F376732

General Info

Members Datasets Scaffolds Average Seq Length
270 166 267 356

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10028747|Ga0070691_100287472
Length 392
Sequence MKPSSFLDIVKTGVRGSIRPLKRHKSRINLACLMLGLAPLLSFGQEKKDTQFTITGDIKGLADNELVFLTDVSNPTDTVAKVPAKGQHFVLSGHVAEPNLYELNLGSAKTKAPLFMGNDNISVSGSQEDLKGLVAKGSPSNDDFVEFQKVFNPYFTRINSVMQLANSPEGVKVRDSLFKIYKRVADSTMNQLDVFVADKRSSYVSPFVMVVLNQLSEDVGRQLKRYNTLTPEVQKGYYGQYLKSKLDEASIGAIGTDAMDFTQTDTSGRAVSLSSFKGKYVLLDFWASWCGPCRMENPNVVSTYKRFKDKNFTVLGVSLDKSKEPWLKAIKDDGLAWTQVSDLKYWYNEAALKYHIQSIPQNFLIDPNGKIVGKNLRGPDLQAKLCELLGCN

Samples

Sample ID Description Type Environment
1 2738543023 Pedobacter sp. OK628 Isolate Unclassified
2 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
3 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
154 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
155 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0.37
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 0.37
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10094495 3300003320 Bacteria 15735
2 rootH1_10044353 3300003323 Bacteria 10541
3 rootH1_10258435 3300003323 Bacteria 4165
4 rootH1_10284763 3300003323 Bacteria 3113
5 Ga0065712_10001793 3300005290 Bacteria 6415
6 Ga0065712_10085861 3300005290 Bacteria 2669
7 Ga0070658_10006293 3300005327 Bacteria 9615
8 Ga0070658_10136900 3300005327 Bacteria 2044
9 Ga0070676_10011229 3300005328 Bacteria 4870
10 Ga0070683_100002966 3300005329 Bacteria 13606
11 Ga0070677_10021155 3300005333 Bacteria 2383
12 Ga0070677_10043289 3300005333 Bacteria 1787
13 Ga0068869_100107252 3300005334 Unclassified 2120
14 Ga0070680_100026482 3300005336 Bacteria 4638
15 Ga0070682_100216470 3300005337 Bacteria 1360
16 Ga0068868_100005270 3300005338 Bacteria 9078
17 Ga0070660_100015714 3300005339 Bacteria 5473
18 Ga0070691_10028747 3300005341 Bacteria 2599
19 Ga0070668_100002494 3300005347 Bacteria 13548
20 Ga0070675_100014671 3300005354 Bacteria 6180
21 Ga0070675_100042104 3300005354 Bacteria 3731
22 Ga0070674_100023903 3300005356 Bacteria 3962
23 Ga0070673_100001990 3300005364 Bacteria 12324
24 Ga0070673_100089130 3300005364 Bacteria 2518
25 Ga0070667_100000492 3300005367 Bacteria 40164
26 Ga0070667_100097229 3300005367 Bacteria 2540
27 Ga0070681_10057931 3300005458 Bacteria 3854
28 Ga0068867_100042571 3300005459 Bacteria 3323
29 Ga0068867_100100326 3300005459 Bacteria 2210
30 Ga0070698_100142238 3300005471 Bacteria 2350
31 Ga0070679_100023347 3300005530 Bacteria 6052
32 Ga0068853_100020914 3300005539 Bacteria 5445
33 Ga0068853_100039849 3300005539 Bacteria 4007
34 Ga0068853_100079894 3300005539 Bacteria 2861
35 Ga0068853_100094492 3300005539 Bacteria 2634
36 Ga0068853_100098624 3300005539 Bacteria 2580
37 Ga0070672_100001464 3300005543 Bacteria 14647
38 Ga0070665_100005742 3300005548 Bacteria 12739
39 Ga0068855_100007886 3300005563 Bacteria 12858
40 Ga0068855_100033925 3300005563 Bacteria 6089
41 Ga0068855_100097237 3300005563 Bacteria 3391
42 Ga0068855_100191377 3300005563 Bacteria 2307
43 Ga0068855_100357639 3300005563 Bacteria 1607
44 Ga0070664_100102258 3300005564 Bacteria 2493
45 Ga0068857_100001119 3300005577 Bacteria 20854
46 Ga0068856_100055225 3300005614 Bacteria 3919
47 Ga0068852_100002006 3300005616 Bacteria 13883
48 Ga0068852_100043927 3300005616 Bacteria 3792
49 Ga0068852_100064061 3300005616 Bacteria 3203
50 Ga0068852_100090784 3300005616 Bacteria 2732
51 Ga0068859_100075328 3300005617 Bacteria 3415
52 Ga0068861_100244034 3300005719 Bacteria 1529
53 Ga0068851_10001340 3300005834 Bacteria 10756
54 Ga0068863_100013140 3300005841 Bacteria 7992
55 Ga0068863_100299025 3300005841 Bacteria 1561
56 Ga0068858_100011017 3300005842 Bacteria 8544
57 Ga0068858_100053304 3300005842 Bacteria 3742
58 Ga0068860_100000046 3300005843 Bacteria 214800
59 Ga0068860_100003652 3300005843 Bacteria 15833
60 Ga0068860_100004779 3300005843 Bacteria 13804
61 Ga0068860_100030751 3300005843 Bacteria 5163
62 Ga0068860_100093361 3300005843 Bacteria 2868
63 Ga0075366_10001601 3300006195 Bacteria 11329
64 Ga0097621_100001572 3300006237 Bacteria 15606
65 Ga0068871_100000354 3300006358 Bacteria 31915
66 Ga0068871_100019761 3300006358 Bacteria 5147
67 Ga0068865_100065628 3300006881 Bacteria 2558
68 Ga0097620_100075328 3300006931 Bacteria 3415
69 Ga0105240_10000074 3300009093 Bacteria 199611
70 Ga0105240_10000598 3300009093 Bacteria 67006
71 Ga0105240_10000626 3300009093 Bacteria 65179
72 Ga0105240_10004108 3300009093 Bacteria 22346
73 Ga0105240_10004476 3300009093 Bacteria 21284
74 Ga0105240_10012831 3300009093 Bacteria 11542
75 Ga0105240_10072273 3300009093 Bacteria 4264
76 Ga0105240_10115610 3300009093 Bacteria 3239
77 Ga0111539_10023493 3300009094 Bacteria 7575
78 Ga0105241_10000659 3300009174 Bacteria 25872
79 Ga0105241_10028436 3300009174 Bacteria 4167
80 Ga0105242_10013758 3300009176 Bacteria 6262
81 Ga0105242_10058121 3300009176 Bacteria 3169
82 Ga0105248_10290206 3300009177 Bacteria 1842
83 Ga0105237_10000755 3300009545 Bacteria 44312
84 Ga0105237_10004143 3300009545 Bacteria 16893
85 Ga0105237_10005463 3300009545 Bacteria 14336
86 Ga0105237_10043859 3300009545 Bacteria 4503
87 Ga0105237_10050743 3300009545 Bacteria 4168
88 Ga0105237_10082107 3300009545 Bacteria 3214
89 Ga0105237_10157811 3300009545 Bacteria 2266
90 Ga0105238_10001132 3300009551 Bacteria 26885
91 Ga0105238_10160782 3300009551 Bacteria 2222
92 Ga0105238_10167600 3300009551 Bacteria 2172
93 Ga0105249_10076535 3300009553 Bacteria 3102
94 Ga0105249_10104885 3300009553 Bacteria 2664
95 Ga0105239_10000785 3300010375 Bacteria 45044
96 Ga0105239_10002613 3300010375 Bacteria 22790
97 Ga0105239_10038292 3300010375 Bacteria 5254
98 Ga0105239_10045670 3300010375 Bacteria 4801
99 Ga0157373_10040677 3300013100 Bacteria 3325
100 Ga0157373_10042215 3300013100 Bacteria 3260
101 Ga0157371_10024610 3300013102 Bacteria 4394
102 Ga0157371_10064535 3300013102 Bacteria 2594
103 Ga0157370_10009537 3300013104 Bacteria 10354
104 Ga0157370_10111321 3300013104 Bacteria 2559
105 Ga0157370_10117599 3300013104 Bacteria 2483
106 Ga0157370_10132814 3300013104 Bacteria 2322
107 Ga0157369_10022347 3300013105 Bacteria 7059
108 Ga0157369_10065672 3300013105 Bacteria 3905
109 Ga0157374_10058504 3300013296 Bacteria 3602
110 Ga0157374_10234970 3300013296 Bacteria 1801
111 Ga0157374_10261293 3300013296 Bacteria 1705
112 Ga0157378_10034426 3300013297 Bacteria 4479
113 Ga0163162_10000331 3300013306 Bacteria 43319
114 Ga0163162_10001657 3300013306 Bacteria 20874
115 Ga0163162_10005839 3300013306 Bacteria 11903
116 Ga0163162_10014930 3300013306 Bacteria 7585
117 Ga0157372_10000921 3300013307 Bacteria 32008
118 Ga0157372_10044650 3300013307 Bacteria 4911
119 Ga0157372_10108660 3300013307 Bacteria 3175
120 Ga0157372_10169545 3300013307 Bacteria 2525
121 Ga0157372_10366288 3300013307 Unclassified 1679
122 Ga0157372_10545143 3300013307 Bacteria 1352
123 Ga0157375_10003117 3300013308 Bacteria 14392
124 Ga0157375_10012971 3300013308 Bacteria 7402
125 Ga0163163_10000653 3300014325 Bacteria 29691
126 Ga0163163_10079728 3300014325 Bacteria 3273
127 Ga0182008_10000043 3300014497 Bacteria 117076
128 Ga0157379_10002723 3300014968 Bacteria 14918
129 Ga0157376_10033842 3300014969 Bacteria 4119
130 Ga0157376_10144239 3300014969 Bacteria 2140
131 Ga0182006_1000110 3300015261 Bacteria 88392
132 Ga0163161_10001362 3300017792 Bacteria 18128
133 Ga0163161_10026556 3300017792 Bacteria 4101
134 Ga0213876_10002105 3300021384 Bacteria 11776
135 Ga0209026_1001188 3300025250 Bacteria 12079
136 Ga0209455_1005394 3300025272 Bacteria 3959
137 Ga0207680_10025833 3300025903 Bacteria 3245
138 Ga0207647_10121784 3300025904 Bacteria 1538
139 Ga0207645_10020204 3300025907 Bacteria 4362
140 Ga0207705_10037801 3300025909 Bacteria 3454
141 Ga0207654_10003155 3300025911 Bacteria 8333
142 Ga0207654_10036250 3300025911 Bacteria 2754
143 Ga0207707_10133257 3300025912 Bacteria 2173
144 Ga0207695_10000071 3300025913 Bacteria 315568
145 Ga0207695_10000084 3300025913 Bacteria 282392
146 Ga0207695_10000323 3300025913 Bacteria 114265
147 Ga0207695_10004602 3300025913 Bacteria 18731
148 Ga0207695_10023004 3300025913 Bacteria 7058
149 Ga0207695_10023032 3300025913 Bacteria 7051
150 Ga0207695_10051952 3300025913 Bacteria 4299
151 Ga0207671_10001044 3300025914 Bacteria 33679
152 Ga0207671_10003904 3300025914 Bacteria 14529
153 Ga0207671_10004723 3300025914 Bacteria 12863
154 Ga0207671_10025795 3300025914 Bacteria 4410
155 Ga0207671_10193426 3300025914 Bacteria 1587
156 Ga0207660_10029928 3300025917 Bacteria 3740
157 Ga0207657_10010433 3300025919 Bacteria 9272
158 Ga0207652_10237375 3300025921 Bacteria 1643
159 Ga0207694_10022045 3300025924 Bacteria 4831
160 Ga0207694_10030383 3300025924 Bacteria 4126
161 Ga0207694_10162806 3300025924 Bacteria 1803
162 Ga0207659_10082427 3300025926 Bacteria 2381
163 Ga0207686_10005723 3300025934 Bacteria 6665
164 Ga0207704_10045918 3300025938 Bacteria 2599
165 Ga0207691_10004310 3300025940 Bacteria 13818
166 Ga0207691_10006538 3300025940 Bacteria 11250
167 Ga0207689_10124153 3300025942 Unclassified 2124
168 Ga0207661_10020085 3300025944 Bacteria 4989
169 Ga0207679_10075016 3300025945 Bacteria 2565
170 Ga0207667_10000177 3300025949 Bacteria 92852
171 Ga0207667_10001672 3300025949 Bacteria 27944
172 Ga0207667_10021496 3300025949 Bacteria 7148
173 Ga0207667_10164164 3300025949 Bacteria 2284
174 Ga0207651_10025180 3300025960 Bacteria 3696
175 Ga0207712_10054600 3300025961 Bacteria 2806
176 Ga0207668_10000843 3300025972 Bacteria 18537
177 Ga0207640_10019845 3300025981 Bacteria 3979
178 Ga0207658_10008500 3300025986 Bacteria 6985
179 Ga0207677_10013715 3300026023 Bacteria 4705
180 Ga0207703_10005016 3300026035 Bacteria 10732
181 Ga0207639_10014811 3300026041 Bacteria 5493
182 Ga0207639_10017081 3300026041 Bacteria 5141
183 Ga0207639_10018377 3300026041 Bacteria 4966
184 Ga0207639_10079236 3300026041 Bacteria 2595
185 Ga0207639_10254718 3300026041 Bacteria 1532
186 Ga0207702_10079901 3300026078 Bacteria 2836
187 Ga0207702_10171472 3300026078 Bacteria 1990
188 Ga0207702_10208537 3300026078 Bacteria 1815
189 Ga0207641_10004894 3300026088 Bacteria 11515
190 Ga0207648_10012585 3300026089 Bacteria 7917
191 Ga0207648_10079229 3300026089 Bacteria 2865
192 Ga0207674_10000672 3300026116 Bacteria 44419
193 Ga0207698_10030889 3300026142 Bacteria 3859
194 Ga0207698_10035386 3300026142 Bacteria 3653
195 Ga0207698_10326362 3300026142 Bacteria 1440
196 Ga0268266_10000049 3300028379 Bacteria 307763
197 Ga0268265_10008645 3300028380 Bacteria 6883
198 Ga0268264_10000041 3300028381 Bacteria 372501
199 Ga0268264_10003505 3300028381 Bacteria 13525
200 Ga0268264_10017624 3300028381 Bacteria 5848
201 Ga0268264_10073210 3300028381 Bacteria 2907
202 Ga0307517_10008402 3300028786 Bacteria 14816
203 Ga0307517_10171654 3300028786 Bacteria 1424
204 Ga0307511_10001228 3300030521 Bacteria 27171
205 Ga0307513_10053789 3300031456 Bacteria 4324
206 Ga0307413_10130777 3300031824 Bacteria 1718
207 Ga0373937_0132896 3300036401 Bacteria 2325
208 Ga0436365_0926144 3300039437 Bacteria 3753
209 Ga0436365_1079918 3300039437 Bacteria 37760
210 Ga0439449_0022101 3300042007 Bacteria 2381
211 Ga0466969_0000238 3300044656 Bacteria 30098
212 Ga0466972_0000469 3300044658 Bacteria 20427
213 Ga0466965_0021071 3300044683 Bacteria 3137
214 Ga0466966_0000136 3300044684 Bacteria 47038
215 Ga0466964_0076566 3300044706 Bacteria 1427
216 Ga0466964_0094060 3300044706 Bacteria 1309
217 Ga0466957_0009105 3300044842 Bacteria 5660
218 Ga0466957_0015762 3300044842 Bacteria 4415
219 Ga0466959_0000002 3300045049 Bacteria 362671
220 Ga0495638_0062038 3300046460 Bacteria 2308
221 Ga0495651_0097725 3300046462 Bacteria 2192
222 Ga0495582_0096613 3300046473 Bacteria 1652
223 Ga0495630_0044620 3300046517 Bacteria 3313
224 Ga0495633_0052294 3300046558 Bacteria 1925
225 Ga0495611_0080437 3300046648 Bacteria 1497
226 Ga0495661_0019484 3300046665 Bacteria 4445
227 Ga0495670_0068505 3300046691 Bacteria 1793
228 Ga0495674_0081424 3300047319 Bacteria 2777
229 Ga0495687_000001 3300047443 Bacteria 1215582
230 Ga0496109_0081844 3300048912 Bacteria 2975
231 Ga0501298_003651 3300049521 Bacteria 2395
232 Ga0501315_008878 3300049531 Bacteria 1178
233 Ga0501032_0014823 3300049569 Bacteria 5516
234 Ga0501034_0003972 3300049571 Bacteria 16617
235 Ga0501036_0014532 3300049572 Bacteria 6558
236 Ga0501037_0021286 3300049573 Bacteria 4792
237 Ga0501038_0034768 3300049574 Bacteria 4428
238 Ga0501039_0101559 3300049575 Bacteria 2245
239 Ga0501043_0044734 3300049579 Bacteria 3481
240 Ga0501046_0013494 3300049580 Bacteria 6916
241 Ga0501047_0056627 3300049581 Bacteria 3791
242 Ga0501047_0078836 3300049581 Bacteria 3167
243 Ga0501047_0112132 3300049581 Bacteria 2609
244 Ga0501048_0014254 3300049582 Bacteria 5888
245 Ga0501070_0040839 3300049586 Bacteria 3867
246 Ga0501073_0006174 3300049589 Bacteria 8944
247 Ga0501074_0027112 3300049590 Bacteria 4152
248 Ga0501198_000444 3300049649 Bacteria 5111
249 Ga0501202_001005 3300049652 Bacteria 4369
250 Ga0501217_010991 3300049661 Bacteria 1995
251 Ga0501223_000793 3300049663 Bacteria 7486
252 Ga0501224_002896 3300049664 Bacteria 2369
253 Ga0501235_002938 3300049669 Bacteria 3670
254 Ga0501256_000366 3300049685 Bacteria 2815
255 Ga0501257_002024 3300049686 Bacteria 4227
256 Ga0501259_000101 3300049688 Bacteria 12324
257 Ga0501221_001429 3300049704 Bacteria 3949
258 Ga0501221_010771 3300049704 Bacteria 1631
259 Ga0501225_0005859 3300049705 Bacteria 3596
260 Ga0501245_000190 3300049708 Bacteria 6812
261 Ga0501035_0035502 3300049822 Bacteria 4524
262 Ga0501044_0014178 3300049823 Bacteria 8607
263 nmdc:mga0k408_61_c1 3300050493 Bacteria 53671
264 Ga0500583_0005514 3300053092 Bacteria 4251
265 Ga0500642_0028174 3300053130 Bacteria 2314
266 Ga0500622_0001463 3300053156 Bacteria 18819
267 Ga0466962_0058093 3300061719 Bacteria 1847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10006293 Ga0070658_100062937 291
2 3300005328 Ga0070676_10011229 Ga0070676_100112295 291
3 3300005338 Ga0068868_100005270 Ga0068868_1000052709 291
4 3300005347 Ga0070668_100002494 Ga0070668_10000249413 291
5 3300005364 Ga0070673_100001990 Ga0070673_10000199014 291
6 3300005367 Ga0070667_100000492 Ga0070667_10000049237 291
7 3300005459 Ga0068867_100042571 Ga0068867_1000425712 291
8 3300005539 Ga0068853_100020914 Ga0068853_1000209147 291
9 3300005543 Ga0070672_100001464 Ga0070672_1000014649 291
10 3300005548 Ga0070665_100005742 Ga0070665_10000574213 291
11 3300005563 Ga0068855_100357639 Ga0068855_1003576392 291
12 3300005564 Ga0070664_100102258 Ga0070664_1001022583 291
13 3300005617 Ga0068859_100075328 Ga0068859_1000753285 291
14 3300005834 Ga0068851_10001340 Ga0068851_100013405 291
15 3300005841 Ga0068863_100013140 Ga0068863_10001314010 291
16 3300005842 Ga0068858_100011017 Ga0068858_1000110176 291
17 3300005843 Ga0068860_100003652 Ga0068860_10000365216 291
18 3300006358 Ga0068871_100019761 Ga0068871_1000197614 291
19 3300006881 Ga0068865_100065628 Ga0068865_1000656283 291
20 3300006931 Ga0097620_100075328 Ga0097620_1000753285 291
21 3300009093 Ga0105240_10072273 Ga0105240_100722733 291
22 3300009176 Ga0105242_10058121 Ga0105242_100581212 291
23 3300009177 Ga0105248_10290206 Ga0105248_102902062 291
24 3300009545 Ga0105237_10157811 Ga0105237_101578112 291
25 3300009551 Ga0105238_10160782 Ga0105238_101607823 291
26 3300009553 Ga0105249_10076535 Ga0105249_100765352 291
27 3300013296 Ga0157374_10058504 Ga0157374_100585043 291
28 3300013297 Ga0157378_10034426 Ga0157378_100344265 291
29 3300013306 Ga0163162_10005839 Ga0163162_1000583912 291
30 3300013307 Ga0157372_10169545 Ga0157372_101695453 291
31 3300013308 Ga0157375_10012971 Ga0157375_100129715 291
32 3300014325 Ga0163163_10000653 Ga0163163_1000065319 291
33 3300014968 Ga0157379_10002723 Ga0157379_100027235 291
34 3300014969 Ga0157376_10033842 Ga0157376_100338423 291
35 3300017792 Ga0163161_10026556 Ga0163161_100265565 291
36 3300025907 Ga0207645_10020204 Ga0207645_100202043 291
37 3300025909 Ga0207705_10037801 Ga0207705_100378015 291
38 3300025924 Ga0207694_10162806 Ga0207694_101628062 291
39 3300025938 Ga0207704_10045918 Ga0207704_100459183 291
40 3300025940 Ga0207691_10006538 Ga0207691_100065386 291
41 3300025945 Ga0207679_10075016 Ga0207679_100750163 291
42 3300025961 Ga0207712_10054600 Ga0207712_100546002 291
43 3300025972 Ga0207668_10000843 Ga0207668_1000084313 291
44 3300025986 Ga0207658_10008500 Ga0207658_100085008 291
45 3300026023 Ga0207677_10013715 Ga0207677_100137155 291
46 3300026035 Ga0207703_10005016 Ga0207703_1000501612 291
47 3300026041 Ga0207639_10014811 Ga0207639_100148117 291
48 3300026088 Ga0207641_10004894 Ga0207641_100048943 291
49 3300026089 Ga0207648_10012585 Ga0207648_100125859 291
50 3300028381 Ga0268264_10017624 Ga0268264_100176246 291
51 3300048912 Ga0496109_0081844 Ga0496109_0081844_925_2016 291
52 3300013102 Ga0157371_10064535 Ga0157371_100645352 303
53 3300005290 Ga0065712_10001793 Ga0065712_100017933 305
54 3300009176 Ga0105242_10013758 Ga0105242_100137583 305
55 3300025934 Ga0207686_10005723 Ga0207686_100057235 305
56 3300046517 Ga0495630_0044620 Ga0495630_0044620_529_1626 310
57 3300044842 Ga0466957_0015762 Ga0466957_0015762_28_1065 311
58 3300005539 Ga0068853_100039849 Ga0068853_1000398493 316
59 3300026041 Ga0207639_10017081 Ga0207639_100170816 316
60 3300009093 Ga0105240_10115610 Ga0105240_101156102 317
61 3300009545 Ga0105237_10004143 Ga0105237_1000414314 317
62 3300010375 Ga0105239_10002613 Ga0105239_1000261324 317
63 3300025911 Ga0207654_10003155 Ga0207654_1000315510 317
64 3300025914 Ga0207671_10003904 Ga0207671_100039044 317
65 3300036401 Ga0373937_0132896 Ga0373937_0132896_621_1691 318
66 3300005841 Ga0068863_100299025 Ga0068863_1002990251 319
67 3300025913 Ga0207695_10000084 Ga0207695_10000084226 319
68 3300005334 Ga0068869_100107252 Ga0068869_1001072522 320
69 3300005336 Ga0070680_100026482 Ga0070680_1000264825 320
70 3300005337 Ga0070682_100216470 Ga0070682_1002164702 320
71 3300005339 Ga0070660_100015714 Ga0070660_1000157142 320
72 3300005367 Ga0070667_100097229 Ga0070667_1000972293 320
73 3300005458 Ga0070681_10057931 Ga0070681_100579314 320
74 3300005530 Ga0070679_100023347 Ga0070679_1000233472 320
75 3300005539 Ga0068853_100094492 Ga0068853_1000944922 320
76 3300005563 Ga0068855_100097237 Ga0068855_1000972373 320
77 3300005614 Ga0068856_100055225 Ga0068856_1000552254 320
78 3300005616 Ga0068852_100043927 Ga0068852_1000439273 320
79 3300005616 Ga0068852_100090784 Ga0068852_1000907843 320
80 3300005843 Ga0068860_100093361 Ga0068860_1000933612 320
81 3300009174 Ga0105241_10028436 Ga0105241_100284363 320
82 3300009545 Ga0105237_10050743 Ga0105237_100507434 320
83 3300009553 Ga0105249_10104885 Ga0105249_101048852 320
84 3300010375 Ga0105239_10038292 Ga0105239_100382923 320
85 3300013100 Ga0157373_10042215 Ga0157373_100422153 320
86 3300013102 Ga0157371_10024610 Ga0157371_100246105 320
87 3300013104 Ga0157370_10111321 Ga0157370_101113213 320
88 3300013105 Ga0157369_10065672 Ga0157369_100656724 320
89 3300013307 Ga0157372_10108660 Ga0157372_101086602 320
90 3300025911 Ga0207654_10036250 Ga0207654_100362502 320
91 3300025912 Ga0207707_10133257 Ga0207707_101332571 320
92 3300025913 Ga0207695_10023032 Ga0207695_100230323 320
93 3300025914 Ga0207671_10193426 Ga0207671_101934262 320
94 3300025917 Ga0207660_10029928 Ga0207660_100299285 320
95 3300025919 Ga0207657_10010433 Ga0207657_100104338 320
96 3300025921 Ga0207652_10237375 Ga0207652_102373751 320
97 3300025942 Ga0207689_10124153 Ga0207689_101241532 320
98 3300025949 Ga0207667_10021496 Ga0207667_100214967 320
99 3300026041 Ga0207639_10079236 Ga0207639_100792361 320
100 3300026078 Ga0207702_10208537 Ga0207702_102085372 320
101 3300026142 Ga0207698_10030889 Ga0207698_100308895 320
102 3300026142 Ga0207698_10035386 Ga0207698_100353862 320
103 3300026142 Ga0207698_10326362 Ga0207698_103263622 320
104 3300028380 Ga0268265_10008645 Ga0268265_100086455 320
105 3300028381 Ga0268264_10073210 Ga0268264_100732102 320
106 3300025913 Ga0207695_10004602 Ga0207695_100046025 321
107 3300003323 rootH1_10284763 rootH1_102847632 322
108 3300005290 Ga0065712_10085861 Ga0065712_100858612 323
109 3300005333 Ga0070677_10021155 Ga0070677_100211552 323
110 3300005354 Ga0070675_100042104 Ga0070675_1000421045 323
111 3300014325 Ga0163163_10079728 Ga0163163_100797282 323
112 3300049521 Ga0501298_003651 Ga0501298_003651_767_1846 323
113 3300049531 Ga0501315_008878 Ga0501315_008878_48_1127 323
114 3300049649 Ga0501198_000444 Ga0501198_000444_748_1827 323
115 3300049652 Ga0501202_001005 Ga0501202_001005_2454_3533 323
116 3300049661 Ga0501217_010991 Ga0501217_010991_410_1489 323
117 3300049663 Ga0501223_000793 Ga0501223_000793_1767_2846 323
118 3300049664 Ga0501224_002896 Ga0501224_002896_789_1868 323
119 3300049669 Ga0501235_002938 Ga0501235_002938_436_1515 323
120 3300049685 Ga0501256_000366 Ga0501256_000366_1317_2396 323
121 3300049686 Ga0501257_002024 Ga0501257_002024_1493_2572 323
122 3300049688 Ga0501259_000101 Ga0501259_000101_9437_10516 323
123 3300049704 Ga0501221_001429 Ga0501221_001429_2198_3277 323
124 3300049704 Ga0501221_010771 Ga0501221_010771_45_1124 323
125 3300049705 Ga0501225_0005859 Ga0501225_0005859_554_1633 323
126 3300049708 Ga0501245_000190 Ga0501245_000190_1992_3071 323
127 3300005327 Ga0070658_10136900 Ga0070658_101369002 324
128 3300013307 Ga0157372_10366288 Ga0157372_103662882 324
129 3300031824 Ga0307413_10130777 Ga0307413_101307771 324
130 3300039437 Ga0436365_0926144 Ga0436365_0926144_1424_2503 325
131 3300049581 Ga0501047_0078836 Ga0501047_0078836_187_1269 325
132 3300049581 Ga0501047_0112132 Ga0501047_0112132_1428_2510 325
133 3300005356 Ga0070674_100023903 Ga0070674_1000239034 326
134 3300005616 Ga0068852_100064061 Ga0068852_1000640612 326
135 3300009093 Ga0105240_10000074 Ga0105240_10000074141 326
136 3300009093 Ga0105240_10000598 Ga0105240_1000059827 326
137 3300009094 Ga0111539_10023493 Ga0111539_100234933 326
138 3300009174 Ga0105241_10000659 Ga0105241_100006599 326
139 3300009545 Ga0105237_10082107 Ga0105237_100821073 326
140 3300009551 Ga0105238_10001132 Ga0105238_100011329 326
141 3300013307 Ga0157372_10545143 Ga0157372_105451431 326
142 3300021384 Ga0213876_10002105 Ga0213876_100021059 326
143 3300025913 Ga0207695_10000323 Ga0207695_1000032375 326
144 3300025924 Ga0207694_10022045 Ga0207694_100220453 326
145 3300026078 Ga0207702_10079901 Ga0207702_100799011 326
146 3300030521 Ga0307511_10001228 Ga0307511_100012287 326
147 3300039437 Ga0436365_1079918 Ga0436365_1079918_16788_17870 326
148 3300003323 rootH1_10044353 rootH1_100443539 327
149 3300005329 Ga0070683_100002966 Ga0070683_1000029665 327
150 3300005333 Ga0070677_10043289 Ga0070677_100432891 327
151 3300005341 Ga0070691_10028747 Ga0070691_100287472 327
152 3300005354 Ga0070675_100014671 Ga0070675_1000146711 327
153 3300005364 Ga0070673_100089130 Ga0070673_1000891303 327
154 3300005459 Ga0068867_100100326 Ga0068867_1001003262 327
155 3300005471 Ga0070698_100142238 Ga0070698_1001422384 327
156 3300005539 Ga0068853_100098624 Ga0068853_1000986242 327
157 3300005563 Ga0068855_100007886 Ga0068855_10000788612 327
158 3300005563 Ga0068855_100033925 Ga0068855_1000339252 327
159 3300005563 Ga0068855_100191377 Ga0068855_1001913772 327
160 3300005577 Ga0068857_100001119 Ga0068857_10000111913 327
161 3300005616 Ga0068852_100002006 Ga0068852_10000200612 327
162 3300005719 Ga0068861_100244034 Ga0068861_1002440342 327
163 3300005842 Ga0068858_100053304 Ga0068858_1000533043 327
164 3300005843 Ga0068860_100000046 Ga0068860_10000004635 327
165 3300005843 Ga0068860_100004779 Ga0068860_10000477912 327
166 3300005843 Ga0068860_100030751 Ga0068860_1000307514 327
167 3300006237 Ga0097621_100001572 Ga0097621_10000157213 327
168 3300006358 Ga0068871_100000354 Ga0068871_10000035416 327
169 3300009093 Ga0105240_10000626 Ga0105240_1000062635 327
170 3300009093 Ga0105240_10004476 Ga0105240_1000447621 327
171 3300009093 Ga0105240_10012831 Ga0105240_100128313 327
172 3300009545 Ga0105237_10000755 Ga0105237_1000075539 327
173 3300009545 Ga0105237_10043859 Ga0105237_100438592 327
174 3300009551 Ga0105238_10167600 Ga0105238_101676002 327
175 3300010375 Ga0105239_10000785 Ga0105239_1000078522 327
176 3300013100 Ga0157373_10040677 Ga0157373_100406772 327
177 3300013104 Ga0157370_10009537 Ga0157370_100095379 327
178 3300013104 Ga0157370_10132814 Ga0157370_101328142 327
179 3300013105 Ga0157369_10022347 Ga0157369_100223473 327
180 3300013296 Ga0157374_10234970 Ga0157374_102349702 327
181 3300013296 Ga0157374_10261293 Ga0157374_102612932 327
182 3300013306 Ga0163162_10000331 Ga0163162_1000033117 327
183 3300013306 Ga0163162_10001657 Ga0163162_100016579 327
184 3300013306 Ga0163162_10014930 Ga0163162_100149302 327
185 3300013307 Ga0157372_10000921 Ga0157372_100009217 327
186 3300013307 Ga0157372_10044650 Ga0157372_100446504 327
187 3300013308 Ga0157375_10003117 Ga0157375_100031172 327
188 3300014969 Ga0157376_10144239 Ga0157376_101442392 327
189 3300025904 Ga0207647_10121784 Ga0207647_101217841 327
190 3300025913 Ga0207695_10000071 Ga0207695_10000071248 327
191 3300025913 Ga0207695_10023004 Ga0207695_100230045 327
192 3300025913 Ga0207695_10051952 Ga0207695_100519524 327
193 3300025914 Ga0207671_10001044 Ga0207671_1000104413 327
194 3300025914 Ga0207671_10025795 Ga0207671_100257954 327
195 3300025924 Ga0207694_10030383 Ga0207694_100303832 327
196 3300025926 Ga0207659_10082427 Ga0207659_100824273 327
197 3300025940 Ga0207691_10004310 Ga0207691_1000431016 327
198 3300025944 Ga0207661_10020085 Ga0207661_100200852 327
199 3300025949 Ga0207667_10000177 Ga0207667_100001775 327
200 3300025949 Ga0207667_10001672 Ga0207667_100016725 327
201 3300025949 Ga0207667_10164164 Ga0207667_101641642 327
202 3300025960 Ga0207651_10025180 Ga0207651_100251804 327
203 3300025981 Ga0207640_10019845 Ga0207640_100198453 327
204 3300026041 Ga0207639_10018377 Ga0207639_100183772 327
205 3300026041 Ga0207639_10254718 Ga0207639_102547182 327
206 3300026078 Ga0207702_10171472 Ga0207702_101714722 327
207 3300026089 Ga0207648_10079229 Ga0207648_100792292 327
208 3300026116 Ga0207674_10000672 Ga0207674_1000067226 327
209 3300028379 Ga0268266_10000049 Ga0268266_1000004983 327
210 3300028381 Ga0268264_10000041 Ga0268264_10000041292 327
211 3300028381 Ga0268264_10003505 Ga0268264_100035056 327
212 3300028786 Ga0307517_10008402 Ga0307517_100084024 327
213 3300028786 Ga0307517_10171654 Ga0307517_101716542 327
214 3300031456 Ga0307513_10053789 Ga0307513_100537893 327
215 3300042007 Ga0439449_0022101 Ga0439449_0022101_645_1733 327
216 3300044656 Ga0466969_0000238 Ga0466969_0000238_871_1959 327
217 3300044658 Ga0466972_0000469 Ga0466972_0000469_2387_3484 327
218 3300044683 Ga0466965_0021071 Ga0466965_0021071_1255_2358 327
219 3300044684 Ga0466966_0000136 Ga0466966_0000136_7882_8970 327
220 3300044706 Ga0466964_0076566 Ga0466964_0076566_235_1338 327
221 3300044706 Ga0466964_0094060 Ga0466964_0094060_85_1173 327
222 3300044842 Ga0466957_0009105 Ga0466957_0009105_143_1231 327
223 3300045049 Ga0466959_0000002 Ga0466959_0000002_284159_285247 327
224 3300046460 Ga0495638_0062038 Ga0495638_0062038_1013_2110 327
225 3300046473 Ga0495582_0096613 Ga0495582_0096613_33_1130 327
226 3300046558 Ga0495633_0052294 Ga0495633_0052294_657_1754 327
227 3300046648 Ga0495611_0080437 Ga0495611_0080437_255_1376 327
228 3300046691 Ga0495670_0068505 Ga0495670_0068505_146_1243 327
229 3300047319 Ga0495674_0081424 Ga0495674_0081424_602_1699 327
230 3300047443 Ga0495687_000001 Ga0495687_000001_339424_340521 327
231 3300053092 Ga0500583_0005514 Ga0500583_0005514_2685_3782 327
232 3300053130 Ga0500642_0028174 Ga0500642_0028174_1022_2119 327
233 3300053156 Ga0500622_0001463 Ga0500622_0001463_8156_9253 327
234 3300061719 Ga0466962_0058093 Ga0466962_0058093_343_1431 327
235 iso_pu_bacteria 2738543023 2739302642 327
236 iso_pu_bacteria 2849281842 2849286845 327
237 iso_pu_bacteria 2852627209 2852632097 327
238 3300025903 Ga0207680_10025833 Ga0207680_100258332 328
239 3300049569 Ga0501032_0014823 Ga0501032_0014823_378_1484 328
240 3300049571 Ga0501034_0003972 Ga0501034_0003972_12327_13433 328
241 3300049572 Ga0501036_0014532 Ga0501036_0014532_2575_3681 328
242 3300049573 Ga0501037_0021286 Ga0501037_0021286_1112_2218 328
243 3300049574 Ga0501038_0034768 Ga0501038_0034768_2932_4038 328
244 3300049575 Ga0501039_0101559 Ga0501039_0101559_533_1639 328
245 3300049579 Ga0501043_0044734 Ga0501043_0044734_1992_3098 328
246 3300049580 Ga0501046_0013494 Ga0501046_0013494_765_1871 328
247 3300049581 Ga0501047_0056627 Ga0501047_0056627_2303_3409 328
248 3300049582 Ga0501048_0014254 Ga0501048_0014254_2049_3155 328
249 3300049586 Ga0501070_0040839 Ga0501070_0040839_1646_2752 328
250 3300049589 Ga0501073_0006174 Ga0501073_0006174_2177_3283 328
251 3300049590 Ga0501074_0027112 Ga0501074_0027112_2177_3283 328
252 3300049822 Ga0501035_0035502 Ga0501035_0035502_2488_3594 328
253 3300049823 Ga0501044_0014178 Ga0501044_0014178_409_1515 328
254 3300005539 Ga0068853_100079894 Ga0068853_1000798941 329
255 3300006195 Ga0075366_10001601 Ga0075366_1000160112 329
256 3300009093 Ga0105240_10004108 Ga0105240_100041084 329
257 3300010375 Ga0105239_10045670 Ga0105239_100456702 329
258 3300013104 Ga0157370_10117599 Ga0157370_101175992 329
259 3300025272 Ga0209455_1005394 Ga0209455_10053943 329
260 3300046462 Ga0495651_0097725 Ga0495651_0097725_928_2055 329
261 3300046665 Ga0495661_0019484 Ga0495661_0019484_224_1354 329
262 3300050493 nmdc:mga0k408_61_c1 nmdc:mga0k408_61_c1_45786_46922 329
263 3300009545 Ga0105237_10005463 Ga0105237_100054633 331
264 3300014497 Ga0182008_10000043 Ga0182008_1000004398 331
265 3300015261 Ga0182006_1000110 Ga0182006_100011028 331
266 3300017792 Ga0163161_10001362 Ga0163161_100013622 331
267 3300025914 Ga0207671_10004723 Ga0207671_100047233 331
268 3300025250 Ga0209026_1001188 Ga0209026_10011886 333
269 3300003320 rootH2_10094495 rootH2_1009449514 384
270 3300003323 rootH1_10258435 rootH1_102584352 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

278

371

0.98

PF14289

DUF4369

Domain of unknown function (DUF4369)

52

144

0.96

PF00578

AhpC-TSA

AhpC/TSA family

254

374

0.93

PF08534

Redoxin

Redoxin

253

384

0.92

PF00085

Thioredoxin

Thioredoxin

269

330

0.91

PF13098

Thioredoxin_2

Thioredoxin-like domain

275

383

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.9298 247 367
3fkf-assembly1.cif.gz_D thiol-disulfide oxidoreductase from bacteroides fragilis nctc 9343 0.9235 248 381
4grf-assembly1.cif.gz_A crystal structure of thioredoxin domain of thiol-disulfide oxidoreductase bvu-2223 (target efi-501010) from bacteroides vulgatus 0.923 244 383
3c71-assembly1.cif.gz_A structure of a resa variant with a dsba-like active site motif (cphc) 0.922 247 367
3fw2-assembly2.cif.gz_D c-terminal domain of putative thiol-disulfide oxidoreductase from bacteroides thetaiotaomicron. 0.9119 242 383
ID Description Score Start End Superfamily
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.923 244 383 3.40.30.10
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9163 248 381 3.40.30.10
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9044 244 383 3.40.30.10
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8971 248 381 3.40.30.10
3hczA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.875 244 381 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A258F0T0-F1-model_v4 Thioredoxin domain-containing protein 0.9897 259 382
AF-A0A847XTS5-F1-model_v4 TlpA family protein disulfide reductase 0.9837 252 384
AF-A0A2V4C753-F1-model_v4 TlpA family protein disulfide reductase 0.9817 243 384 GO:0016209
GO:0016491
AF-A0A848UVZ0-F1-model_v4 TlpA family protein disulfide reductase 0.979 244 384 GO:0016491
GO:0017004
GO:0030313
AF-A0A847XTS5-F1-model_v4 TlpA family protein disulfide reductase 0.9691 252 384

Feature Viewer

pLDDT pTM Quality
70.57 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map