F376932

General Info

Members Datasets Scaffolds Average Seq Length
270 127 540 199

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10057325|Ga0157373_100573253
Length 222
Sequence VFFLAAISPAQRDLALRVLTGVAYRTDVNARDKGGAIIAVLAVHAVLLVALLNLSGTIDLASPQGALSVIDLSNPGSAPKNIRSEATPVVAPKPRIETPPVQKIVASNTPRQGTAPTQGASDVRGPNGVVEPPHLATPVLSGRDIPRDLLDRWPGRATVFMRLRIDARGYVEECTVDRGTGVPAIDTTLCNIAHAQLRYRPALNRSGQPVAGWAGYAQPAPR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.3
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10057325 3300013100 Bacteria 2763
2 JGI24739J22299_10037287 3300001989 Bacteria 1638
3 Ga0070658_10117267 3300005327 Bacteria 2210
4 Ga0070676_10253745 3300005328 Unclassified 1175
5 Ga0070683_100365854 3300005329 Unclassified 1373
6 Ga0070670_100067380 3300005331 Bacteria 3071
7 Ga0070670_100088480 3300005331 Bacteria 2662
8 Ga0070677_10080408 3300005333 Bacteria 1393
9 Ga0070666_10002660 3300005335 Bacteria 10779
10 Ga0070666_10162376 3300005335 Bacteria 1562
11 Ga0070680_100060806 3300005336 Bacteria 3091
12 Ga0070682_100047016 3300005337 Bacteria 2681
13 Ga0070682_100073292 3300005337 Bacteria 2196
14 Ga0068868_100000514 3300005338 Bacteria 25842
15 Ga0070660_100090313 3300005339 Bacteria 2415
16 Ga0070660_100099616 3300005339 Bacteria 2301
17 Ga0070691_10003078 3300005341 Bacteria 7472
18 Ga0070661_100037027 3300005344 Bacteria 3549
19 Ga0070661_100044205 3300005344 Bacteria 3254
20 Ga0070661_100123060 3300005344 Bacteria 1944
21 Ga0070661_100480118 3300005344 Bacteria 992
22 Ga0070668_100036591 3300005347 Bacteria 3747
23 Ga0070675_100318975 3300005354 Bacteria 1372
24 Ga0070671_100015139 3300005355 Bacteria 6230
25 Ga0070671_100061329 3300005355 Bacteria 3132
26 Ga0070671_100089854 3300005355 Bacteria 2571
27 Ga0070674_100012733 3300005356 Bacteria 5174
28 Ga0070674_100388483 3300005356 Unclassified 1137
29 Ga0070673_100294577 3300005364 Bacteria 1427
30 Ga0070673_100454548 3300005364 Bacteria 1152
31 Ga0070659_100046795 3300005366 Bacteria 3391
32 Ga0070659_100108082 3300005366 Bacteria 2243
33 Ga0070659_100729229 3300005366 Bacteria 858
34 Ga0070667_100003204 3300005367 Bacteria 14026
35 Ga0070667_100018138 3300005367 Bacteria 5836
36 Ga0070663_100012167 3300005455 Bacteria 5431
37 Ga0070663_100065256 3300005455 Bacteria 2634
38 Ga0070663_100325029 3300005455 Bacteria 1238
39 Ga0070678_100008340 3300005456 Bacteria 6205
40 Ga0070678_100048976 3300005456 Bacteria 3047
41 Ga0070662_100002121 3300005457 Bacteria 12156
42 Ga0070662_100045141 3300005457 Bacteria 3160
43 Ga0070662_100102060 3300005457 Bacteria 2172
44 Ga0070662_100159989 3300005457 Unclassified 1761
45 Ga0070662_100198100 3300005457 Bacteria 1592
46 Ga0068867_100097609 3300005459 Bacteria 2239
47 Ga0068867_100176861 3300005459 Bacteria 1694
48 Ga0070685_10075423 3300005466 Bacteria 2009
49 Ga0070679_100246895 3300005530 Bacteria 1742
50 Ga0070684_100096881 3300005535 Bacteria 2630
51 Ga0070684_100446298 3300005535 Unclassified 1195
52 Ga0068853_100013803 3300005539 Bacteria 6602
53 Ga0068853_100599843 3300005539 Bacteria 1046
54 Ga0068853_100726253 3300005539 Bacteria 948
55 Ga0070693_100105544 3300005547 Bacteria 1724
56 Ga0070665_100072849 3300005548 Bacteria 3442
57 Ga0068855_100246770 3300005563 Bacteria 1993
58 Ga0068855_100479125 3300005563 Bacteria 1355
59 Ga0070664_100001924 3300005564 Bacteria 16671
60 Ga0070664_100002497 3300005564 Bacteria 14828
61 Ga0070664_100055951 3300005564 Bacteria 3351
62 Ga0070664_100124176 3300005564 Bacteria 2263
63 Ga0068857_100005219 3300005577 Bacteria 11060
64 Ga0068857_100105900 3300005577 Bacteria 2525
65 Ga0068857_100123904 3300005577 Unclassified 2328
66 Ga0068857_100662751 3300005577 Bacteria 989
67 Ga0068854_100069642 3300005578 Bacteria 2569
68 Ga0068854_100134539 3300005578 Bacteria 1891
69 Ga0068854_100211607 3300005578 Unclassified 1529
70 Ga0068854_100391386 3300005578 Bacteria 1148
71 Ga0070702_100136487 3300005615 Bacteria 1557
72 Ga0068852_100180568 3300005616 Bacteria 1984
73 Ga0068852_100507576 3300005616 Unclassified 1201
74 Ga0068852_100516435 3300005616 Bacteria 1191
75 Ga0068852_100799980 3300005616 Bacteria 957
76 Ga0068859_100038609 3300005617 Bacteria 4790
77 Ga0068859_100068035 3300005617 Bacteria 3597
78 Ga0068864_100004870 3300005618 Bacteria 10991
79 Ga0068864_100451234 3300005618 Unclassified 1230
80 Ga0068851_10038594 3300005834 Bacteria 2396
81 Ga0068851_10061516 3300005834 Bacteria 1925
82 Ga0068851_10064828 3300005834 Unclassified 1878
83 Ga0068863_100002387 3300005841 Bacteria 18669
84 Ga0068858_100003406 3300005842 Bacteria 15815
85 Ga0068858_100016319 3300005842 Bacteria 6977
86 Ga0068858_100094471 3300005842 Unclassified 2785
87 Ga0081539_10029704 3300005985 Bacteria 3408
88 Ga0081539_10085262 3300005985 Bacteria 1648
89 Ga0068871_100106962 3300006358 Bacteria 2349
90 Ga0097620_100038608 3300006931 Bacteria 4790
91 Ga0097620_100068038 3300006931 Bacteria 3597
92 Ga0105240_10018278 3300009093 Bacteria 9423
93 Ga0105240_10201073 3300009093 Bacteria 2335
94 Ga0105245_10206010 3300009098 Bacteria 1891
95 Ga0105248_10004260 3300009177 Bacteria 15834
96 Ga0105248_10034609 3300009177 Bacteria 5650
97 Ga0105248_10609083 3300009177 Unclassified 1232
98 Ga0105237_10010384 3300009545 Bacteria 9911
99 Ga0105238_10014286 3300009551 Bacteria 8025
100 Ga0105239_10341420 3300010375 Bacteria 1690
101 Ga0157373_10007965 3300013100 Bacteria 7878
102 Ga0157373_10074348 3300013100 Bacteria 2397
103 Ga0157373_10178210 3300013100 Bacteria 1496
104 Ga0157371_10037457 3300013102 Bacteria 3470
105 Ga0157369_10255367 3300013105 Bacteria 1829
106 Ga0157369_10487684 3300013105 Bacteria 1275
107 Ga0157374_10735588 3300013296 Bacteria 1001
108 Ga0157378_10211642 3300013297 Unclassified 1838
109 Ga0163162_10004759 3300013306 Bacteria 13099
110 Ga0157372_10144802 3300013307 Bacteria 2740
111 Ga0157372_10185527 3300013307 Bacteria 2409
112 Ga0157375_10169665 3300013308 Bacteria 2329
113 Ga0182008_10027481 3300014497 Bacteria 2882
114 Ga0182008_10099802 3300014497 Bacteria 1434
115 Ga0157379_10047973 3300014968 Bacteria 3812
116 Ga0157379_10140129 3300014968 Bacteria 2180
117 Ga0206356_10019961 3300020070 Bacteria 1105
118 Ga0207697_10002558 3300025315 Bacteria 9361
119 Ga0207642_10316417 3300025899 Bacteria 910
120 Ga0207688_10014376 3300025901 Bacteria 4305
121 Ga0207688_10065184 3300025901 Bacteria 2058
122 Ga0207680_10002682 3300025903 Bacteria 8317
123 Ga0207647_10000435 3300025904 Bacteria 34176
124 Ga0207647_10012170 3300025904 Bacteria 6001
125 Ga0207645_10021555 3300025907 Bacteria 4200
126 Ga0207645_10125034 3300025907 Unclassified 1671
127 Ga0207645_10230153 3300025907 Bacteria 1223
128 Ga0207705_10115906 3300025909 Bacteria 1983
129 Ga0207707_10592147 3300025912 Bacteria 939
130 Ga0207660_10183354 3300025917 Bacteria 1627
131 Ga0207657_10003139 3300025919 Bacteria 17676
132 Ga0207657_10003144 3300025919 Bacteria 17663
133 Ga0207657_10003595 3300025919 Bacteria 16527
134 Ga0207657_10013094 3300025919 Bacteria 8150
135 Ga0207657_10020988 3300025919 Bacteria 6159
136 Ga0207657_10066773 3300025919 Bacteria 3061
137 Ga0207657_10088003 3300025919 Bacteria 2597
138 Ga0207657_10097521 3300025919 Bacteria 2444
139 Ga0207649_10136026 3300025920 Bacteria 1675
140 Ga0207649_10257111 3300025920 Bacteria 1260
141 Ga0207694_10169265 3300025924 Bacteria 1768
142 Ga0207650_10198168 3300025925 Bacteria 1607
143 Ga0207659_10102616 3300025926 Bacteria 2159
144 Ga0207644_10266618 3300025931 Bacteria 1371
145 Ga0207690_10007007 3300025932 Bacteria 6684
146 Ga0207690_10136378 3300025932 Bacteria 1802
147 Ga0207690_10267299 3300025932 Bacteria 1327
148 Ga0207690_10618331 3300025932 Bacteria 885
149 Ga0207706_10006146 3300025933 Bacteria 11151
150 Ga0207706_10019891 3300025933 Bacteria 6035
151 Ga0207706_10054834 3300025933 Bacteria 3517
152 Ga0207706_10213512 3300025933 Unclassified 1691
153 Ga0207706_10471546 3300025933 Bacteria 1085
154 Ga0207669_10077982 3300025937 Bacteria 2109
155 Ga0207704_10056090 3300025938 Bacteria 2412
156 Ga0207711_10000047 3300025941 Bacteria 150849
157 Ga0207711_10017350 3300025941 Bacteria 5981
158 Ga0207711_10024110 3300025941 Bacteria 5093
159 Ga0207711_10883157 3300025941 Bacteria 831
160 Ga0207689_10035351 3300025942 Bacteria 4152
161 Ga0207661_10008596 3300025944 Bacteria 7297
162 Ga0207679_10023132 3300025945 Bacteria 4244
163 Ga0207679_10052499 3300025945 Bacteria 2990
164 Ga0207667_10025694 3300025949 Bacteria 6443
165 Ga0207667_10141917 3300025949 Bacteria 2473
166 Ga0207651_10275504 3300025960 Unclassified 1388
167 Ga0207668_10292569 3300025972 Bacteria 1341
168 Ga0207640_10010525 3300025981 Bacteria 5214
169 Ga0207658_10041105 3300025986 Bacteria 3346
170 Ga0207658_10050732 3300025986 Bacteria 3054
171 Ga0207677_10002516 3300026023 Bacteria 9609
172 Ga0207703_10003999 3300026035 Bacteria 12207
173 Ga0207703_10015512 3300026035 Bacteria 5940
174 Ga0207703_10098627 3300026035 Bacteria 2471
175 Ga0207703_10197905 3300026035 Bacteria 1784
176 Ga0207639_10089768 3300026041 Bacteria 2456
177 Ga0207639_10309400 3300026041 Bacteria 1399
178 Ga0207678_10008116 3300026067 Bacteria 9256
179 Ga0207678_10018335 3300026067 Bacteria 6148
180 Ga0207678_10034728 3300026067 Bacteria 4392
181 Ga0207678_10094620 3300026067 Bacteria 2553
182 Ga0207678_10360937 3300026067 Unclassified 1254
183 Ga0207641_10017136 3300026088 Bacteria 5927
184 Ga0207648_10001590 3300026089 Bacteria 24892
185 Ga0207648_10061054 3300026089 Bacteria 3287
186 Ga0207648_10109469 3300026089 Bacteria 2425
187 Ga0207676_10007853 3300026095 Bacteria 7589
188 Ga0207676_10029486 3300026095 Bacteria 4110
189 Ga0207676_10083263 3300026095 Bacteria 2605
190 Ga0207674_10000060 3300026116 Bacteria 112806
191 Ga0207674_10001045 3300026116 Bacteria 36002
192 Ga0207674_10012221 3300026116 Bacteria 9604
193 Ga0207674_10038555 3300026116 Bacteria 4956
194 Ga0207683_10015108 3300026121 Bacteria 6570
195 Ga0207683_10025155 3300026121 Bacteria 5134
196 Ga0207698_10002123 3300026142 Bacteria 11689
197 Ga0207698_10062028 3300026142 Bacteria 2917
198 Ga0207698_10216263 3300026142 Bacteria 1728
199 Ga0207698_10311488 3300026142 Bacteria 1470
200 Ga0207698_10722077 3300026142 Bacteria 993
201 Ga0207698_10868128 3300026142 Unclassified 908
202 Ga0268266_10197541 3300028379 Bacteria 1839
203 Ga0307413_10107880 3300031824 Bacteria 1857
204 Ga0307409_100071704 3300031995 Bacteria 2755
205 Ga0307411_10149198 3300032005 Bacteria 1735
206 Ga0307411_10485862 3300032005 Bacteria 1041
207 Ga0395899_0035343 3300037312 Bacteria 3751
208 Ga0395899_0048402 3300037312 Bacteria 3164
209 Ga0395899_0115249 3300037312 Bacteria 1929
210 Ga0395899_0190488 3300037312 Bacteria 1435
211 Ga0395900_0028829 3300037418 Bacteria 5690
212 Ga0395900_0049046 3300037418 Bacteria 4349
213 Ga0395900_0108210 3300037418 Bacteria 2856
214 Ga0395900_0156880 3300037418 Bacteria 2324
215 Ga0395900_0242083 3300037418 Bacteria 1809
216 Ga0395900_0248592 3300037418 Bacteria 1781
217 Ga0395900_0265282 3300037418 Unclassified 1713
218 Ga0395900_0288660 3300037418 Unclassified 1630
219 Ga0395900_0429898 3300037418 Bacteria 1280
220 Ga0395898_0003162 3300037466 Bacteria 18570
221 Ga0395898_0145284 3300037466 Bacteria 2270
222 Ga0395905_0001847 3300037471 Bacteria 24433
223 Ga0395905_0002431 3300037471 Bacteria 20644
224 Ga0395905_0033811 3300037471 Bacteria 4802
225 Ga0395905_0040779 3300037471 Bacteria 4355
226 Ga0395905_0041066 3300037471 Bacteria 4340
227 Ga0395905_0058159 3300037471 Bacteria 3616
228 Ga0395905_0081818 3300037471 Bacteria 3026
229 Ga0395905_0111280 3300037471 Bacteria 2571
230 Ga0395905_0117965 3300037471 Bacteria 2494
231 Ga0395905_0166030 3300037471 Unclassified 2074
232 Ga0395905_0197976 3300037471 Bacteria 1884
233 Ga0395901_0092361 3300038443 Bacteria 3168
234 Ga0395901_0107308 3300038443 Bacteria 2931
235 Ga0395901_0117958 3300038443 Bacteria 2788
236 Ga0395901_0272422 3300038443 Bacteria 1760
237 Ga0395901_0371216 3300038443 Bacteria 1474
238 Ga0395901_0394980 3300038443 Unclassified 1421
239 Ga0395901_0427537 3300038443 Unclassified 1357
240 Ga0395901_0758833 3300038443 Bacteria 962
241 Ga0439455_0033279 3300042012 Bacteria 1292
242 Ga0439458_0006329 3300042157 Bacteria 2641
243 Ga0495663_0002605 3300046525 Bacteria 5376
244 Ga0495663_0111646 3300046525 Unclassified 909
245 Ga0495647_0014919 3300046681 Bacteria 2714
246 Ga0495669_0000119 3300046684 Bacteria 50758
247 Ga0495669_0003943 3300046684 Bacteria 6110
248 Ga0495669_0006725 3300046684 Bacteria 4812
249 Ga0495669_0059830 3300046684 Bacteria 1721
250 Ga0495669_0084302 3300046684 Bacteria 1461
251 Ga0495677_0018026 3300047445 Bacteria 2560
252 Ga0496101_0006241 3300048904 Bacteria 7665
253 Ga0496102_0027918 3300048905 Bacteria 5042
254 Ga0496102_0170703 3300048905 Bacteria 2048
255 Ga0496102_0332958 3300048905 Bacteria 1430
256 Ga0496103_0032774 3300048906 Bacteria 3172
257 Ga0496106_0631533 3300048909 Bacteria 857
258 Ga0496107_0022300 3300048910 Bacteria 4475
259 Ga0496107_0047863 3300048910 Unclassified 3079
260 Ga0496108_0009382 3300048911 Bacteria 7922
261 Ga0496108_0070706 3300048911 Bacteria 2945
262 Ga0496109_0005611 3300048912 Bacteria 10499
263 Ga0496110_0073922 3300048913 Bacteria 3025
264 Ga0496111_0000920 3300048914 Bacteria 16055
265 Ga0496112_0057427 3300048915 Bacteria 3831
266 Ga0496112_0174582 3300048915 Bacteria 2114
267 Ga0496112_0258501 3300048915 Bacteria 1691
268 Ga0496113_0005182 3300048916 Bacteria 8105
269 Ga0501067_0066755 3300049583 Bacteria 1991
270 Ga0501068_0169238 3300049584 Bacteria 1379
271 Ga0157373_10057325
272 JGI24739J22299_10037287
273 Ga0070658_10117267
274 Ga0070676_10253745
275 Ga0070683_100365854
276 Ga0070670_100067380
277 Ga0070670_100088480
278 Ga0070677_10080408
279 Ga0070666_10002660
280 Ga0070666_10162376
281 Ga0070680_100060806
282 Ga0070682_100047016
283 Ga0070682_100073292
284 Ga0068868_100000514
285 Ga0070660_100090313
286 Ga0070660_100099616
287 Ga0070691_10003078
288 Ga0070661_100037027
289 Ga0070661_100044205
290 Ga0070661_100123060
291 Ga0070661_100480118
292 Ga0070668_100036591
293 Ga0070675_100318975
294 Ga0070671_100015139
295 Ga0070671_100061329
296 Ga0070671_100089854
297 Ga0070674_100012733
298 Ga0070674_100388483
299 Ga0070673_100294577
300 Ga0070673_100454548
301 Ga0070659_100046795
302 Ga0070659_100108082
303 Ga0070659_100729229
304 Ga0070667_100003204
305 Ga0070667_100018138
306 Ga0070663_100012167
307 Ga0070663_100065256
308 Ga0070663_100325029
309 Ga0070678_100008340
310 Ga0070678_100048976
311 Ga0070662_100002121
312 Ga0070662_100045141
313 Ga0070662_100102060
314 Ga0070662_100159989
315 Ga0070662_100198100
316 Ga0068867_100097609
317 Ga0068867_100176861
318 Ga0070685_10075423
319 Ga0070679_100246895
320 Ga0070684_100096881
321 Ga0070684_100446298
322 Ga0068853_100013803
323 Ga0068853_100599843
324 Ga0068853_100726253
325 Ga0070693_100105544
326 Ga0070665_100072849
327 Ga0068855_100246770
328 Ga0068855_100479125
329 Ga0070664_100001924
330 Ga0070664_100002497
331 Ga0070664_100055951
332 Ga0070664_100124176
333 Ga0068857_100005219
334 Ga0068857_100105900
335 Ga0068857_100123904
336 Ga0068857_100662751
337 Ga0068854_100069642
338 Ga0068854_100134539
339 Ga0068854_100211607
340 Ga0068854_100391386
341 Ga0070702_100136487
342 Ga0068852_100180568
343 Ga0068852_100507576
344 Ga0068852_100516435
345 Ga0068852_100799980
346 Ga0068859_100038609
347 Ga0068859_100068035
348 Ga0068864_100004870
349 Ga0068864_100451234
350 Ga0068851_10038594
351 Ga0068851_10061516
352 Ga0068851_10064828
353 Ga0068863_100002387
354 Ga0068858_100003406
355 Ga0068858_100016319
356 Ga0068858_100094471
357 Ga0081539_10029704
358 Ga0081539_10085262
359 Ga0068871_100106962
360 Ga0097620_100038608
361 Ga0097620_100068038
362 Ga0105240_10018278
363 Ga0105240_10201073
364 Ga0105245_10206010
365 Ga0105248_10004260
366 Ga0105248_10034609
367 Ga0105248_10609083
368 Ga0105237_10010384
369 Ga0105238_10014286
370 Ga0105239_10341420
371 Ga0157373_10007965
372 Ga0157373_10074348
373 Ga0157373_10178210
374 Ga0157371_10037457
375 Ga0157369_10255367
376 Ga0157369_10487684
377 Ga0157374_10735588
378 Ga0157378_10211642
379 Ga0163162_10004759
380 Ga0157372_10144802
381 Ga0157372_10185527
382 Ga0157375_10169665
383 Ga0182008_10027481
384 Ga0182008_10099802
385 Ga0157379_10047973
386 Ga0157379_10140129
387 Ga0206356_10019961
388 Ga0207697_10002558
389 Ga0207642_10316417
390 Ga0207688_10014376
391 Ga0207688_10065184
392 Ga0207680_10002682
393 Ga0207647_10000435
394 Ga0207647_10012170
395 Ga0207645_10021555
396 Ga0207645_10125034
397 Ga0207645_10230153
398 Ga0207705_10115906
399 Ga0207707_10592147
400 Ga0207660_10183354
401 Ga0207657_10003139
402 Ga0207657_10003144
403 Ga0207657_10003595
404 Ga0207657_10013094
405 Ga0207657_10020988
406 Ga0207657_10066773
407 Ga0207657_10088003
408 Ga0207657_10097521
409 Ga0207649_10136026
410 Ga0207649_10257111
411 Ga0207694_10169265
412 Ga0207650_10198168
413 Ga0207659_10102616
414 Ga0207644_10266618
415 Ga0207690_10007007
416 Ga0207690_10136378
417 Ga0207690_10267299
418 Ga0207690_10618331
419 Ga0207706_10006146
420 Ga0207706_10019891
421 Ga0207706_10054834
422 Ga0207706_10213512
423 Ga0207706_10471546
424 Ga0207669_10077982
425 Ga0207704_10056090
426 Ga0207711_10000047
427 Ga0207711_10017350
428 Ga0207711_10024110
429 Ga0207711_10883157
430 Ga0207689_10035351
431 Ga0207661_10008596
432 Ga0207679_10023132
433 Ga0207679_10052499
434 Ga0207667_10025694
435 Ga0207667_10141917
436 Ga0207651_10275504
437 Ga0207668_10292569
438 Ga0207640_10010525
439 Ga0207658_10041105
440 Ga0207658_10050732
441 Ga0207677_10002516
442 Ga0207703_10003999
443 Ga0207703_10015512
444 Ga0207703_10098627
445 Ga0207703_10197905
446 Ga0207639_10089768
447 Ga0207639_10309400
448 Ga0207678_10008116
449 Ga0207678_10018335
450 Ga0207678_10034728
451 Ga0207678_10094620
452 Ga0207678_10360937
453 Ga0207641_10017136
454 Ga0207648_10001590
455 Ga0207648_10061054
456 Ga0207648_10109469
457 Ga0207676_10007853
458 Ga0207676_10029486
459 Ga0207676_10083263
460 Ga0207674_10000060
461 Ga0207674_10001045
462 Ga0207674_10012221
463 Ga0207674_10038555
464 Ga0207683_10015108
465 Ga0207683_10025155
466 Ga0207698_10002123
467 Ga0207698_10062028
468 Ga0207698_10216263
469 Ga0207698_10311488
470 Ga0207698_10722077
471 Ga0207698_10868128
472 Ga0268266_10197541
473 Ga0307413_10107880
474 Ga0307409_100071704
475 Ga0307411_10149198
476 Ga0307411_10485862
477 Ga0395899_0035343
478 Ga0395899_0048402
479 Ga0395899_0115249
480 Ga0395899_0190488
481 Ga0395900_0028829
482 Ga0395900_0049046
483 Ga0395900_0108210
484 Ga0395900_0156880
485 Ga0395900_0242083
486 Ga0395900_0248592
487 Ga0395900_0265282
488 Ga0395900_0288660
489 Ga0395900_0429898
490 Ga0395898_0003162
491 Ga0395898_0145284
492 Ga0395905_0001847
493 Ga0395905_0002431
494 Ga0395905_0033811
495 Ga0395905_0040779
496 Ga0395905_0041066
497 Ga0395905_0058159
498 Ga0395905_0081818
499 Ga0395905_0111280
500 Ga0395905_0117965
501 Ga0395905_0166030
502 Ga0395905_0197976
503 Ga0395901_0092361
504 Ga0395901_0107308
505 Ga0395901_0117958
506 Ga0395901_0272422
507 Ga0395901_0371216
508 Ga0395901_0394980
509 Ga0395901_0427537
510 Ga0395901_0758833
511 Ga0439455_0033279
512 Ga0439458_0006329
513 Ga0495663_0002605
514 Ga0495663_0111646
515 Ga0495647_0014919
516 Ga0495669_0000119
517 Ga0495669_0003943
518 Ga0495669_0006725
519 Ga0495669_0059830
520 Ga0495669_0084302
521 Ga0495677_0018026
522 Ga0496101_0006241
523 Ga0496102_0027918
524 Ga0496102_0170703
525 Ga0496102_0332958
526 Ga0496103_0032774
527 Ga0496106_0631533
528 Ga0496107_0022300
529 Ga0496107_0047863
530 Ga0496108_0009382
531 Ga0496108_0070706
532 Ga0496109_0005611
533 Ga0496110_0073922
534 Ga0496111_0000920
535 Ga0496112_0057427
536 Ga0496112_0174582
537 Ga0496112_0258501
538 Ga0496113_0005182
539 Ga0501067_0066755
540 Ga0501068_0169238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map