0182005_1001161
317 Ga0182005_1008657
318 Ga0163161_10186154
319 Ga0209760_103056
320 Ga0209674_100155
321 Ga0209674_106127
322 Ga0209672_100020
323 Ga0209147_100024
324 Ga0207427_107248
325 Ga0209437_100051
326 Ga0209258_100121
327 Ga0209148_1000458
328 Ga0209148_1001123
329 Ga0209759_1000138
330 Ga0209233_1000069
331 Ga0209233_1011612
332 Ga0209455_1000263
333 Ga0209025_1000079
334 Ga0209758_1053433
335 Ga0207426_1000004
336 Ga0209051_1004251
337 Ga0207713_1004521
338 Ga0207695_10000328
339 Ga0207695_10103454
340 Ga0207671_10030100
341 Ga0207671_10095979
342 Ga0207657_10000035
343 Ga0207694_10022992
344 Ga0207650_10026629
345 Ga0207690_10000007
346 Ga0207706_10269951
347 Ga0207709_10001926
348 Ga0207709_10489737
349 Ga0207679_10433408
350 Ga0207667_10043062
351 Ga0207703_10694899
352 Ga0207678_10000064
353 Ga0207678_10368033
354 Ga0207702_10149283
355 Ga0207698_10041860
356 Ga0209371_1000025
357 Ga0209371_1001418
358 Ga0209371_1001443
359 Ga0307517_10022636
360 Ga0307517_10123911
361 Ga0268256_1000027
362 Ga0268256_1002229
363 Ga0268256_1011377
364 Ga0307513_10071917
365 Ga0307408_100054357
366 Ga0307516_10010267
367 Ga0307405_10235258
368 Ga0307406_10016788
369 Ga0307412_10009087
370 Ga0307414_10212105
371 Ga0307414_10422781
372 Ga0307510_10000181
373 Ga0307510_10030169
374 Ga0307510_10205090
375 Ga0373960_0020303
376 Ga0373931_0054105
377 Ga0395905_0218452
378 Ga0395901_0917519
379 Ga0436361_0690733
380 Ga0439436_0000009
381 Ga0439461_0005981
382 Ga0439466_0023087
383 Ga0439465_0001193
384 Ga0439465_0002056
385 Ga0451787_100051
386 Ga0451793_1920026
387 Ga0451800_1458579
388 Ga0451802_1146121
389 Ga0451807_1506508
390 Ga0451853_0182881
391 Ga0439445_0007928
392 Ga0466982_0000045
393 Ga0466961_0144497
394 Ga0466957_0136051
395 Ga0466958_0000830
396 Ga0495638_0000346
397 Ga0495638_0134234
398 Ga0495650_0000399
399 Ga0495650_0001592
400 Ga0495650_0003026
401 Ga0495650_0008191
402 Ga0495650_0015083
403 Ga0495650_0026434
404 Ga0495582_0004182
405 Ga0495607_0008989
406 Ga0495607_0041974
407 Ga0495583_0018984
408 Ga0495606_0005337
409 Ga0495610_0000024
410 Ga0495610_0001774
411 Ga0495620_0025584
412 Ga0495628_0008629
413 Ga0495668_0001184
414 Ga0495611_0137182
415 Ga0495625_0001608
416 Ga0495661_0026579
417 Ga0495657_0007089
418 Ga0495624_0004602
419 Ga0495649_0040212
420 Ga0495660_0006156
421 Ga0495660_0037220
422 Ga0495660_0049872
423 Ga0495672_0000036
424 Ga0495679_023446
425 Ga0495679_055592
426 Ga0495686_0011019
427 Ga0495686_0128596
428 Ga0496100_0000070
429 Ga0496101_0000044
430 Ga0496101_0138500
431 Ga0496102_0000715
432 Ga0496103_0000213
433 Ga0496104_0030385
434 Ga0496104_0086835
435 Ga0496105_0051870
436 Ga0496105_0198400
437 Ga0496112_0348521
438 Ga0496114_0131561
439 Ga0496116_0000216
440 Ga0496117_0000098
441 Ga0496117_0005443
442 Ga0496117_0007740
443 Ga0496117_0015510
444 Ga0496117_0017153
445 Ga0496118_0000608
446 Ga0496118_0000625
447 Ga0496118_0002026
448 Ga0496118_0002119
449 Ga0496118_0010724
450 Ga0496119_0002070
451 Ga0496119_0004204
452 Ga0496119_0146713
453 Ga0496120_0002568
454 Ga0496120_0003369
455 Ga0496121_0000246
456 Ga0496121_0000644
457 Ga0496121_0018059
458 Ga0496121_0038538
459 Ga0496121_0221258
460 Ga0496122_0001796
461 Ga0496122_0003728
462 Ga0496122_0015531
463 Ga0496122_0033399
464 Ga0496122_0188789
465 Ga0496122_0294265
466 Ga0496123_0002974
467 Ga0496123_0005440
468 Ga0496123_0021311
469 Ga0496123_0032903
470 Ga0496123_0080838
471 Ga0496123_0085292
472 Ga0496123_0091764
473 Ga0496123_0169778
474 Ga0496123_0346287
475 Ga0496124_0000023
476 Ga0496124_0004196
477 Ga0496124_0078024
478 Ga0496124_0106006
479 Ga0496125_0071638
480 Ga0496126_0007073
481 Ga0496126_0103660
482 Ga0496126_0338366
483 Ga0495678_000770
484 nmdc:mga00v17_36778_c1
485 nmdc:mga0k408_80510_c1
486 nmdc:mga07m45_89187_c1
487 Ga0500635_0111958
488 Ga0500572_117946
489 Ga0500594_0005854
490 Ga0500607_013384
491 Ga0500618_014166
492 Ga0500642_0014673
493 Ga0500658_0001403
494 Ga0500559_0000038
495 Ga0500559_0018600
496 Ga0500564_083698
497 Ga0500622_0001043
498 Ga0500622_0076912
499 Ga0500636_0001531
500 Ga0500661_008439
501 2585257867
502 2509076479
503 2511248133
504 2515687178
505 2523469634
506 2527075843
507 2585901130
508 2588294768
509 2595446269
510 2599747352
511 2600209023
512 2676745051
513 2739351603
514 2787436737
515 2809147119
516 2819562737
517 2819661469
518 2842325415
519 2842349694
520 2842455070
521 2842921986
522 2852653737
523 2852687336
524 2854902202
525 2870073451
526 2885271747
527 2902409033
528 2904424859
529 2904463347
530 2904541946
531 2919085301
532 2919407983
533 2928158447
534 2928167338
535 2929167235
536 2981991915
537 8020953195
538 8046773045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

211

0.93

PF08659

KR

KR domain

26

184

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

216

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

188

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imf-assembly1.cif.gz_D 1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' 0.9325 2 176
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9205 2 174
3guy-assembly1.cif.gz_D crystal structure of a short-chain dehydrogenase/reductase from vibrio parahaemolyticus 0.919 4 175
8hax-assembly1.cif.gz_B brucella melitensis 7alpha-hydroxysteroid dehydrogenase mutant-i258m/k262t 0.9187 2 174
2q2q-assembly2.cif.gz_F-2 structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9183 2 174
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 76 174 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 2 171 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 67 174 3.40.50.720
af_Q9W3K9_50_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9282 2 178 3.40.50.720
af_Q9VKB8_43_310_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9218 2 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A436QX60-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9994 1 164 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433
AF-A0A7Y9YS30-F1-model_v4 deleted 0.9977 1 248
AF-A0A7J0D2C2-F1-model_v4 Short-chain dehydrogenase/reductase 0.9964 1 182 GO:0016491
AF-A0A829XTV3-F1-model_v4 deleted 0.9915 32 249
AF-A0A7Y9YS30-F1-model_v4 deleted 0.9897 1 248

Map