F376843

General Info

Members Datasets Scaffolds Average Seq Length
270 180 270 254

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10223110|Ga0070717_102231104
Length 274
Sequence MLTLLGLPAAASTHAGDIDEMIVLVHWLMAILFVGWGLFFLYVLFRFRKGANPKASYTGAKGKISKGLEVAVAVIEVILLVFYAIPAWAKRVKAFPAENEATVVRVVGEQFAWNVHYPGPDGKFGRTDVKLVAPDNPLGLDRRDPDAKDDVTTINQLYLPVNRPVLIHLSSKDVIHSFGLYEMRVKQDAVPGMSIPVWFIPDTTTDEMRKKLNKPDFDYEITCSQLCGLGHFRMRGFVQVLSAADYQKWMADQEKELQPAVATPAAVPTAPRSN

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.19
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10005770 3300002459 Bacteria 2524
2 Ga0058862_10011738 3300004803 Bacteria 1777
3 Ga0058862_12645855 3300004803 Unclassified 1007
4 Ga0065712_10103209 3300005290 Unclassified 1990
5 Ga0065707_10085132 3300005295 Bacteria 6426
6 Ga0070690_100042976 3300005330 Bacteria 2864
7 Ga0070670_100108148 3300005331 Unclassified 2396
8 Ga0068869_100377106 3300005334 Unclassified 1162
9 Ga0070680_100068878 3300005336 Bacteria 2905
10 Ga0070682_100022409 3300005337 Bacteria 3741
11 Ga0070682_100188575 3300005337 Bacteria 1446
12 Ga0068868_100032766 3300005338 Bacteria 3998
13 Ga0070660_100043306 3300005339 Bacteria 3440
14 Ga0070689_100012538 3300005340 Bacteria 6110
15 Ga0070689_100115523 3300005340 Bacteria 2139
16 Ga0070668_100017730 3300005347 Bacteria 5339
17 Ga0070669_100029234 3300005353 Bacteria 3972
18 Ga0070669_100032868 3300005353 Bacteria 3749
19 Ga0070675_100001537 3300005354 Bacteria 17074
20 Ga0070673_100071637 3300005364 Bacteria 2785
21 Ga0070688_100125104 3300005365 Unclassified 1727
22 Ga0070709_10111748 3300005434 Bacteria 1837
23 Ga0070700_100123643 3300005441 Bacteria 1737
24 Ga0070681_10096194 3300005458 Bacteria 2910
25 Ga0070685_10194166 3300005466 Unclassified 1315
26 Ga0070685_10287006 3300005466 Bacteria 1104
27 Ga0070699_100031590 3300005518 Bacteria 4572
28 Ga0070699_100095635 3300005518 Bacteria 2601
29 Ga0070679_100017287 3300005530 Bacteria 6979
30 Ga0070679_100037637 3300005530 Bacteria 4807
31 Ga0070684_100107642 3300005535 Bacteria 2497
32 Ga0070697_100387535 3300005536 Unclassified 1211
33 Ga0068853_101131660 3300005539 Unclassified 755
34 Ga0070672_100620427 3300005543 Unclassified 943
35 Ga0070686_100025887 3300005544 Bacteria 3534
36 Ga0070696_100127485 3300005546 Bacteria 1848
37 Ga0070665_100015165 3300005548 Bacteria 7737
38 Ga0070704_100234664 3300005549 Unclassified 1498
39 Ga0068855_100023932 3300005563 Bacteria 7314
40 Ga0068857_100161381 3300005577 Bacteria 2034
41 Ga0068854_100112789 3300005578 Bacteria 2053
42 Ga0068859_100116866 3300005617 Bacteria 2732
43 Ga0068859_100195942 3300005617 Bacteria 2105
44 Ga0068859_100348747 3300005617 Bacteria 1575
45 Ga0068866_10148952 3300005718 Bacteria 1353
46 Ga0068861_100019838 3300005719 Bacteria 4805
47 Ga0068861_100158990 3300005719 Bacteria 1862
48 Ga0068851_10118823 3300005834 Bacteria 1418
49 Ga0068858_100033441 3300005842 Unclassified 4771
50 Ga0068858_100087997 3300005842 Bacteria 2889
51 Ga0068858_100172126 3300005842 Bacteria 2042
52 Ga0068858_100182129 3300005842 Bacteria 1984
53 Ga0068858_100256176 3300005842 Bacteria 1663
54 Ga0068858_100292522 3300005842 Bacteria 1553
55 Ga0068860_100033594 3300005843 Bacteria 4921
56 Ga0068862_100118204 3300005844 Bacteria 2334
57 Ga0068862_100131594 3300005844 Bacteria 2213
58 Ga0068862_100238362 3300005844 Unclassified 1653
59 Ga0081455_10377844 3300005937 Unclassified 991
60 Ga0081540_1064403 3300005983 Bacteria 1729
61 Ga0070717_10223110 3300006028 Unclassified 1657
62 Ga0070717_10290366 3300006028 Bacteria 1452
63 Ga0070715_10114160 3300006163 Bacteria 1278
64 Ga0070715_10235052 3300006163 Bacteria 950
65 Ga0070716_100160600 3300006173 Unclassified 1456
66 Ga0070716_100239708 3300006173 Unclassified 1229
67 Ga0097621_100009469 3300006237 Bacteria 7071
68 Ga0097621_100050539 3300006237 Bacteria 3381
69 Ga0097621_100286538 3300006237 Bacteria 1451
70 Ga0068871_100012578 3300006358 Bacteria 6248
71 Ga0068871_100171531 3300006358 Unclassified 1860
72 Ga0068871_100396225 3300006358 Unclassified 1229
73 Ga0075433_10067266 3300006852 Bacteria 3145
74 Ga0075433_10128269 3300006852 Bacteria 2253
75 Ga0075434_100021223 3300006871 Bacteria 6312
76 Ga0075434_100060975 3300006871 Bacteria 3752
77 Ga0075434_100730850 3300006871 Bacteria 1007
78 Ga0075436_100010393 3300006914 Bacteria 6379
79 Ga0097620_100116871 3300006931 Bacteria 2732
80 Ga0097620_100195915 3300006931 Bacteria 2105
81 Ga0097620_100348736 3300006931 Bacteria 1575
82 Ga0075435_100004448 3300007076 Bacteria 9632
83 Ga0075435_100052494 3300007076 Bacteria 3286
84 Ga0075435_100053991 3300007076 Bacteria 3242
85 Ga0111539_10211189 3300009094 Unclassified 2261
86 Ga0111539_10279755 3300009094 Bacteria 1942
87 Ga0105245_10059584 3300009098 Bacteria 3438
88 Ga0105245_10643245 3300009098 Unclassified 1090
89 Ga0105247_10017382 3300009101 Bacteria 4319
90 Ga0114129_10111924 3300009147 Bacteria 3766
91 Ga0114129_10113164 3300009147 Bacteria 3742
92 Ga0114129_10140444 3300009147 Bacteria 3311
93 Ga0105243_10465030 3300009148 Bacteria 1190
94 Ga0105242_10033222 3300009176 Bacteria 4130
95 Ga0105242_10350803 3300009176 Bacteria 1363
96 Ga0105242_10586345 3300009176 Bacteria 1075
97 Ga0105248_10024770 3300009177 Bacteria 6674
98 Ga0105248_10030747 3300009177 Bacteria 5998
99 Ga0105248_10089169 3300009177 Bacteria 3472
100 Ga0105248_10294126 3300009177 Unclassified 1829
101 Ga0105248_10398291 3300009177 Unclassified 1550
102 Ga0105238_10673454 3300009551 Unclassified 1046
103 Ga0105249_10016229 3300009553 Bacteria 6605
104 Ga0105249_10152751 3300009553 Bacteria 2224
105 Ga0157374_10118383 3300013296 Bacteria 2554
106 Ga0157374_10138351 3300013296 Bacteria 2362
107 Ga0157378_10608506 3300013297 Unclassified 1105
108 Ga0163162_10293786 3300013306 Bacteria 1757
109 Ga0157375_10118016 3300013308 Unclassified 2759
110 Ga0157375_10255970 3300013308 Bacteria 1912
111 Ga0163163_10816813 3300014325 Bacteria 996
112 Ga0157380_10034301 3300014326 Bacteria 3913
113 Ga0157380_10556061 3300014326 Unclassified 1127
114 Ga0157377_10041426 3300014745 Bacteria 2555
115 Ga0157379_10046157 3300014968 Bacteria 3888
116 Ga0157376_10033860 3300014969 Bacteria 4118
117 Ga0157376_10104160 3300014969 Bacteria 2486
118 Ga0163161_10536564 3300017792 Unclassified 957
119 Ga0207656_10072012 3300025321 Bacteria 1538
120 Ga0207642_10164544 3300025899 Bacteria 1194
121 Ga0207642_10333683 3300025899 Bacteria 889
122 Ga0207680_10126221 3300025903 Unclassified 1680
123 Ga0207680_10271543 3300025903 Bacteria 1176
124 Ga0207685_10052116 3300025905 Bacteria 1584
125 Ga0207699_10056009 3300025906 Bacteria 2348
126 Ga0207645_10195145 3300025907 Unclassified 1331
127 Ga0207654_10479425 3300025911 Bacteria 876
128 Ga0207707_10140018 3300025912 Bacteria 2116
129 Ga0207662_10298999 3300025918 Bacteria 1069
130 Ga0207657_10043378 3300025919 Bacteria 3962
131 Ga0207652_10166557 3300025921 Bacteria 1976
132 Ga0207681_10094518 3300025923 Bacteria 2142
133 Ga0207694_10366760 3300025924 Bacteria 1194
134 Ga0207659_10001294 3300025926 Bacteria 14955
135 Ga0207700_10287925 3300025928 Bacteria 1415
136 Ga0207644_10391109 3300025931 Bacteria 1135
137 Ga0207706_10017122 3300025933 Bacteria 6536
138 Ga0207706_10171863 3300025933 Bacteria 1904
139 Ga0207709_10488825 3300025935 Unclassified 958
140 Ga0207670_10021814 3300025936 Unclassified 3957
141 Ga0207669_10008545 3300025937 Bacteria 4814
142 Ga0207665_10031837 3300025939 Unclassified 3491
143 Ga0207691_10298670 3300025940 Bacteria 1384
144 Ga0207711_10179790 3300025941 Bacteria 1923
145 Ga0207711_10185737 3300025941 Bacteria 1892
146 Ga0207711_10259594 3300025941 Bacteria 1596
147 Ga0207711_10330031 3300025941 Bacteria 1411
148 Ga0207711_10420763 3300025941 Unclassified 1243
149 Ga0207667_10131233 3300025949 Bacteria 2580
150 Ga0207712_10513540 3300025961 Bacteria 1026
151 Ga0207640_10082191 3300025981 Bacteria 2205
152 Ga0207677_10413136 3300026023 Bacteria 1147
153 Ga0207703_10002242 3300026035 Bacteria 16903
154 Ga0207703_10065818 3300026035 Bacteria 2979
155 Ga0207703_10194583 3300026035 Bacteria 1798
156 Ga0207703_10275782 3300026035 Bacteria 1525
157 Ga0207641_10179295 3300026088 Bacteria 1939
158 Ga0207648_10018889 3300026089 Bacteria 6227
159 Ga0207676_10036797 3300026095 Bacteria 3726
160 Ga0207676_10623132 3300026095 Bacteria 1038
161 Ga0207675_100015362 3300026118 Bacteria 7141
162 Ga0207675_100070825 3300026118 Bacteria 3259
163 Ga0207675_100150562 3300026118 Bacteria 2214
164 Ga0207675_100267634 3300026118 Bacteria 1658
165 Ga0207683_10130767 3300026121 Bacteria 2258
166 Ga0207428_10403623 3300027907 Bacteria 1000
167 Ga0268266_10057208 3300028379 Bacteria 3355
168 Ga0268265_10096270 3300028380 Unclassified 2379
169 Ga0268265_10107418 3300028380 Bacteria 2269
170 Ga0268265_10325890 3300028380 Bacteria 1393
171 Ga0268264_10000914 3300028381 Bacteria 30928
172 Ga0268264_10560439 3300028381 Unclassified 1122
173 Ga0268264_10919633 3300028381 Bacteria 879
174 Ga0265332_10076490 3300031238 Bacteria 1422
175 Ga0265314_10038728 3300031711 Bacteria 3442
176 Ga0265342_10188622 3300031712 Bacteria 1126
177 Ga0307416_100213792 3300032002 Bacteria 1842
178 Ga0373934_0048760 3300035086 Bacteria 1677
179 Ga0373936_0020647 3300035113 Bacteria 2560
180 Ga0373943_0005334 3300035170 Bacteria 5779
181 Ga0373946_0016837 3300035171 Bacteria 2790
182 Ga0373955_0058325 3300035172 Bacteria 2124
183 Ga0373955_0139642 3300035172 Bacteria 1420
184 Ga0373924_0010839 3300035410 Bacteria 3373
185 Ga0373927_0030205 3300035695 Bacteria 3536
186 Ga0373933_0080287 3300035724 Bacteria 1999
187 Ga0373947_0045052 3300035725 Bacteria 2639
188 Ga0373937_0273624 3300036401 Bacteria 1594
189 Ga0373937_0423000 3300036401 Bacteria 1264
190 Ga0373925_0050984 3300037068 Bacteria 3088
191 Ga0495592_0027038 3300046454 Bacteria 4349
192 Ga0495628_0032989 3300046516 Bacteria 4176
193 Ga0495630_0048370 3300046517 Bacteria 3182
194 Ga0495630_0466212 3300046517 Bacteria 968
195 Ga0495665_0127037 3300046531 Bacteria 1335
196 Ga0495640_0090019 3300046533 Bacteria 2026
197 Ga0495640_0129003 3300046533 Bacteria 1638
198 Ga0495645_0273298 3300046543 Bacteria 1114
199 Ga0495634_0264664 3300046642 Bacteria 1048
200 Ga0495634_0303674 3300046642 Unclassified 964
201 Ga0495635_0356740 3300046663 Bacteria 975
202 Ga0495599_0249793 3300046678 Unclassified 1080
203 Ga0495658_0102744 3300046683 Bacteria 1708
204 Ga0495658_0215678 3300046683 Unclassified 1200
205 Ga0495613_0000927 3300046689 Bacteria 22499
206 Ga0495600_0076081 3300046809 Bacteria 2192
207 Ga0495581_0124380 3300047315 Bacteria 1502
208 Ga0495604_0057732 3300047317 Bacteria 2983
209 Ga0495674_0005735 3300047319 Bacteria 11901
210 Ga0495674_0295378 3300047319 Bacteria 1324
211 Ga0495680_0119602 3300047322 Bacteria 1946
212 Ga0495684_0000048 3300047471 Bacteria 89243
213 Ga0496101_0000685 3300048904 Bacteria 20428
214 Ga0496102_0696839 3300048905 Bacteria 939
215 Ga0496104_0214743 3300048907 Bacteria 1835
216 Ga0496104_0447242 3300048907 Bacteria 1204
217 Ga0496105_0042435 3300048908 Bacteria 3750
218 Ga0496105_0286194 3300048908 Bacteria 1328
219 Ga0496107_0236747 3300048910 Bacteria 1359
220 Ga0496108_0029582 3300048911 Bacteria 4538
221 Ga0496109_0562135 3300048912 Bacteria 1076
222 Ga0496110_0068299 3300048913 Bacteria 3146
223 Ga0496111_0212936 3300048914 Bacteria 1435
224 Ga0496114_0070631 3300048917 Bacteria 2933
225 Ga0496114_0110426 3300048917 Unclassified 2355
226 Ga0496114_0242798 3300048917 Unclassified 1584
227 Ga0501036_0035823 3300049572 Bacteria 4200
228 Ga0501036_0051854 3300049572 Bacteria 3474
229 Ga0501039_0043031 3300049575 Bacteria 3489
230 Ga0501040_0006107 3300049576 Bacteria 7814
231 Ga0501041_0006178 3300049577 Bacteria 7001
232 Ga0501042_0010389 3300049578 Bacteria 6241
233 Ga0501043_0061223 3300049579 Bacteria 2956
234 Ga0501046_0007776 3300049580 Bacteria 9404
235 Ga0501068_0210468 3300049584 Bacteria 1234
236 Ga0501071_0008592 3300049587 Bacteria 6750
237 Ga0501074_0218045 3300049590 Unclassified 1359
238 Ga0501075_0001743 3300049591 Bacteria 14308
239 Ga0501076_0001162 3300049592 Bacteria 17406
240 Ga0501077_0008036 3300049593 Bacteria 6521
241 Ga0501079_0028989 3300049741 Bacteria 4249
242 Ga0501079_0212502 3300049741 Bacteria 1511
243 Ga0501080_0072928 3300049742 Bacteria 3194
244 Ga0501081_0055339 3300049743 Bacteria 2741
245 Ga0501045_0028244 3300049824 Bacteria 4046
246 nmdc:mga05p37_22241_c1 3300050507 Bacteria 7687
247 nmdc:mga05p37_29063_c1 3300050507 Bacteria 6746
248 nmdc:mga05p37_316459_c1 3300050507 Unclassified 1848
249 nmdc:mga05p37_625762_c1 3300050507 Bacteria 1210
250 nmdc:mga06r32_1143810_c1 3300050510 Unclassified 726
251 nmdc:mga08y16_170699_c1 3300050511 Unclassified 2259
252 nmdc:mga08y16_224901_c1 3300050511 Bacteria 1942
253 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
254 nmdc:mga0n895_16763_c1 3300050512 Bacteria 6733
255 nmdc:mga0n895_188368_c1 3300050512 Unclassified 2094
256 nmdc:mga0n895_45134_c1 3300050512 Bacteria 4299
257 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
258 nmdc:mga08x19_111660_c1 3300050514 Bacteria 1824
259 nmdc:mga08x19_17643_c1 3300050514 Bacteria 4371
260 nmdc:mga08x19_66034_c1 3300050514 Unclassified 2350
261 nmdc:mga0a205_122842_c1 3300050515 Bacteria 2496
262 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
263 Ga0495601_0082246 3300053077 Bacteria 2067
264 Ga0495601_0153745 3300053077 Bacteria 1502
265 Ga0495619_0001582 3300053085 Bacteria 14969
266 Ga0495619_0028066 3300053085 Bacteria 3629
267 Ga0501084_0133752 3300054114 Bacteria 2087
268 Ga0501082_0012981 3300060353 Bacteria 7161
269 Ga0501082_0052057 3300060353 Bacteria 3529
270 Ga0530510_0023942 3300061734 Bacteria 4355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0236747 Ga0496107_0236747_17_712 216
2 3300048912 Ga0496109_0562135 Ga0496109_0562135_26_742 223
3 3300050510 nmdc:mga06r32_1143810_c1 nmdc:mga06r32_1143810_c1_16_699 223
4 3300005539 Ga0068853_101131660 Ga0068853_1011316601 224
5 3300005518 Ga0070699_100095635 Ga0070699_1000956352 229
6 3300035172 Ga0373955_0139642 Ga0373955_0139642_98_859 238
7 3300046517 Ga0495630_0466212 Ga0495630_0466212_121_882 238
8 3300048904 Ga0496101_0000685 Ga0496101_0000685_15792_16553 238
9 3300048907 Ga0496104_0214743 Ga0496104_0214743_692_1453 238
10 3300048908 Ga0496105_0042435 Ga0496105_0042435_2177_2938 238
11 3300048911 Ga0496108_0029582 Ga0496108_0029582_997_1758 238
12 3300048917 Ga0496114_0070631 Ga0496114_0070631_1340_2101 238
13 3300050507 nmdc:mga05p37_29063_c1 nmdc:mga05p37_29063_c1_2374_3138 238
14 3300046683 Ga0495658_0215678 Ga0495658_0215678_71_802 239
15 3300032002 Ga0307416_100213792 Ga0307416_1002137923 241
16 3300005353 Ga0070669_100032868 Ga0070669_1000328686 242
17 3300005843 Ga0068860_100033594 Ga0068860_1000335943 242
18 3300028381 Ga0268264_10000914 Ga0268264_1000091430 242
19 3300005337 Ga0070682_100188575 Ga0070682_1001885753 243
20 3300005842 Ga0068858_100172126 Ga0068858_1001721262 243
21 3300025918 Ga0207662_10298999 Ga0207662_102989991 243
22 3300035172 Ga0373955_0058325 Ga0373955_0058325_995_1726 243
23 3300048908 Ga0496105_0286194 Ga0496105_0286194_190_921 243
24 3300048913 Ga0496110_0068299 Ga0496110_0068299_1955_2686 243
25 3300048914 Ga0496111_0212936 Ga0496111_0212936_216_947 243
26 3300050514 nmdc:mga08x19_111660_c1 nmdc:mga08x19_111660_c1_631_1413 243
27 3300053085 Ga0495619_0028066 Ga0495619_0028066_914_1645 243
28 3300002459 JGI24751J29686_10005770 JGI24751J29686_100057703 244
29 3300004803 Ga0058862_10011738 Ga0058862_100117384 244
30 3300004803 Ga0058862_12645855 Ga0058862_126458552 244
31 3300005290 Ga0065712_10103209 Ga0065712_101032091 244
32 3300005295 Ga0065707_10085132 Ga0065707_100851327 244
33 3300005330 Ga0070690_100042976 Ga0070690_1000429763 244
34 3300005331 Ga0070670_100108148 Ga0070670_1001081484 244
35 3300005334 Ga0068869_100377106 Ga0068869_1003771061 244
36 3300005336 Ga0070680_100068878 Ga0070680_1000688782 244
37 3300005337 Ga0070682_100022409 Ga0070682_1000224094 244
38 3300005338 Ga0068868_100032766 Ga0068868_1000327666 244
39 3300005339 Ga0070660_100043306 Ga0070660_1000433066 244
40 3300005340 Ga0070689_100012538 Ga0070689_1000125387 244
41 3300005340 Ga0070689_100115523 Ga0070689_1001155232 244
42 3300005347 Ga0070668_100017730 Ga0070668_1000177304 244
43 3300005353 Ga0070669_100029234 Ga0070669_1000292344 244
44 3300005354 Ga0070675_100001537 Ga0070675_10000153713 244
45 3300005364 Ga0070673_100071637 Ga0070673_1000716372 244
46 3300005365 Ga0070688_100125104 Ga0070688_1001251041 244
47 3300005434 Ga0070709_10111748 Ga0070709_101117484 244
48 3300005441 Ga0070700_100123643 Ga0070700_1001236432 244
49 3300005458 Ga0070681_10096194 Ga0070681_100961944 244
50 3300005466 Ga0070685_10194166 Ga0070685_101941662 244
51 3300005466 Ga0070685_10287006 Ga0070685_102870062 244
52 3300005518 Ga0070699_100031590 Ga0070699_1000315902 244
53 3300005530 Ga0070679_100017287 Ga0070679_1000172877 244
54 3300005530 Ga0070679_100037637 Ga0070679_1000376374 244
55 3300005535 Ga0070684_100107642 Ga0070684_1001076422 244
56 3300005536 Ga0070697_100387535 Ga0070697_1003875351 244
57 3300005543 Ga0070672_100620427 Ga0070672_1006204272 244
58 3300005544 Ga0070686_100025887 Ga0070686_1000258875 244
59 3300005546 Ga0070696_100127485 Ga0070696_1001274851 244
60 3300005548 Ga0070665_100015165 Ga0070665_10001516510 244
61 3300005549 Ga0070704_100234664 Ga0070704_1002346642 244
62 3300005563 Ga0068855_100023932 Ga0068855_1000239323 244
63 3300005577 Ga0068857_100161381 Ga0068857_1001613814 244
64 3300005578 Ga0068854_100112789 Ga0068854_1001127895 244
65 3300005617 Ga0068859_100116866 Ga0068859_1001168662 244
66 3300005617 Ga0068859_100195942 Ga0068859_1001959421 244
67 3300005617 Ga0068859_100348747 Ga0068859_1003487472 244
68 3300005718 Ga0068866_10148952 Ga0068866_101489522 244
69 3300005719 Ga0068861_100019838 Ga0068861_1000198383 244
70 3300005719 Ga0068861_100158990 Ga0068861_1001589902 244
71 3300005834 Ga0068851_10118823 Ga0068851_101188231 244
72 3300005842 Ga0068858_100033441 Ga0068858_1000334414 244
73 3300005842 Ga0068858_100087997 Ga0068858_1000879973 244
74 3300005842 Ga0068858_100182129 Ga0068858_1001821294 244
75 3300005842 Ga0068858_100256176 Ga0068858_1002561763 244
76 3300005842 Ga0068858_100292522 Ga0068858_1002925221 244
77 3300005844 Ga0068862_100118204 Ga0068862_1001182045 244
78 3300005844 Ga0068862_100131594 Ga0068862_1001315942 244
79 3300005844 Ga0068862_100238362 Ga0068862_1002383622 244
80 3300005937 Ga0081455_10377844 Ga0081455_103778442 244
81 3300005983 Ga0081540_1064403 Ga0081540_10644031 244
82 3300006028 Ga0070717_10223110 Ga0070717_102231104 244
83 3300006028 Ga0070717_10290366 Ga0070717_102903662 244
84 3300006163 Ga0070715_10114160 Ga0070715_101141601 244
85 3300006163 Ga0070715_10235052 Ga0070715_102350521 244
86 3300006173 Ga0070716_100160600 Ga0070716_1001606001 244
87 3300006173 Ga0070716_100239708 Ga0070716_1002397082 244
88 3300006237 Ga0097621_100009469 Ga0097621_1000094695 244
89 3300006237 Ga0097621_100050539 Ga0097621_1000505393 244
90 3300006237 Ga0097621_100286538 Ga0097621_1002865384 244
91 3300006358 Ga0068871_100012578 Ga0068871_1000125785 244
92 3300006358 Ga0068871_100171531 Ga0068871_1001715313 244
93 3300006358 Ga0068871_100396225 Ga0068871_1003962252 244
94 3300006852 Ga0075433_10067266 Ga0075433_100672666 244
95 3300006852 Ga0075433_10128269 Ga0075433_101282692 244
96 3300006871 Ga0075434_100021223 Ga0075434_1000212231 244
97 3300006871 Ga0075434_100060975 Ga0075434_1000609751 244
98 3300006871 Ga0075434_100730850 Ga0075434_1007308501 244
99 3300006914 Ga0075436_100010393 Ga0075436_1000103939 244
100 3300006931 Ga0097620_100116871 Ga0097620_1001168712 244
101 3300006931 Ga0097620_100195915 Ga0097620_1001959151 244
102 3300006931 Ga0097620_100348736 Ga0097620_1003487362 244
103 3300007076 Ga0075435_100004448 Ga0075435_10000444810 244
104 3300007076 Ga0075435_100052494 Ga0075435_1000524946 244
105 3300007076 Ga0075435_100053991 Ga0075435_1000539916 244
106 3300009094 Ga0111539_10211189 Ga0111539_102111893 244
107 3300009094 Ga0111539_10279755 Ga0111539_102797555 244
108 3300009098 Ga0105245_10059584 Ga0105245_100595842 244
109 3300009098 Ga0105245_10643245 Ga0105245_106432451 244
110 3300009101 Ga0105247_10017382 Ga0105247_100173822 244
111 3300009147 Ga0114129_10111924 Ga0114129_101119242 244
112 3300009147 Ga0114129_10113164 Ga0114129_101131646 244
113 3300009147 Ga0114129_10140444 Ga0114129_101404444 244
114 3300009148 Ga0105243_10465030 Ga0105243_104650302 244
115 3300009176 Ga0105242_10033222 Ga0105242_100332225 244
116 3300009176 Ga0105242_10350803 Ga0105242_103508033 244
117 3300009176 Ga0105242_10586345 Ga0105242_105863451 244
118 3300009177 Ga0105248_10024770 Ga0105248_100247705 244
119 3300009177 Ga0105248_10030747 Ga0105248_100307478 244
120 3300009177 Ga0105248_10089169 Ga0105248_100891692 244
121 3300009177 Ga0105248_10294126 Ga0105248_102941264 244
122 3300009177 Ga0105248_10398291 Ga0105248_103982911 244
123 3300009551 Ga0105238_10673454 Ga0105238_106734542 244
124 3300009553 Ga0105249_10016229 Ga0105249_100162296 244
125 3300009553 Ga0105249_10152751 Ga0105249_101527515 244
126 3300013296 Ga0157374_10118383 Ga0157374_101183834 244
127 3300013296 Ga0157374_10138351 Ga0157374_101383515 244
128 3300013297 Ga0157378_10608506 Ga0157378_106085062 244
129 3300013306 Ga0163162_10293786 Ga0163162_102937862 244
130 3300013308 Ga0157375_10118016 Ga0157375_101180164 244
131 3300013308 Ga0157375_10255970 Ga0157375_102559701 244
132 3300014325 Ga0163163_10816813 Ga0163163_108168131 244
133 3300014326 Ga0157380_10034301 Ga0157380_100343016 244
134 3300014326 Ga0157380_10556061 Ga0157380_105560613 244
135 3300014745 Ga0157377_10041426 Ga0157377_100414265 244
136 3300014968 Ga0157379_10046157 Ga0157379_100461576 244
137 3300014969 Ga0157376_10033860 Ga0157376_100338603 244
138 3300014969 Ga0157376_10104160 Ga0157376_101041606 244
139 3300017792 Ga0163161_10536564 Ga0163161_105365641 244
140 3300025321 Ga0207656_10072012 Ga0207656_100720122 244
141 3300025899 Ga0207642_10164544 Ga0207642_101645443 244
142 3300025899 Ga0207642_10333683 Ga0207642_103336832 244
143 3300025903 Ga0207680_10126221 Ga0207680_101262212 244
144 3300025903 Ga0207680_10271543 Ga0207680_102715432 244
145 3300025905 Ga0207685_10052116 Ga0207685_100521162 244
146 3300025906 Ga0207699_10056009 Ga0207699_100560093 244
147 3300025907 Ga0207645_10195145 Ga0207645_101951452 244
148 3300025911 Ga0207654_10479425 Ga0207654_104794251 244
149 3300025912 Ga0207707_10140018 Ga0207707_101400184 244
150 3300025919 Ga0207657_10043378 Ga0207657_100433782 244
151 3300025921 Ga0207652_10166557 Ga0207652_101665572 244
152 3300025923 Ga0207681_10094518 Ga0207681_100945183 244
153 3300025924 Ga0207694_10366760 Ga0207694_103667601 244
154 3300025926 Ga0207659_10001294 Ga0207659_1000129410 244
155 3300025928 Ga0207700_10287925 Ga0207700_102879254 244
156 3300025931 Ga0207644_10391109 Ga0207644_103911091 244
157 3300025933 Ga0207706_10017122 Ga0207706_100171228 244
158 3300025933 Ga0207706_10171863 Ga0207706_101718634 244
159 3300025935 Ga0207709_10488825 Ga0207709_104888251 244
160 3300025936 Ga0207670_10021814 Ga0207670_100218144 244
161 3300025937 Ga0207669_10008545 Ga0207669_100085457 244
162 3300025939 Ga0207665_10031837 Ga0207665_100318372 244
163 3300025940 Ga0207691_10298670 Ga0207691_102986702 244
164 3300025941 Ga0207711_10179790 Ga0207711_101797903 244
165 3300025941 Ga0207711_10185737 Ga0207711_101857372 244
166 3300025941 Ga0207711_10259594 Ga0207711_102595944 244
167 3300025941 Ga0207711_10330031 Ga0207711_103300312 244
168 3300025941 Ga0207711_10420763 Ga0207711_104207631 244
169 3300025949 Ga0207667_10131233 Ga0207667_101312332 244
170 3300025961 Ga0207712_10513540 Ga0207712_105135401 244
171 3300025981 Ga0207640_10082191 Ga0207640_100821915 244
172 3300026023 Ga0207677_10413136 Ga0207677_104131361 244
173 3300026035 Ga0207703_10002242 Ga0207703_100022429 244
174 3300026035 Ga0207703_10065818 Ga0207703_100658182 244
175 3300026035 Ga0207703_10194583 Ga0207703_101945833 244
176 3300026035 Ga0207703_10275782 Ga0207703_102757821 244
177 3300026088 Ga0207641_10179295 Ga0207641_101792953 244
178 3300026089 Ga0207648_10018889 Ga0207648_100188896 244
179 3300026095 Ga0207676_10036797 Ga0207676_100367975 244
180 3300026095 Ga0207676_10623132 Ga0207676_106231321 244
181 3300026118 Ga0207675_100015362 Ga0207675_1000153624 244
182 3300026118 Ga0207675_100070825 Ga0207675_1000708256 244
183 3300026118 Ga0207675_100150562 Ga0207675_1001505625 244
184 3300026118 Ga0207675_100267634 Ga0207675_1002676341 244
185 3300026121 Ga0207683_10130767 Ga0207683_101307673 244
186 3300027907 Ga0207428_10403623 Ga0207428_104036232 244
187 3300028379 Ga0268266_10057208 Ga0268266_100572082 244
188 3300028380 Ga0268265_10096270 Ga0268265_100962701 244
189 3300028380 Ga0268265_10107418 Ga0268265_101074185 244
190 3300028380 Ga0268265_10325890 Ga0268265_103258902 244
191 3300028381 Ga0268264_10560439 Ga0268264_105604392 244
192 3300028381 Ga0268264_10919633 Ga0268264_109196331 244
193 3300031238 Ga0265332_10076490 Ga0265332_100764902 244
194 3300031711 Ga0265314_10038728 Ga0265314_100387282 244
195 3300031712 Ga0265342_10188622 Ga0265342_101886222 244
196 3300035086 Ga0373934_0048760 Ga0373934_0048760_453_1232 244
197 3300035113 Ga0373936_0020647 Ga0373936_0020647_159_905 244
198 3300035170 Ga0373943_0005334 Ga0373943_0005334_4434_5180 244
199 3300035171 Ga0373946_0016837 Ga0373946_0016837_155_901 244
200 3300035410 Ga0373924_0010839 Ga0373924_0010839_889_1635 244
201 3300035695 Ga0373927_0030205 Ga0373927_0030205_2039_2785 244
202 3300035724 Ga0373933_0080287 Ga0373933_0080287_32_814 244
203 3300035725 Ga0373947_0045052 Ga0373947_0045052_144_890 244
204 3300036401 Ga0373937_0273624 Ga0373937_0273624_13_792 244
205 3300036401 Ga0373937_0423000 Ga0373937_0423000_186_965 244
206 3300037068 Ga0373925_0050984 Ga0373925_0050984_1739_2485 244
207 3300046454 Ga0495592_0027038 Ga0495592_0027038_975_1754 244
208 3300046516 Ga0495628_0032989 Ga0495628_0032989_2184_2963 244
209 3300046517 Ga0495630_0048370 Ga0495630_0048370_577_1356 244
210 3300046531 Ga0495665_0127037 Ga0495665_0127037_289_1068 244
211 3300046533 Ga0495640_0090019 Ga0495640_0090019_495_1274 244
212 3300046533 Ga0495640_0129003 Ga0495640_0129003_276_1022 244
213 3300046543 Ga0495645_0273298 Ga0495645_0273298_277_1056 244
214 3300046642 Ga0495634_0264664 Ga0495634_0264664_68_847 244
215 3300046642 Ga0495634_0303674 Ga0495634_0303674_123_905 244
216 3300046663 Ga0495635_0356740 Ga0495635_0356740_94_873 244
217 3300046678 Ga0495599_0249793 Ga0495599_0249793_321_1067 244
218 3300046683 Ga0495658_0102744 Ga0495658_0102744_781_1560 244
219 3300046689 Ga0495613_0000927 Ga0495613_0000927_7539_8318 244
220 3300046809 Ga0495600_0076081 Ga0495600_0076081_14_793 244
221 3300047315 Ga0495581_0124380 Ga0495581_0124380_47_784 244
222 3300047317 Ga0495604_0057732 Ga0495604_0057732_1991_2770 244
223 3300047319 Ga0495674_0005735 Ga0495674_0005735_8179_8958 244
224 3300047319 Ga0495674_0295378 Ga0495674_0295378_504_1283 244
225 3300047322 Ga0495680_0119602 Ga0495680_0119602_452_1231 244
226 3300047471 Ga0495684_0000048 Ga0495684_0000048_42989_43768 244
227 3300048905 Ga0496102_0696839 Ga0496102_0696839_97_852 244
228 3300048907 Ga0496104_0447242 Ga0496104_0447242_250_1029 244
229 3300048917 Ga0496114_0110426 Ga0496114_0110426_451_1233 244
230 3300048917 Ga0496114_0242798 Ga0496114_0242798_459_1241 244
231 3300049572 Ga0501036_0035823 Ga0501036_0035823_1386_2150 244
232 3300049572 Ga0501036_0051854 Ga0501036_0051854_1325_2074 244
233 3300049575 Ga0501039_0043031 Ga0501039_0043031_1574_2323 244
234 3300049576 Ga0501040_0006107 Ga0501040_0006107_6165_6914 244
235 3300049577 Ga0501041_0006178 Ga0501041_0006178_5358_6107 244
236 3300049578 Ga0501042_0010389 Ga0501042_0010389_4120_4869 244
237 3300049579 Ga0501043_0061223 Ga0501043_0061223_1933_2682 244
238 3300049580 Ga0501046_0007776 Ga0501046_0007776_1695_2444 244
239 3300049584 Ga0501068_0210468 Ga0501068_0210468_404_1153 244
240 3300049587 Ga0501071_0008592 Ga0501071_0008592_5774_6523 244
241 3300049590 Ga0501074_0218045 Ga0501074_0218045_38_787 244
242 3300049591 Ga0501075_0001743 Ga0501075_0001743_5096_5845 244
243 3300049592 Ga0501076_0001162 Ga0501076_0001162_1789_2538 244
244 3300049593 Ga0501077_0008036 Ga0501077_0008036_4875_5624 244
245 3300049741 Ga0501079_0028989 Ga0501079_0028989_3164_3913 244
246 3300049741 Ga0501079_0212502 Ga0501079_0212502_510_1274 244
247 3300049742 Ga0501080_0072928 Ga0501080_0072928_1440_2189 244
248 3300049743 Ga0501081_0055339 Ga0501081_0055339_424_1173 244
249 3300049824 Ga0501045_0028244 Ga0501045_0028244_1340_2089 244
250 3300050507 nmdc:mga05p37_22241_c1 nmdc:mga05p37_22241_c1_5120_5908 244
251 3300050507 nmdc:mga05p37_316459_c1 nmdc:mga05p37_316459_c1_284_1036 244
252 3300050507 nmdc:mga05p37_625762_c1 nmdc:mga05p37_625762_c1_399_1187 244
253 3300050511 nmdc:mga08y16_170699_c1 nmdc:mga08y16_170699_c1_1496_2242 244
254 3300050511 nmdc:mga08y16_224901_c1 nmdc:mga08y16_224901_c1_68_853 244
255 3300050512 nmdc:mga0n895_108320_c1 nmdc:mga0n895_108320_c1_1997_2749 244
256 3300050512 nmdc:mga0n895_16763_c1 nmdc:mga0n895_16763_c1_2709_3473 244
257 3300050512 nmdc:mga0n895_188368_c1 nmdc:mga0n895_188368_c1_572_1360 244
258 3300050512 nmdc:mga0n895_45134_c1 nmdc:mga0n895_45134_c1_3217_3954 244
259 3300050513 nmdc:mga0rr50_22625_c1 nmdc:mga0rr50_22625_c1_2103_2855 244
260 3300050514 nmdc:mga08x19_17643_c1 nmdc:mga08x19_17643_c1_614_1378 244
261 3300050514 nmdc:mga08x19_66034_c1 nmdc:mga08x19_66034_c1_361_1113 244
262 3300050515 nmdc:mga0a205_122842_c1 nmdc:mga0a205_122842_c1_1415_2203 244
263 3300050515 nmdc:mga0a205_59591_c1 nmdc:mga0a205_59591_c1_2185_2937 244
264 3300053077 Ga0495601_0082246 Ga0495601_0082246_15_761 244
265 3300053077 Ga0495601_0153745 Ga0495601_0153745_194_973 244
266 3300053085 Ga0495619_0001582 Ga0495619_0001582_7561_8340 244
267 3300054114 Ga0501084_0133752 Ga0501084_0133752_26_775 244
268 3300060353 Ga0501082_0012981 Ga0501082_0012981_1681_2430 244
269 3300060353 Ga0501082_0052057 Ga0501082_0052057_1455_2219 244
270 3300061734 Ga0530510_0023942 Ga0530510_0023942_1943_2707 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

102

241

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9347 155 229
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9308 155 229
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.9296 155 229
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9287 155 229
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9209 155 229
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9324 156 237 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9301 155 229 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9185 101 238 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9132 94 240 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8872 90 240 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7C7WHT2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9638 71 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7Y4TJV2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9594 77 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7W1TTH5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9583 82 241 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2V6L428-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9575 100 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A3B9LF19-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9523 68 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Feature Viewer

pLDDT pTM Quality
89.59 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map