F376843
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 180 | 270 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10223110|Ga0070717_102231104 |
| Length | 274 |
| Sequence | MLTLLGLPAAASTHAGDIDEMIVLVHWLMAILFVGWGLFFLYVLFRFRKGANPKASYTGAKGKISKGLEVAVAVIEVILLVFYAIPAWAKRVKAFPAENEATVVRVVGEQFAWNVHYPGPDGKFGRTDVKLVAPDNPLGLDRRDPDAKDDVTTINQLYLPVNRPVLIHLSSKDVIHSFGLYEMRVKQDAVPGMSIPVWFIPDTTTDEMRKKLNKPDFDYEITCSQLCGLGHFRMRGFVQVLSAADYQKWMADQEKELQPAVATPAAVPTAPRSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 120 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.19 |
| Rhizosphere | 94.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10005770 | 3300002459 | Bacteria | 2524 |
| 2 | Ga0058862_10011738 | 3300004803 | Bacteria | 1777 |
| 3 | Ga0058862_12645855 | 3300004803 | Unclassified | 1007 |
| 4 | Ga0065712_10103209 | 3300005290 | Unclassified | 1990 |
| 5 | Ga0065707_10085132 | 3300005295 | Bacteria | 6426 |
| 6 | Ga0070690_100042976 | 3300005330 | Bacteria | 2864 |
| 7 | Ga0070670_100108148 | 3300005331 | Unclassified | 2396 |
| 8 | Ga0068869_100377106 | 3300005334 | Unclassified | 1162 |
| 9 | Ga0070680_100068878 | 3300005336 | Bacteria | 2905 |
| 10 | Ga0070682_100022409 | 3300005337 | Bacteria | 3741 |
| 11 | Ga0070682_100188575 | 3300005337 | Bacteria | 1446 |
| 12 | Ga0068868_100032766 | 3300005338 | Bacteria | 3998 |
| 13 | Ga0070660_100043306 | 3300005339 | Bacteria | 3440 |
| 14 | Ga0070689_100012538 | 3300005340 | Bacteria | 6110 |
| 15 | Ga0070689_100115523 | 3300005340 | Bacteria | 2139 |
| 16 | Ga0070668_100017730 | 3300005347 | Bacteria | 5339 |
| 17 | Ga0070669_100029234 | 3300005353 | Bacteria | 3972 |
| 18 | Ga0070669_100032868 | 3300005353 | Bacteria | 3749 |
| 19 | Ga0070675_100001537 | 3300005354 | Bacteria | 17074 |
| 20 | Ga0070673_100071637 | 3300005364 | Bacteria | 2785 |
| 21 | Ga0070688_100125104 | 3300005365 | Unclassified | 1727 |
| 22 | Ga0070709_10111748 | 3300005434 | Bacteria | 1837 |
| 23 | Ga0070700_100123643 | 3300005441 | Bacteria | 1737 |
| 24 | Ga0070681_10096194 | 3300005458 | Bacteria | 2910 |
| 25 | Ga0070685_10194166 | 3300005466 | Unclassified | 1315 |
| 26 | Ga0070685_10287006 | 3300005466 | Bacteria | 1104 |
| 27 | Ga0070699_100031590 | 3300005518 | Bacteria | 4572 |
| 28 | Ga0070699_100095635 | 3300005518 | Bacteria | 2601 |
| 29 | Ga0070679_100017287 | 3300005530 | Bacteria | 6979 |
| 30 | Ga0070679_100037637 | 3300005530 | Bacteria | 4807 |
| 31 | Ga0070684_100107642 | 3300005535 | Bacteria | 2497 |
| 32 | Ga0070697_100387535 | 3300005536 | Unclassified | 1211 |
| 33 | Ga0068853_101131660 | 3300005539 | Unclassified | 755 |
| 34 | Ga0070672_100620427 | 3300005543 | Unclassified | 943 |
| 35 | Ga0070686_100025887 | 3300005544 | Bacteria | 3534 |
| 36 | Ga0070696_100127485 | 3300005546 | Bacteria | 1848 |
| 37 | Ga0070665_100015165 | 3300005548 | Bacteria | 7737 |
| 38 | Ga0070704_100234664 | 3300005549 | Unclassified | 1498 |
| 39 | Ga0068855_100023932 | 3300005563 | Bacteria | 7314 |
| 40 | Ga0068857_100161381 | 3300005577 | Bacteria | 2034 |
| 41 | Ga0068854_100112789 | 3300005578 | Bacteria | 2053 |
| 42 | Ga0068859_100116866 | 3300005617 | Bacteria | 2732 |
| 43 | Ga0068859_100195942 | 3300005617 | Bacteria | 2105 |
| 44 | Ga0068859_100348747 | 3300005617 | Bacteria | 1575 |
| 45 | Ga0068866_10148952 | 3300005718 | Bacteria | 1353 |
| 46 | Ga0068861_100019838 | 3300005719 | Bacteria | 4805 |
| 47 | Ga0068861_100158990 | 3300005719 | Bacteria | 1862 |
| 48 | Ga0068851_10118823 | 3300005834 | Bacteria | 1418 |
| 49 | Ga0068858_100033441 | 3300005842 | Unclassified | 4771 |
| 50 | Ga0068858_100087997 | 3300005842 | Bacteria | 2889 |
| 51 | Ga0068858_100172126 | 3300005842 | Bacteria | 2042 |
| 52 | Ga0068858_100182129 | 3300005842 | Bacteria | 1984 |
| 53 | Ga0068858_100256176 | 3300005842 | Bacteria | 1663 |
| 54 | Ga0068858_100292522 | 3300005842 | Bacteria | 1553 |
| 55 | Ga0068860_100033594 | 3300005843 | Bacteria | 4921 |
| 56 | Ga0068862_100118204 | 3300005844 | Bacteria | 2334 |
| 57 | Ga0068862_100131594 | 3300005844 | Bacteria | 2213 |
| 58 | Ga0068862_100238362 | 3300005844 | Unclassified | 1653 |
| 59 | Ga0081455_10377844 | 3300005937 | Unclassified | 991 |
| 60 | Ga0081540_1064403 | 3300005983 | Bacteria | 1729 |
| 61 | Ga0070717_10223110 | 3300006028 | Unclassified | 1657 |
| 62 | Ga0070717_10290366 | 3300006028 | Bacteria | 1452 |
| 63 | Ga0070715_10114160 | 3300006163 | Bacteria | 1278 |
| 64 | Ga0070715_10235052 | 3300006163 | Bacteria | 950 |
| 65 | Ga0070716_100160600 | 3300006173 | Unclassified | 1456 |
| 66 | Ga0070716_100239708 | 3300006173 | Unclassified | 1229 |
| 67 | Ga0097621_100009469 | 3300006237 | Bacteria | 7071 |
| 68 | Ga0097621_100050539 | 3300006237 | Bacteria | 3381 |
| 69 | Ga0097621_100286538 | 3300006237 | Bacteria | 1451 |
| 70 | Ga0068871_100012578 | 3300006358 | Bacteria | 6248 |
| 71 | Ga0068871_100171531 | 3300006358 | Unclassified | 1860 |
| 72 | Ga0068871_100396225 | 3300006358 | Unclassified | 1229 |
| 73 | Ga0075433_10067266 | 3300006852 | Bacteria | 3145 |
| 74 | Ga0075433_10128269 | 3300006852 | Bacteria | 2253 |
| 75 | Ga0075434_100021223 | 3300006871 | Bacteria | 6312 |
| 76 | Ga0075434_100060975 | 3300006871 | Bacteria | 3752 |
| 77 | Ga0075434_100730850 | 3300006871 | Bacteria | 1007 |
| 78 | Ga0075436_100010393 | 3300006914 | Bacteria | 6379 |
| 79 | Ga0097620_100116871 | 3300006931 | Bacteria | 2732 |
| 80 | Ga0097620_100195915 | 3300006931 | Bacteria | 2105 |
| 81 | Ga0097620_100348736 | 3300006931 | Bacteria | 1575 |
| 82 | Ga0075435_100004448 | 3300007076 | Bacteria | 9632 |
| 83 | Ga0075435_100052494 | 3300007076 | Bacteria | 3286 |
| 84 | Ga0075435_100053991 | 3300007076 | Bacteria | 3242 |
| 85 | Ga0111539_10211189 | 3300009094 | Unclassified | 2261 |
| 86 | Ga0111539_10279755 | 3300009094 | Bacteria | 1942 |
| 87 | Ga0105245_10059584 | 3300009098 | Bacteria | 3438 |
| 88 | Ga0105245_10643245 | 3300009098 | Unclassified | 1090 |
| 89 | Ga0105247_10017382 | 3300009101 | Bacteria | 4319 |
| 90 | Ga0114129_10111924 | 3300009147 | Bacteria | 3766 |
| 91 | Ga0114129_10113164 | 3300009147 | Bacteria | 3742 |
| 92 | Ga0114129_10140444 | 3300009147 | Bacteria | 3311 |
| 93 | Ga0105243_10465030 | 3300009148 | Bacteria | 1190 |
| 94 | Ga0105242_10033222 | 3300009176 | Bacteria | 4130 |
| 95 | Ga0105242_10350803 | 3300009176 | Bacteria | 1363 |
| 96 | Ga0105242_10586345 | 3300009176 | Bacteria | 1075 |
| 97 | Ga0105248_10024770 | 3300009177 | Bacteria | 6674 |
| 98 | Ga0105248_10030747 | 3300009177 | Bacteria | 5998 |
| 99 | Ga0105248_10089169 | 3300009177 | Bacteria | 3472 |
| 100 | Ga0105248_10294126 | 3300009177 | Unclassified | 1829 |
| 101 | Ga0105248_10398291 | 3300009177 | Unclassified | 1550 |
| 102 | Ga0105238_10673454 | 3300009551 | Unclassified | 1046 |
| 103 | Ga0105249_10016229 | 3300009553 | Bacteria | 6605 |
| 104 | Ga0105249_10152751 | 3300009553 | Bacteria | 2224 |
| 105 | Ga0157374_10118383 | 3300013296 | Bacteria | 2554 |
| 106 | Ga0157374_10138351 | 3300013296 | Bacteria | 2362 |
| 107 | Ga0157378_10608506 | 3300013297 | Unclassified | 1105 |
| 108 | Ga0163162_10293786 | 3300013306 | Bacteria | 1757 |
| 109 | Ga0157375_10118016 | 3300013308 | Unclassified | 2759 |
| 110 | Ga0157375_10255970 | 3300013308 | Bacteria | 1912 |
| 111 | Ga0163163_10816813 | 3300014325 | Bacteria | 996 |
| 112 | Ga0157380_10034301 | 3300014326 | Bacteria | 3913 |
| 113 | Ga0157380_10556061 | 3300014326 | Unclassified | 1127 |
| 114 | Ga0157377_10041426 | 3300014745 | Bacteria | 2555 |
| 115 | Ga0157379_10046157 | 3300014968 | Bacteria | 3888 |
| 116 | Ga0157376_10033860 | 3300014969 | Bacteria | 4118 |
| 117 | Ga0157376_10104160 | 3300014969 | Bacteria | 2486 |
| 118 | Ga0163161_10536564 | 3300017792 | Unclassified | 957 |
| 119 | Ga0207656_10072012 | 3300025321 | Bacteria | 1538 |
| 120 | Ga0207642_10164544 | 3300025899 | Bacteria | 1194 |
| 121 | Ga0207642_10333683 | 3300025899 | Bacteria | 889 |
| 122 | Ga0207680_10126221 | 3300025903 | Unclassified | 1680 |
| 123 | Ga0207680_10271543 | 3300025903 | Bacteria | 1176 |
| 124 | Ga0207685_10052116 | 3300025905 | Bacteria | 1584 |
| 125 | Ga0207699_10056009 | 3300025906 | Bacteria | 2348 |
| 126 | Ga0207645_10195145 | 3300025907 | Unclassified | 1331 |
| 127 | Ga0207654_10479425 | 3300025911 | Bacteria | 876 |
| 128 | Ga0207707_10140018 | 3300025912 | Bacteria | 2116 |
| 129 | Ga0207662_10298999 | 3300025918 | Bacteria | 1069 |
| 130 | Ga0207657_10043378 | 3300025919 | Bacteria | 3962 |
| 131 | Ga0207652_10166557 | 3300025921 | Bacteria | 1976 |
| 132 | Ga0207681_10094518 | 3300025923 | Bacteria | 2142 |
| 133 | Ga0207694_10366760 | 3300025924 | Bacteria | 1194 |
| 134 | Ga0207659_10001294 | 3300025926 | Bacteria | 14955 |
| 135 | Ga0207700_10287925 | 3300025928 | Bacteria | 1415 |
| 136 | Ga0207644_10391109 | 3300025931 | Bacteria | 1135 |
| 137 | Ga0207706_10017122 | 3300025933 | Bacteria | 6536 |
| 138 | Ga0207706_10171863 | 3300025933 | Bacteria | 1904 |
| 139 | Ga0207709_10488825 | 3300025935 | Unclassified | 958 |
| 140 | Ga0207670_10021814 | 3300025936 | Unclassified | 3957 |
| 141 | Ga0207669_10008545 | 3300025937 | Bacteria | 4814 |
| 142 | Ga0207665_10031837 | 3300025939 | Unclassified | 3491 |
| 143 | Ga0207691_10298670 | 3300025940 | Bacteria | 1384 |
| 144 | Ga0207711_10179790 | 3300025941 | Bacteria | 1923 |
| 145 | Ga0207711_10185737 | 3300025941 | Bacteria | 1892 |
| 146 | Ga0207711_10259594 | 3300025941 | Bacteria | 1596 |
| 147 | Ga0207711_10330031 | 3300025941 | Bacteria | 1411 |
| 148 | Ga0207711_10420763 | 3300025941 | Unclassified | 1243 |
| 149 | Ga0207667_10131233 | 3300025949 | Bacteria | 2580 |
| 150 | Ga0207712_10513540 | 3300025961 | Bacteria | 1026 |
| 151 | Ga0207640_10082191 | 3300025981 | Bacteria | 2205 |
| 152 | Ga0207677_10413136 | 3300026023 | Bacteria | 1147 |
| 153 | Ga0207703_10002242 | 3300026035 | Bacteria | 16903 |
| 154 | Ga0207703_10065818 | 3300026035 | Bacteria | 2979 |
| 155 | Ga0207703_10194583 | 3300026035 | Bacteria | 1798 |
| 156 | Ga0207703_10275782 | 3300026035 | Bacteria | 1525 |
| 157 | Ga0207641_10179295 | 3300026088 | Bacteria | 1939 |
| 158 | Ga0207648_10018889 | 3300026089 | Bacteria | 6227 |
| 159 | Ga0207676_10036797 | 3300026095 | Bacteria | 3726 |
| 160 | Ga0207676_10623132 | 3300026095 | Bacteria | 1038 |
| 161 | Ga0207675_100015362 | 3300026118 | Bacteria | 7141 |
| 162 | Ga0207675_100070825 | 3300026118 | Bacteria | 3259 |
| 163 | Ga0207675_100150562 | 3300026118 | Bacteria | 2214 |
| 164 | Ga0207675_100267634 | 3300026118 | Bacteria | 1658 |
| 165 | Ga0207683_10130767 | 3300026121 | Bacteria | 2258 |
| 166 | Ga0207428_10403623 | 3300027907 | Bacteria | 1000 |
| 167 | Ga0268266_10057208 | 3300028379 | Bacteria | 3355 |
| 168 | Ga0268265_10096270 | 3300028380 | Unclassified | 2379 |
| 169 | Ga0268265_10107418 | 3300028380 | Bacteria | 2269 |
| 170 | Ga0268265_10325890 | 3300028380 | Bacteria | 1393 |
| 171 | Ga0268264_10000914 | 3300028381 | Bacteria | 30928 |
| 172 | Ga0268264_10560439 | 3300028381 | Unclassified | 1122 |
| 173 | Ga0268264_10919633 | 3300028381 | Bacteria | 879 |
| 174 | Ga0265332_10076490 | 3300031238 | Bacteria | 1422 |
| 175 | Ga0265314_10038728 | 3300031711 | Bacteria | 3442 |
| 176 | Ga0265342_10188622 | 3300031712 | Bacteria | 1126 |
| 177 | Ga0307416_100213792 | 3300032002 | Bacteria | 1842 |
| 178 | Ga0373934_0048760 | 3300035086 | Bacteria | 1677 |
| 179 | Ga0373936_0020647 | 3300035113 | Bacteria | 2560 |
| 180 | Ga0373943_0005334 | 3300035170 | Bacteria | 5779 |
| 181 | Ga0373946_0016837 | 3300035171 | Bacteria | 2790 |
| 182 | Ga0373955_0058325 | 3300035172 | Bacteria | 2124 |
| 183 | Ga0373955_0139642 | 3300035172 | Bacteria | 1420 |
| 184 | Ga0373924_0010839 | 3300035410 | Bacteria | 3373 |
| 185 | Ga0373927_0030205 | 3300035695 | Bacteria | 3536 |
| 186 | Ga0373933_0080287 | 3300035724 | Bacteria | 1999 |
| 187 | Ga0373947_0045052 | 3300035725 | Bacteria | 2639 |
| 188 | Ga0373937_0273624 | 3300036401 | Bacteria | 1594 |
| 189 | Ga0373937_0423000 | 3300036401 | Bacteria | 1264 |
| 190 | Ga0373925_0050984 | 3300037068 | Bacteria | 3088 |
| 191 | Ga0495592_0027038 | 3300046454 | Bacteria | 4349 |
| 192 | Ga0495628_0032989 | 3300046516 | Bacteria | 4176 |
| 193 | Ga0495630_0048370 | 3300046517 | Bacteria | 3182 |
| 194 | Ga0495630_0466212 | 3300046517 | Bacteria | 968 |
| 195 | Ga0495665_0127037 | 3300046531 | Bacteria | 1335 |
| 196 | Ga0495640_0090019 | 3300046533 | Bacteria | 2026 |
| 197 | Ga0495640_0129003 | 3300046533 | Bacteria | 1638 |
| 198 | Ga0495645_0273298 | 3300046543 | Bacteria | 1114 |
| 199 | Ga0495634_0264664 | 3300046642 | Bacteria | 1048 |
| 200 | Ga0495634_0303674 | 3300046642 | Unclassified | 964 |
| 201 | Ga0495635_0356740 | 3300046663 | Bacteria | 975 |
| 202 | Ga0495599_0249793 | 3300046678 | Unclassified | 1080 |
| 203 | Ga0495658_0102744 | 3300046683 | Bacteria | 1708 |
| 204 | Ga0495658_0215678 | 3300046683 | Unclassified | 1200 |
| 205 | Ga0495613_0000927 | 3300046689 | Bacteria | 22499 |
| 206 | Ga0495600_0076081 | 3300046809 | Bacteria | 2192 |
| 207 | Ga0495581_0124380 | 3300047315 | Bacteria | 1502 |
| 208 | Ga0495604_0057732 | 3300047317 | Bacteria | 2983 |
| 209 | Ga0495674_0005735 | 3300047319 | Bacteria | 11901 |
| 210 | Ga0495674_0295378 | 3300047319 | Bacteria | 1324 |
| 211 | Ga0495680_0119602 | 3300047322 | Bacteria | 1946 |
| 212 | Ga0495684_0000048 | 3300047471 | Bacteria | 89243 |
| 213 | Ga0496101_0000685 | 3300048904 | Bacteria | 20428 |
| 214 | Ga0496102_0696839 | 3300048905 | Bacteria | 939 |
| 215 | Ga0496104_0214743 | 3300048907 | Bacteria | 1835 |
| 216 | Ga0496104_0447242 | 3300048907 | Bacteria | 1204 |
| 217 | Ga0496105_0042435 | 3300048908 | Bacteria | 3750 |
| 218 | Ga0496105_0286194 | 3300048908 | Bacteria | 1328 |
| 219 | Ga0496107_0236747 | 3300048910 | Bacteria | 1359 |
| 220 | Ga0496108_0029582 | 3300048911 | Bacteria | 4538 |
| 221 | Ga0496109_0562135 | 3300048912 | Bacteria | 1076 |
| 222 | Ga0496110_0068299 | 3300048913 | Bacteria | 3146 |
| 223 | Ga0496111_0212936 | 3300048914 | Bacteria | 1435 |
| 224 | Ga0496114_0070631 | 3300048917 | Bacteria | 2933 |
| 225 | Ga0496114_0110426 | 3300048917 | Unclassified | 2355 |
| 226 | Ga0496114_0242798 | 3300048917 | Unclassified | 1584 |
| 227 | Ga0501036_0035823 | 3300049572 | Bacteria | 4200 |
| 228 | Ga0501036_0051854 | 3300049572 | Bacteria | 3474 |
| 229 | Ga0501039_0043031 | 3300049575 | Bacteria | 3489 |
| 230 | Ga0501040_0006107 | 3300049576 | Bacteria | 7814 |
| 231 | Ga0501041_0006178 | 3300049577 | Bacteria | 7001 |
| 232 | Ga0501042_0010389 | 3300049578 | Bacteria | 6241 |
| 233 | Ga0501043_0061223 | 3300049579 | Bacteria | 2956 |
| 234 | Ga0501046_0007776 | 3300049580 | Bacteria | 9404 |
| 235 | Ga0501068_0210468 | 3300049584 | Bacteria | 1234 |
| 236 | Ga0501071_0008592 | 3300049587 | Bacteria | 6750 |
| 237 | Ga0501074_0218045 | 3300049590 | Unclassified | 1359 |
| 238 | Ga0501075_0001743 | 3300049591 | Bacteria | 14308 |
| 239 | Ga0501076_0001162 | 3300049592 | Bacteria | 17406 |
| 240 | Ga0501077_0008036 | 3300049593 | Bacteria | 6521 |
| 241 | Ga0501079_0028989 | 3300049741 | Bacteria | 4249 |
| 242 | Ga0501079_0212502 | 3300049741 | Bacteria | 1511 |
| 243 | Ga0501080_0072928 | 3300049742 | Bacteria | 3194 |
| 244 | Ga0501081_0055339 | 3300049743 | Bacteria | 2741 |
| 245 | Ga0501045_0028244 | 3300049824 | Bacteria | 4046 |
| 246 | nmdc:mga05p37_22241_c1 | 3300050507 | Bacteria | 7687 |
| 247 | nmdc:mga05p37_29063_c1 | 3300050507 | Bacteria | 6746 |
| 248 | nmdc:mga05p37_316459_c1 | 3300050507 | Unclassified | 1848 |
| 249 | nmdc:mga05p37_625762_c1 | 3300050507 | Bacteria | 1210 |
| 250 | nmdc:mga06r32_1143810_c1 | 3300050510 | Unclassified | 726 |
| 251 | nmdc:mga08y16_170699_c1 | 3300050511 | Unclassified | 2259 |
| 252 | nmdc:mga08y16_224901_c1 | 3300050511 | Bacteria | 1942 |
| 253 | nmdc:mga0n895_108320_c1 | 3300050512 | Bacteria | 2793 |
| 254 | nmdc:mga0n895_16763_c1 | 3300050512 | Bacteria | 6733 |
| 255 | nmdc:mga0n895_188368_c1 | 3300050512 | Unclassified | 2094 |
| 256 | nmdc:mga0n895_45134_c1 | 3300050512 | Bacteria | 4299 |
| 257 | nmdc:mga0rr50_22625_c1 | 3300050513 | Bacteria | 4318 |
| 258 | nmdc:mga08x19_111660_c1 | 3300050514 | Bacteria | 1824 |
| 259 | nmdc:mga08x19_17643_c1 | 3300050514 | Bacteria | 4371 |
| 260 | nmdc:mga08x19_66034_c1 | 3300050514 | Unclassified | 2350 |
| 261 | nmdc:mga0a205_122842_c1 | 3300050515 | Bacteria | 2496 |
| 262 | nmdc:mga0a205_59591_c1 | 3300050515 | Bacteria | 3687 |
| 263 | Ga0495601_0082246 | 3300053077 | Bacteria | 2067 |
| 264 | Ga0495601_0153745 | 3300053077 | Bacteria | 1502 |
| 265 | Ga0495619_0001582 | 3300053085 | Bacteria | 14969 |
| 266 | Ga0495619_0028066 | 3300053085 | Bacteria | 3629 |
| 267 | Ga0501084_0133752 | 3300054114 | Bacteria | 2087 |
| 268 | Ga0501082_0012981 | 3300060353 | Bacteria | 7161 |
| 269 | Ga0501082_0052057 | 3300060353 | Bacteria | 3529 |
| 270 | Ga0530510_0023942 | 3300061734 | Bacteria | 4355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0236747 | Ga0496107_0236747_17_712 | 216 |
| 2 | 3300048912 | Ga0496109_0562135 | Ga0496109_0562135_26_742 | 223 |
| 3 | 3300050510 | nmdc:mga06r32_1143810_c1 | nmdc:mga06r32_1143810_c1_16_699 | 223 |
| 4 | 3300005539 | Ga0068853_101131660 | Ga0068853_1011316601 | 224 |
| 5 | 3300005518 | Ga0070699_100095635 | Ga0070699_1000956352 | 229 |
| 6 | 3300035172 | Ga0373955_0139642 | Ga0373955_0139642_98_859 | 238 |
| 7 | 3300046517 | Ga0495630_0466212 | Ga0495630_0466212_121_882 | 238 |
| 8 | 3300048904 | Ga0496101_0000685 | Ga0496101_0000685_15792_16553 | 238 |
| 9 | 3300048907 | Ga0496104_0214743 | Ga0496104_0214743_692_1453 | 238 |
| 10 | 3300048908 | Ga0496105_0042435 | Ga0496105_0042435_2177_2938 | 238 |
| 11 | 3300048911 | Ga0496108_0029582 | Ga0496108_0029582_997_1758 | 238 |
| 12 | 3300048917 | Ga0496114_0070631 | Ga0496114_0070631_1340_2101 | 238 |
| 13 | 3300050507 | nmdc:mga05p37_29063_c1 | nmdc:mga05p37_29063_c1_2374_3138 | 238 |
| 14 | 3300046683 | Ga0495658_0215678 | Ga0495658_0215678_71_802 | 239 |
| 15 | 3300032002 | Ga0307416_100213792 | Ga0307416_1002137923 | 241 |
| 16 | 3300005353 | Ga0070669_100032868 | Ga0070669_1000328686 | 242 |
| 17 | 3300005843 | Ga0068860_100033594 | Ga0068860_1000335943 | 242 |
| 18 | 3300028381 | Ga0268264_10000914 | Ga0268264_1000091430 | 242 |
| 19 | 3300005337 | Ga0070682_100188575 | Ga0070682_1001885753 | 243 |
| 20 | 3300005842 | Ga0068858_100172126 | Ga0068858_1001721262 | 243 |
| 21 | 3300025918 | Ga0207662_10298999 | Ga0207662_102989991 | 243 |
| 22 | 3300035172 | Ga0373955_0058325 | Ga0373955_0058325_995_1726 | 243 |
| 23 | 3300048908 | Ga0496105_0286194 | Ga0496105_0286194_190_921 | 243 |
| 24 | 3300048913 | Ga0496110_0068299 | Ga0496110_0068299_1955_2686 | 243 |
| 25 | 3300048914 | Ga0496111_0212936 | Ga0496111_0212936_216_947 | 243 |
| 26 | 3300050514 | nmdc:mga08x19_111660_c1 | nmdc:mga08x19_111660_c1_631_1413 | 243 |
| 27 | 3300053085 | Ga0495619_0028066 | Ga0495619_0028066_914_1645 | 243 |
| 28 | 3300002459 | JGI24751J29686_10005770 | JGI24751J29686_100057703 | 244 |
| 29 | 3300004803 | Ga0058862_10011738 | Ga0058862_100117384 | 244 |
| 30 | 3300004803 | Ga0058862_12645855 | Ga0058862_126458552 | 244 |
| 31 | 3300005290 | Ga0065712_10103209 | Ga0065712_101032091 | 244 |
| 32 | 3300005295 | Ga0065707_10085132 | Ga0065707_100851327 | 244 |
| 33 | 3300005330 | Ga0070690_100042976 | Ga0070690_1000429763 | 244 |
| 34 | 3300005331 | Ga0070670_100108148 | Ga0070670_1001081484 | 244 |
| 35 | 3300005334 | Ga0068869_100377106 | Ga0068869_1003771061 | 244 |
| 36 | 3300005336 | Ga0070680_100068878 | Ga0070680_1000688782 | 244 |
| 37 | 3300005337 | Ga0070682_100022409 | Ga0070682_1000224094 | 244 |
| 38 | 3300005338 | Ga0068868_100032766 | Ga0068868_1000327666 | 244 |
| 39 | 3300005339 | Ga0070660_100043306 | Ga0070660_1000433066 | 244 |
| 40 | 3300005340 | Ga0070689_100012538 | Ga0070689_1000125387 | 244 |
| 41 | 3300005340 | Ga0070689_100115523 | Ga0070689_1001155232 | 244 |
| 42 | 3300005347 | Ga0070668_100017730 | Ga0070668_1000177304 | 244 |
| 43 | 3300005353 | Ga0070669_100029234 | Ga0070669_1000292344 | 244 |
| 44 | 3300005354 | Ga0070675_100001537 | Ga0070675_10000153713 | 244 |
| 45 | 3300005364 | Ga0070673_100071637 | Ga0070673_1000716372 | 244 |
| 46 | 3300005365 | Ga0070688_100125104 | Ga0070688_1001251041 | 244 |
| 47 | 3300005434 | Ga0070709_10111748 | Ga0070709_101117484 | 244 |
| 48 | 3300005441 | Ga0070700_100123643 | Ga0070700_1001236432 | 244 |
| 49 | 3300005458 | Ga0070681_10096194 | Ga0070681_100961944 | 244 |
| 50 | 3300005466 | Ga0070685_10194166 | Ga0070685_101941662 | 244 |
| 51 | 3300005466 | Ga0070685_10287006 | Ga0070685_102870062 | 244 |
| 52 | 3300005518 | Ga0070699_100031590 | Ga0070699_1000315902 | 244 |
| 53 | 3300005530 | Ga0070679_100017287 | Ga0070679_1000172877 | 244 |
| 54 | 3300005530 | Ga0070679_100037637 | Ga0070679_1000376374 | 244 |
| 55 | 3300005535 | Ga0070684_100107642 | Ga0070684_1001076422 | 244 |
| 56 | 3300005536 | Ga0070697_100387535 | Ga0070697_1003875351 | 244 |
| 57 | 3300005543 | Ga0070672_100620427 | Ga0070672_1006204272 | 244 |
| 58 | 3300005544 | Ga0070686_100025887 | Ga0070686_1000258875 | 244 |
| 59 | 3300005546 | Ga0070696_100127485 | Ga0070696_1001274851 | 244 |
| 60 | 3300005548 | Ga0070665_100015165 | Ga0070665_10001516510 | 244 |
| 61 | 3300005549 | Ga0070704_100234664 | Ga0070704_1002346642 | 244 |
| 62 | 3300005563 | Ga0068855_100023932 | Ga0068855_1000239323 | 244 |
| 63 | 3300005577 | Ga0068857_100161381 | Ga0068857_1001613814 | 244 |
| 64 | 3300005578 | Ga0068854_100112789 | Ga0068854_1001127895 | 244 |
| 65 | 3300005617 | Ga0068859_100116866 | Ga0068859_1001168662 | 244 |
| 66 | 3300005617 | Ga0068859_100195942 | Ga0068859_1001959421 | 244 |
| 67 | 3300005617 | Ga0068859_100348747 | Ga0068859_1003487472 | 244 |
| 68 | 3300005718 | Ga0068866_10148952 | Ga0068866_101489522 | 244 |
| 69 | 3300005719 | Ga0068861_100019838 | Ga0068861_1000198383 | 244 |
| 70 | 3300005719 | Ga0068861_100158990 | Ga0068861_1001589902 | 244 |
| 71 | 3300005834 | Ga0068851_10118823 | Ga0068851_101188231 | 244 |
| 72 | 3300005842 | Ga0068858_100033441 | Ga0068858_1000334414 | 244 |
| 73 | 3300005842 | Ga0068858_100087997 | Ga0068858_1000879973 | 244 |
| 74 | 3300005842 | Ga0068858_100182129 | Ga0068858_1001821294 | 244 |
| 75 | 3300005842 | Ga0068858_100256176 | Ga0068858_1002561763 | 244 |
| 76 | 3300005842 | Ga0068858_100292522 | Ga0068858_1002925221 | 244 |
| 77 | 3300005844 | Ga0068862_100118204 | Ga0068862_1001182045 | 244 |
| 78 | 3300005844 | Ga0068862_100131594 | Ga0068862_1001315942 | 244 |
| 79 | 3300005844 | Ga0068862_100238362 | Ga0068862_1002383622 | 244 |
| 80 | 3300005937 | Ga0081455_10377844 | Ga0081455_103778442 | 244 |
| 81 | 3300005983 | Ga0081540_1064403 | Ga0081540_10644031 | 244 |
| 82 | 3300006028 | Ga0070717_10223110 | Ga0070717_102231104 | 244 |
| 83 | 3300006028 | Ga0070717_10290366 | Ga0070717_102903662 | 244 |
| 84 | 3300006163 | Ga0070715_10114160 | Ga0070715_101141601 | 244 |
| 85 | 3300006163 | Ga0070715_10235052 | Ga0070715_102350521 | 244 |
| 86 | 3300006173 | Ga0070716_100160600 | Ga0070716_1001606001 | 244 |
| 87 | 3300006173 | Ga0070716_100239708 | Ga0070716_1002397082 | 244 |
| 88 | 3300006237 | Ga0097621_100009469 | Ga0097621_1000094695 | 244 |
| 89 | 3300006237 | Ga0097621_100050539 | Ga0097621_1000505393 | 244 |
| 90 | 3300006237 | Ga0097621_100286538 | Ga0097621_1002865384 | 244 |
| 91 | 3300006358 | Ga0068871_100012578 | Ga0068871_1000125785 | 244 |
| 92 | 3300006358 | Ga0068871_100171531 | Ga0068871_1001715313 | 244 |
| 93 | 3300006358 | Ga0068871_100396225 | Ga0068871_1003962252 | 244 |
| 94 | 3300006852 | Ga0075433_10067266 | Ga0075433_100672666 | 244 |
| 95 | 3300006852 | Ga0075433_10128269 | Ga0075433_101282692 | 244 |
| 96 | 3300006871 | Ga0075434_100021223 | Ga0075434_1000212231 | 244 |
| 97 | 3300006871 | Ga0075434_100060975 | Ga0075434_1000609751 | 244 |
| 98 | 3300006871 | Ga0075434_100730850 | Ga0075434_1007308501 | 244 |
| 99 | 3300006914 | Ga0075436_100010393 | Ga0075436_1000103939 | 244 |
| 100 | 3300006931 | Ga0097620_100116871 | Ga0097620_1001168712 | 244 |
| 101 | 3300006931 | Ga0097620_100195915 | Ga0097620_1001959151 | 244 |
| 102 | 3300006931 | Ga0097620_100348736 | Ga0097620_1003487362 | 244 |
| 103 | 3300007076 | Ga0075435_100004448 | Ga0075435_10000444810 | 244 |
| 104 | 3300007076 | Ga0075435_100052494 | Ga0075435_1000524946 | 244 |
| 105 | 3300007076 | Ga0075435_100053991 | Ga0075435_1000539916 | 244 |
| 106 | 3300009094 | Ga0111539_10211189 | Ga0111539_102111893 | 244 |
| 107 | 3300009094 | Ga0111539_10279755 | Ga0111539_102797555 | 244 |
| 108 | 3300009098 | Ga0105245_10059584 | Ga0105245_100595842 | 244 |
| 109 | 3300009098 | Ga0105245_10643245 | Ga0105245_106432451 | 244 |
| 110 | 3300009101 | Ga0105247_10017382 | Ga0105247_100173822 | 244 |
| 111 | 3300009147 | Ga0114129_10111924 | Ga0114129_101119242 | 244 |
| 112 | 3300009147 | Ga0114129_10113164 | Ga0114129_101131646 | 244 |
| 113 | 3300009147 | Ga0114129_10140444 | Ga0114129_101404444 | 244 |
| 114 | 3300009148 | Ga0105243_10465030 | Ga0105243_104650302 | 244 |
| 115 | 3300009176 | Ga0105242_10033222 | Ga0105242_100332225 | 244 |
| 116 | 3300009176 | Ga0105242_10350803 | Ga0105242_103508033 | 244 |
| 117 | 3300009176 | Ga0105242_10586345 | Ga0105242_105863451 | 244 |
| 118 | 3300009177 | Ga0105248_10024770 | Ga0105248_100247705 | 244 |
| 119 | 3300009177 | Ga0105248_10030747 | Ga0105248_100307478 | 244 |
| 120 | 3300009177 | Ga0105248_10089169 | Ga0105248_100891692 | 244 |
| 121 | 3300009177 | Ga0105248_10294126 | Ga0105248_102941264 | 244 |
| 122 | 3300009177 | Ga0105248_10398291 | Ga0105248_103982911 | 244 |
| 123 | 3300009551 | Ga0105238_10673454 | Ga0105238_106734542 | 244 |
| 124 | 3300009553 | Ga0105249_10016229 | Ga0105249_100162296 | 244 |
| 125 | 3300009553 | Ga0105249_10152751 | Ga0105249_101527515 | 244 |
| 126 | 3300013296 | Ga0157374_10118383 | Ga0157374_101183834 | 244 |
| 127 | 3300013296 | Ga0157374_10138351 | Ga0157374_101383515 | 244 |
| 128 | 3300013297 | Ga0157378_10608506 | Ga0157378_106085062 | 244 |
| 129 | 3300013306 | Ga0163162_10293786 | Ga0163162_102937862 | 244 |
| 130 | 3300013308 | Ga0157375_10118016 | Ga0157375_101180164 | 244 |
| 131 | 3300013308 | Ga0157375_10255970 | Ga0157375_102559701 | 244 |
| 132 | 3300014325 | Ga0163163_10816813 | Ga0163163_108168131 | 244 |
| 133 | 3300014326 | Ga0157380_10034301 | Ga0157380_100343016 | 244 |
| 134 | 3300014326 | Ga0157380_10556061 | Ga0157380_105560613 | 244 |
| 135 | 3300014745 | Ga0157377_10041426 | Ga0157377_100414265 | 244 |
| 136 | 3300014968 | Ga0157379_10046157 | Ga0157379_100461576 | 244 |
| 137 | 3300014969 | Ga0157376_10033860 | Ga0157376_100338603 | 244 |
| 138 | 3300014969 | Ga0157376_10104160 | Ga0157376_101041606 | 244 |
| 139 | 3300017792 | Ga0163161_10536564 | Ga0163161_105365641 | 244 |
| 140 | 3300025321 | Ga0207656_10072012 | Ga0207656_100720122 | 244 |
| 141 | 3300025899 | Ga0207642_10164544 | Ga0207642_101645443 | 244 |
| 142 | 3300025899 | Ga0207642_10333683 | Ga0207642_103336832 | 244 |
| 143 | 3300025903 | Ga0207680_10126221 | Ga0207680_101262212 | 244 |
| 144 | 3300025903 | Ga0207680_10271543 | Ga0207680_102715432 | 244 |
| 145 | 3300025905 | Ga0207685_10052116 | Ga0207685_100521162 | 244 |
| 146 | 3300025906 | Ga0207699_10056009 | Ga0207699_100560093 | 244 |
| 147 | 3300025907 | Ga0207645_10195145 | Ga0207645_101951452 | 244 |
| 148 | 3300025911 | Ga0207654_10479425 | Ga0207654_104794251 | 244 |
| 149 | 3300025912 | Ga0207707_10140018 | Ga0207707_101400184 | 244 |
| 150 | 3300025919 | Ga0207657_10043378 | Ga0207657_100433782 | 244 |
| 151 | 3300025921 | Ga0207652_10166557 | Ga0207652_101665572 | 244 |
| 152 | 3300025923 | Ga0207681_10094518 | Ga0207681_100945183 | 244 |
| 153 | 3300025924 | Ga0207694_10366760 | Ga0207694_103667601 | 244 |
| 154 | 3300025926 | Ga0207659_10001294 | Ga0207659_1000129410 | 244 |
| 155 | 3300025928 | Ga0207700_10287925 | Ga0207700_102879254 | 244 |
| 156 | 3300025931 | Ga0207644_10391109 | Ga0207644_103911091 | 244 |
| 157 | 3300025933 | Ga0207706_10017122 | Ga0207706_100171228 | 244 |
| 158 | 3300025933 | Ga0207706_10171863 | Ga0207706_101718634 | 244 |
| 159 | 3300025935 | Ga0207709_10488825 | Ga0207709_104888251 | 244 |
| 160 | 3300025936 | Ga0207670_10021814 | Ga0207670_100218144 | 244 |
| 161 | 3300025937 | Ga0207669_10008545 | Ga0207669_100085457 | 244 |
| 162 | 3300025939 | Ga0207665_10031837 | Ga0207665_100318372 | 244 |
| 163 | 3300025940 | Ga0207691_10298670 | Ga0207691_102986702 | 244 |
| 164 | 3300025941 | Ga0207711_10179790 | Ga0207711_101797903 | 244 |
| 165 | 3300025941 | Ga0207711_10185737 | Ga0207711_101857372 | 244 |
| 166 | 3300025941 | Ga0207711_10259594 | Ga0207711_102595944 | 244 |
| 167 | 3300025941 | Ga0207711_10330031 | Ga0207711_103300312 | 244 |
| 168 | 3300025941 | Ga0207711_10420763 | Ga0207711_104207631 | 244 |
| 169 | 3300025949 | Ga0207667_10131233 | Ga0207667_101312332 | 244 |
| 170 | 3300025961 | Ga0207712_10513540 | Ga0207712_105135401 | 244 |
| 171 | 3300025981 | Ga0207640_10082191 | Ga0207640_100821915 | 244 |
| 172 | 3300026023 | Ga0207677_10413136 | Ga0207677_104131361 | 244 |
| 173 | 3300026035 | Ga0207703_10002242 | Ga0207703_100022429 | 244 |
| 174 | 3300026035 | Ga0207703_10065818 | Ga0207703_100658182 | 244 |
| 175 | 3300026035 | Ga0207703_10194583 | Ga0207703_101945833 | 244 |
| 176 | 3300026035 | Ga0207703_10275782 | Ga0207703_102757821 | 244 |
| 177 | 3300026088 | Ga0207641_10179295 | Ga0207641_101792953 | 244 |
| 178 | 3300026089 | Ga0207648_10018889 | Ga0207648_100188896 | 244 |
| 179 | 3300026095 | Ga0207676_10036797 | Ga0207676_100367975 | 244 |
| 180 | 3300026095 | Ga0207676_10623132 | Ga0207676_106231321 | 244 |
| 181 | 3300026118 | Ga0207675_100015362 | Ga0207675_1000153624 | 244 |
| 182 | 3300026118 | Ga0207675_100070825 | Ga0207675_1000708256 | 244 |
| 183 | 3300026118 | Ga0207675_100150562 | Ga0207675_1001505625 | 244 |
| 184 | 3300026118 | Ga0207675_100267634 | Ga0207675_1002676341 | 244 |
| 185 | 3300026121 | Ga0207683_10130767 | Ga0207683_101307673 | 244 |
| 186 | 3300027907 | Ga0207428_10403623 | Ga0207428_104036232 | 244 |
| 187 | 3300028379 | Ga0268266_10057208 | Ga0268266_100572082 | 244 |
| 188 | 3300028380 | Ga0268265_10096270 | Ga0268265_100962701 | 244 |
| 189 | 3300028380 | Ga0268265_10107418 | Ga0268265_101074185 | 244 |
| 190 | 3300028380 | Ga0268265_10325890 | Ga0268265_103258902 | 244 |
| 191 | 3300028381 | Ga0268264_10560439 | Ga0268264_105604392 | 244 |
| 192 | 3300028381 | Ga0268264_10919633 | Ga0268264_109196331 | 244 |
| 193 | 3300031238 | Ga0265332_10076490 | Ga0265332_100764902 | 244 |
| 194 | 3300031711 | Ga0265314_10038728 | Ga0265314_100387282 | 244 |
| 195 | 3300031712 | Ga0265342_10188622 | Ga0265342_101886222 | 244 |
| 196 | 3300035086 | Ga0373934_0048760 | Ga0373934_0048760_453_1232 | 244 |
| 197 | 3300035113 | Ga0373936_0020647 | Ga0373936_0020647_159_905 | 244 |
| 198 | 3300035170 | Ga0373943_0005334 | Ga0373943_0005334_4434_5180 | 244 |
| 199 | 3300035171 | Ga0373946_0016837 | Ga0373946_0016837_155_901 | 244 |
| 200 | 3300035410 | Ga0373924_0010839 | Ga0373924_0010839_889_1635 | 244 |
| 201 | 3300035695 | Ga0373927_0030205 | Ga0373927_0030205_2039_2785 | 244 |
| 202 | 3300035724 | Ga0373933_0080287 | Ga0373933_0080287_32_814 | 244 |
| 203 | 3300035725 | Ga0373947_0045052 | Ga0373947_0045052_144_890 | 244 |
| 204 | 3300036401 | Ga0373937_0273624 | Ga0373937_0273624_13_792 | 244 |
| 205 | 3300036401 | Ga0373937_0423000 | Ga0373937_0423000_186_965 | 244 |
| 206 | 3300037068 | Ga0373925_0050984 | Ga0373925_0050984_1739_2485 | 244 |
| 207 | 3300046454 | Ga0495592_0027038 | Ga0495592_0027038_975_1754 | 244 |
| 208 | 3300046516 | Ga0495628_0032989 | Ga0495628_0032989_2184_2963 | 244 |
| 209 | 3300046517 | Ga0495630_0048370 | Ga0495630_0048370_577_1356 | 244 |
| 210 | 3300046531 | Ga0495665_0127037 | Ga0495665_0127037_289_1068 | 244 |
| 211 | 3300046533 | Ga0495640_0090019 | Ga0495640_0090019_495_1274 | 244 |
| 212 | 3300046533 | Ga0495640_0129003 | Ga0495640_0129003_276_1022 | 244 |
| 213 | 3300046543 | Ga0495645_0273298 | Ga0495645_0273298_277_1056 | 244 |
| 214 | 3300046642 | Ga0495634_0264664 | Ga0495634_0264664_68_847 | 244 |
| 215 | 3300046642 | Ga0495634_0303674 | Ga0495634_0303674_123_905 | 244 |
| 216 | 3300046663 | Ga0495635_0356740 | Ga0495635_0356740_94_873 | 244 |
| 217 | 3300046678 | Ga0495599_0249793 | Ga0495599_0249793_321_1067 | 244 |
| 218 | 3300046683 | Ga0495658_0102744 | Ga0495658_0102744_781_1560 | 244 |
| 219 | 3300046689 | Ga0495613_0000927 | Ga0495613_0000927_7539_8318 | 244 |
| 220 | 3300046809 | Ga0495600_0076081 | Ga0495600_0076081_14_793 | 244 |
| 221 | 3300047315 | Ga0495581_0124380 | Ga0495581_0124380_47_784 | 244 |
| 222 | 3300047317 | Ga0495604_0057732 | Ga0495604_0057732_1991_2770 | 244 |
| 223 | 3300047319 | Ga0495674_0005735 | Ga0495674_0005735_8179_8958 | 244 |
| 224 | 3300047319 | Ga0495674_0295378 | Ga0495674_0295378_504_1283 | 244 |
| 225 | 3300047322 | Ga0495680_0119602 | Ga0495680_0119602_452_1231 | 244 |
| 226 | 3300047471 | Ga0495684_0000048 | Ga0495684_0000048_42989_43768 | 244 |
| 227 | 3300048905 | Ga0496102_0696839 | Ga0496102_0696839_97_852 | 244 |
| 228 | 3300048907 | Ga0496104_0447242 | Ga0496104_0447242_250_1029 | 244 |
| 229 | 3300048917 | Ga0496114_0110426 | Ga0496114_0110426_451_1233 | 244 |
| 230 | 3300048917 | Ga0496114_0242798 | Ga0496114_0242798_459_1241 | 244 |
| 231 | 3300049572 | Ga0501036_0035823 | Ga0501036_0035823_1386_2150 | 244 |
| 232 | 3300049572 | Ga0501036_0051854 | Ga0501036_0051854_1325_2074 | 244 |
| 233 | 3300049575 | Ga0501039_0043031 | Ga0501039_0043031_1574_2323 | 244 |
| 234 | 3300049576 | Ga0501040_0006107 | Ga0501040_0006107_6165_6914 | 244 |
| 235 | 3300049577 | Ga0501041_0006178 | Ga0501041_0006178_5358_6107 | 244 |
| 236 | 3300049578 | Ga0501042_0010389 | Ga0501042_0010389_4120_4869 | 244 |
| 237 | 3300049579 | Ga0501043_0061223 | Ga0501043_0061223_1933_2682 | 244 |
| 238 | 3300049580 | Ga0501046_0007776 | Ga0501046_0007776_1695_2444 | 244 |
| 239 | 3300049584 | Ga0501068_0210468 | Ga0501068_0210468_404_1153 | 244 |
| 240 | 3300049587 | Ga0501071_0008592 | Ga0501071_0008592_5774_6523 | 244 |
| 241 | 3300049590 | Ga0501074_0218045 | Ga0501074_0218045_38_787 | 244 |
| 242 | 3300049591 | Ga0501075_0001743 | Ga0501075_0001743_5096_5845 | 244 |
| 243 | 3300049592 | Ga0501076_0001162 | Ga0501076_0001162_1789_2538 | 244 |
| 244 | 3300049593 | Ga0501077_0008036 | Ga0501077_0008036_4875_5624 | 244 |
| 245 | 3300049741 | Ga0501079_0028989 | Ga0501079_0028989_3164_3913 | 244 |
| 246 | 3300049741 | Ga0501079_0212502 | Ga0501079_0212502_510_1274 | 244 |
| 247 | 3300049742 | Ga0501080_0072928 | Ga0501080_0072928_1440_2189 | 244 |
| 248 | 3300049743 | Ga0501081_0055339 | Ga0501081_0055339_424_1173 | 244 |
| 249 | 3300049824 | Ga0501045_0028244 | Ga0501045_0028244_1340_2089 | 244 |
| 250 | 3300050507 | nmdc:mga05p37_22241_c1 | nmdc:mga05p37_22241_c1_5120_5908 | 244 |
| 251 | 3300050507 | nmdc:mga05p37_316459_c1 | nmdc:mga05p37_316459_c1_284_1036 | 244 |
| 252 | 3300050507 | nmdc:mga05p37_625762_c1 | nmdc:mga05p37_625762_c1_399_1187 | 244 |
| 253 | 3300050511 | nmdc:mga08y16_170699_c1 | nmdc:mga08y16_170699_c1_1496_2242 | 244 |
| 254 | 3300050511 | nmdc:mga08y16_224901_c1 | nmdc:mga08y16_224901_c1_68_853 | 244 |
| 255 | 3300050512 | nmdc:mga0n895_108320_c1 | nmdc:mga0n895_108320_c1_1997_2749 | 244 |
| 256 | 3300050512 | nmdc:mga0n895_16763_c1 | nmdc:mga0n895_16763_c1_2709_3473 | 244 |
| 257 | 3300050512 | nmdc:mga0n895_188368_c1 | nmdc:mga0n895_188368_c1_572_1360 | 244 |
| 258 | 3300050512 | nmdc:mga0n895_45134_c1 | nmdc:mga0n895_45134_c1_3217_3954 | 244 |
| 259 | 3300050513 | nmdc:mga0rr50_22625_c1 | nmdc:mga0rr50_22625_c1_2103_2855 | 244 |
| 260 | 3300050514 | nmdc:mga08x19_17643_c1 | nmdc:mga08x19_17643_c1_614_1378 | 244 |
| 261 | 3300050514 | nmdc:mga08x19_66034_c1 | nmdc:mga08x19_66034_c1_361_1113 | 244 |
| 262 | 3300050515 | nmdc:mga0a205_122842_c1 | nmdc:mga0a205_122842_c1_1415_2203 | 244 |
| 263 | 3300050515 | nmdc:mga0a205_59591_c1 | nmdc:mga0a205_59591_c1_2185_2937 | 244 |
| 264 | 3300053077 | Ga0495601_0082246 | Ga0495601_0082246_15_761 | 244 |
| 265 | 3300053077 | Ga0495601_0153745 | Ga0495601_0153745_194_973 | 244 |
| 266 | 3300053085 | Ga0495619_0001582 | Ga0495619_0001582_7561_8340 | 244 |
| 267 | 3300054114 | Ga0501084_0133752 | Ga0501084_0133752_26_775 | 244 |
| 268 | 3300060353 | Ga0501082_0012981 | Ga0501082_0012981_1681_2430 | 244 |
| 269 | 3300060353 | Ga0501082_0052057 | Ga0501082_0052057_1455_2219 | 244 |
| 270 | 3300061734 | Ga0530510_0023942 | Ga0530510_0023942_1943_2707 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cua-assembly2.cif.gz_B | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9347 | 155 | 229 |
| 2cua-assembly1.cif.gz_A | the cua domain of cytochrome ba3 from thermus thermophilus | 0.9308 | 155 | 229 |
| 6pty-assembly2.cif.gz_B | soluble model of human cua (tt3lh) | 0.9296 | 155 | 229 |
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.9287 | 155 | 229 |
| 6ptt-assembly2.cif.gz_B | soluble model of arabidopsis thaliana cua (tt3lat) | 0.9209 | 155 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9324 | 156 | 237 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9301 | 155 | 229 | 2.60.40.420 |
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9185 | 101 | 238 | 2.60.40.420 |
| af_Q2FZJ9_108_266_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9132 | 94 | 240 | 2.60.40.420 |
| af_P0ABJ1_113_282_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8872 | 90 | 240 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7WHT2-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9638 | 71 | 243 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A7Y4TJV2-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9594 | 77 | 243 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A7W1TTH5-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9583 | 82 | 241 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A2V6L428-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9575 | 100 | 243 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A3B9LF19-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9523 | 68 | 243 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar