F376945

General Info

Members Datasets Scaffolds Average Seq Length
270 186 540 317

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10015875|Ga0157378_100158754
Length 367
Sequence MPFRLHHLHENSDSAPETLAQGRDAAQCCSTPVIARRMSAPNTPPFAGLSPDIIIKAVESLGIVCDGRVLALNSYENRVYRLGREDAAPLVVKFYRPNRWSDAAILEDHAFGAELRAAELSVVAPLDIAGRTLHHSEGFRFSLFPMQGGRAPEPGDKETLIHIGRALGRMHSVGAAGVFRHRPVLSVRAYAEEPVDYLLEAGWLPPELEENFLELGELSIHAIERAFALAGQLQTLRLHGDCHPGNLLWRDDTVHFVDLDDTLTGPAMQDLWMLLSGDRPARAQQLGWLLEGYEIFRPFDRAELHLIEALRAMRLLHYHAWIARRWHDPAFPAAFPWFESPRHWEAVITQLQEQLATMAEPVLDLLR

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
101 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
170 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
173 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
174 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
175 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
176 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
177 2734482264 Dyella sp. AD052 Isolate Unclassified
178 2738543009 Luteibacter sp. OK325 Isolate Unclassified
179 2739367700 Dyella sp. YR388 Isolate Unclassified
180 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
181 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
182 2884411467 Dyella sp. AD56 Isolate Rhizosphere
183 2919085039 Luteibacter sp. 1214 Isolate Unclassified
184 2919404418 Luteibacter sp. 3190 Isolate Unclassified
185 2928963466 Dyella japonica 1073 Isolate Unclassified
186 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 0.74
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.56
Nodule 0
Rhizoplane 3.7
Rhizosphere 65.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10015875 3300013297 Bacteria 6594
2 SwRhRL2b_contig_2001396 2162886007 Bacteria 1638
3 JGI25162J39368_1000147 3300002737 Bacteria 76626
4 JGI25162J39368_1002571 3300002737 Bacteria 6873
5 JGI25154J39366_1006186 3300002738 Bacteria 1788
6 JGI25157J39369_1000093 3300002741 Bacteria 76626
7 JGI25157J39369_1000818 3300002741 Bacteria 15526
8 JGI25163J39215_1000328 3300002771 Bacteria 15770
9 JGI25163J39215_1000500 3300002771 Bacteria 11663
10 JGI25164J39214_1000118 3300002772 Bacteria 76626
11 JGI25165J46597_1000236 3300003214 Bacteria 76626
12 rootH1_10008997 3300003316 Bacteria 3253
13 Ga0055538_1001354 3300003751 Bacteria 4845
14 Ga0055535_1000138 3300003761 Bacteria 76626
15 Ga0055542_1000186 3300003762 Bacteria 76626
16 Ga0055542_1000247 3300003762 Bacteria 62095
17 Ga0055529_1000226 3300003763 Bacteria 71685
18 Ga0055529_1000396 3300003763 Bacteria 46326
19 Ga0070680_100041772 3300005336 Bacteria 3719
20 Ga0070689_100006866 3300005340 Bacteria 7917
21 Ga0070661_100029118 3300005344 Bacteria 3985
22 Ga0070661_100045305 3300005344 Bacteria 3215
23 Ga0070675_100036448 3300005354 Bacteria 4002
24 Ga0070675_100212832 3300005354 Bacteria 1681
25 Ga0070673_100208902 3300005364 Bacteria 1685
26 Ga0070667_100089719 3300005367 Bacteria 2641
27 Ga0070713_100000090 3300005436 Bacteria 57703
28 Ga0070711_100077816 3300005439 Bacteria 2355
29 Ga0070663_100042756 3300005455 Bacteria 3185
30 Ga0070681_10000008 3300005458 Bacteria 151355
31 Ga0070685_10044917 3300005466 Bacteria 2531
32 Ga0068853_100048342 3300005539 Bacteria 3654
33 Ga0068853_100059625 3300005539 Bacteria 3297
34 Ga0070696_100007799 3300005546 Bacteria 7145
35 Ga0070696_100244229 3300005546 Bacteria 1355
36 Ga0068855_100018763 3300005563 Bacteria 8316
37 Ga0068855_100173957 3300005563 Bacteria 2437
38 Ga0068857_100285692 3300005577 Bacteria 1518
39 Ga0068854_100048632 3300005578 Bacteria 3026
40 Ga0068856_100000676 3300005614 Bacteria 36917
41 Ga0068860_100064818 3300005843 Bacteria 3469
42 Ga0068862_100031871 3300005844 Bacteria 4453
43 Ga0075369_10019528 3300006186 Bacteria 2768
44 Ga0099794_10004440 3300007265 Bacteria 5515
45 Ga0099795_10007094 3300007788 Bacteria 3103
46 Ga0105240_10111342 3300009093 Bacteria 3312
47 Ga0105247_10001155 3300009101 Bacteria 19591
48 Ga0105237_10000036 3300009545 Bacteria 191142
49 Ga0105238_10145909 3300009551 Bacteria 2343
50 Ga0099796_10000269 3300010159 Bacteria 8239
51 Ga0105239_10075496 3300010375 Bacteria 3706
52 Ga0157373_10188224 3300013100 Bacteria 1454
53 Ga0157370_10018468 3300013104 Bacteria 7011
54 Ga0157369_10016495 3300013105 Bacteria 8308
55 Ga0163162_10202123 3300013306 Bacteria 2116
56 Ga0157372_10072242 3300013307 Bacteria 3888
57 Ga0182008_10077107 3300014497 Bacteria 1640
58 Ga0182008_10161955 3300014497 Bacteria 1126
59 Ga0157376_10013121 3300014969 Bacteria 6172
60 Ga0182006_1000185 3300015261 Bacteria 64803
61 Ga0182006_1016880 3300015261 Bacteria 3110
62 Ga0182007_10005469 3300015262 Bacteria 5576
63 Ga0182007_10010065 3300015262 Bacteria 3762
64 Ga0182005_1001773 3300015265 Bacteria 8305
65 Ga0182005_1025505 3300015265 Bacteria 1613
66 Ga0163161_10000436 3300017792 Bacteria 34952
67 Ga0163161_10165471 3300017792 Bacteria 1688
68 Ga0206356_10082985 3300020070 Bacteria 2959
69 Ga0206353_11142836 3300020082 Bacteria 4823
70 Ga0209435_106992 3300025206 Bacteria 1251
71 Ga0209760_100571 3300025207 Bacteria 6595
72 Ga0209784_100094 3300025224 Bacteria 113434
73 Ga0209566_102797 3300025225 Bacteria 2992
74 Ga0209674_101763 3300025226 Bacteria 5253
75 Ga0209672_100407 3300025228 Bacteria 25502
76 Ga0209147_104140 3300025229 Bacteria 2508
77 Ga0207427_100100 3300025231 Bacteria 121264
78 Ga0207427_103267 3300025231 Bacteria 3528
79 Ga0209437_100059 3300025233 Bacteria 355048
80 Ga0209437_100382 3300025233 Bacteria 43727
81 Ga0209437_101296 3300025233 Bacteria 6708
82 Ga0209258_100034 3300025242 Bacteria 437372
83 Ga0209258_100738 3300025242 Bacteria 21171
84 Ga0209258_102718 3300025242 Bacteria 4300
85 Ga0209646_1002679 3300025246 Bacteria 3818
86 Ga0209026_1000119 3300025250 Bacteria 130220
87 Ga0209026_1000161 3300025250 Bacteria 102959
88 Ga0209026_1000206 3300025250 Bacteria 81686
89 Ga0209026_1004776 3300025250 Bacteria 3882
90 Ga0209148_1000001 3300025254 Bacteria 2545271
91 Ga0209148_1000055 3300025254 Bacteria 367500
92 Ga0209759_1000467 3300025256 Bacteria 45696
93 Ga0209759_1001926 3300025256 Bacteria 10141
94 Ga0209759_1009613 3300025256 Bacteria 2908
95 Ga0209129_1000455 3300025258 Bacteria 30337
96 Ga0209233_1000002 3300025261 Bacteria 2501366
97 Ga0209233_1020339 3300025261 Bacteria 1743
98 Ga0209233_1023614 3300025261 Bacteria 1555
99 Ga0209455_1000054 3300025272 Bacteria 358936
100 Ga0209455_1000318 3300025272 Bacteria 47836
101 Ga0209758_1023720 3300025297 Bacteria 2763
102 Ga0209256_1011333 3300025299 Bacteria 3579
103 Ga0207710_10008240 3300025900 Bacteria 4400
104 Ga0207647_10000013 3300025904 Bacteria 144052
105 Ga0207707_10000442 3300025912 Bacteria 43048
106 Ga0207695_10000938 3300025913 Bacteria 52009
107 Ga0207671_10004404 3300025914 Bacteria 13490
108 Ga0207663_10037328 3300025916 Bacteria 2928
109 Ga0207681_10056628 3300025923 Bacteria 2675
110 Ga0207659_10428379 3300025926 Bacteria 1111
111 Ga0207700_10000065 3300025928 Bacteria 65305
112 Ga0207700_10006574 3300025928 Bacteria 7039
113 Ga0207706_10172424 3300025933 Bacteria 1901
114 Ga0207670_10008701 3300025936 Bacteria 5746
115 Ga0207667_10008815 3300025949 Bacteria 11943
116 Ga0207667_10215497 3300025949 Bacteria 1968
117 Ga0207658_10158380 3300025986 Bacteria 1853
118 Ga0207639_10002808 3300026041 Bacteria 11683
119 Ga0207639_10023333 3300026041 Bacteria 4467
120 Ga0207702_10000661 3300026078 Bacteria 37532
121 Ga0265356_1002071 3300028017 Bacteria 2750
122 Ga0265327_10000348 3300031251 Bacteria 87817
123 Ga0265316_10010846 3300031344 Bacteria 8274
124 Ga0316576_10018262 3300031727 Bacteria 4784
125 Ga0316578_10020597 3300031728 Bacteria 3647
126 Ga0307516_10000530 3300031730 Bacteria 51072
127 Ga0316580_10035870 3300032139 Bacteria 1535
128 Ga0373955_0111694 3300035172 Bacteria 1581
129 Ga0436361_0378193 3300039447 Bacteria 1911
130 Ga0451789_0781782 3300041443 Bacteria 1088
131 Ga0451793_0776588 3300041452 Bacteria 2152
132 Ga0450908_000006 3300042184 Bacteria 56117
133 Ga0439459_0000749 3300042438 Bacteria 4459
134 Ga0451577_0008296 3300042876 Bacteria 10108
135 Ga0451577_0036489 3300042876 Bacteria 4424
136 Ga0466982_0000015 3300044672 Bacteria 131281
137 Ga0466982_0000027 3300044672 Bacteria 62332
138 Ga0453683_0153344 3300044673 Bacteria 1456
139 Ga0453683_0245356 3300044673 Bacteria 1141
140 Ga0453684_0000615 3300044712 Bacteria 130336
141 Ga0453684_0000833 3300044712 Bacteria 104091
142 Ga0453684_0033909 3300044712 Bacteria 7101
143 Ga0453684_0118165 3300044712 Bacteria 3207
144 Ga0453684_0143854 3300044712 Bacteria 2843
145 Ga0466968_0012250 3300044735 Bacteria 3352
146 Ga0466957_0049386 3300044842 Bacteria 2558
147 Ga0451576_0000201 3300045051 Bacteria 150175
148 Ga0451576_0037205 3300045051 Bacteria 5155
149 Ga0495617_000058 3300046452 Bacteria 100393
150 Ga0495638_0000090 3300046460 Bacteria 148040
151 Ga0495638_0000458 3300046460 Bacteria 48869
152 Ga0495638_0000536 3300046460 Bacteria 43871
153 Ga0495638_0000576 3300046460 Bacteria 41440
154 Ga0495638_0006634 3300046460 Bacteria 8405
155 Ga0495650_0000092 3300046471 Bacteria 224681
156 Ga0495650_0005112 3300046471 Bacteria 8668
157 Ga0495650_0010898 3300046471 Bacteria 5033
158 Ga0495584_0008164 3300046491 Bacteria 5437
159 Ga0495585_0000683 3300046492 Bacteria 30903
160 Ga0495585_0000999 3300046492 Bacteria 23656
161 Ga0495607_0000038 3300046501 Bacteria 134124
162 Ga0495607_0000196 3300046501 Bacteria 63991
163 Ga0495607_0010187 3300046501 Bacteria 6324
164 Ga0495606_0000222 3300046507 Bacteria 100766
165 Ga0495606_0000923 3300046507 Bacteria 43313
166 Ga0495606_0001488 3300046507 Bacteria 31138
167 Ga0495606_0004160 3300046507 Bacteria 14665
168 Ga0495606_0067430 3300046507 Bacteria 2265
169 Ga0495610_0074725 3300046512 Bacteria 1571
170 Ga0495616_0000056 3300046513 Bacteria 101901
171 Ga0495616_0015371 3300046513 Bacteria 4256
172 Ga0495620_0000479 3300046515 Bacteria 25982
173 Ga0495620_0001818 3300046515 Bacteria 12549
174 Ga0495631_0000120 3300046518 Bacteria 52656
175 Ga0495631_0000595 3300046518 Bacteria 23959
176 Ga0495632_0075747 3300046519 Bacteria 1610
177 Ga0495632_0140974 3300046519 Bacteria 1118
178 Ga0495637_0010001 3300046520 Bacteria 4608
179 Ga0495648_0001431 3300046524 Bacteria 23362
180 Ga0495648_0001523 3300046524 Bacteria 22661
181 Ga0495609_0007485 3300046538 Bacteria 5445
182 Ga0495622_0012896 3300046557 Bacteria 3876
183 Ga0495668_0001983 3300046616 Bacteria 17927
184 Ga0495668_0074430 3300046616 Bacteria 1865
185 Ga0495611_0000034 3300046648 Bacteria 103287
186 Ga0495611_0000078 3300046648 Bacteria 68937
187 Ga0495625_0000002 3300046660 Bacteria 813323
188 Ga0495625_0046953 3300046660 Bacteria 3114
189 Ga0495625_0132658 3300046660 Bacteria 1686
190 Ga0495661_0001142 3300046665 Bacteria 23194
191 Ga0495661_0225333 3300046665 Bacteria 969
192 Ga0495670_0003624 3300046691 Bacteria 7588
193 Ga0495670_0008323 3300046691 Bacteria 5098
194 Ga0495671_0001575 3300046692 Bacteria 15099
195 Ga0495649_0109463 3300046694 Bacteria 1465
196 Ga0495589_0000192 3300046794 Bacteria 53416
197 Ga0495660_0000156 3300046810 Bacteria 74271
198 Ga0495660_0000273 3300046810 Bacteria 48544
199 Ga0495683_0001655 3300047323 Bacteria 14236
200 Ga0495679_000003 3300047446 Bacteria 787868
201 Ga0495673_0000004 3300047469 Bacteria 1354526
202 Ga0495673_0000127 3300047469 Bacteria 140402
203 Ga0495673_0001542 3300047469 Bacteria 18120
204 Ga0495686_0000024 3300047472 Bacteria 400343
205 Ga0495686_0000375 3300047472 Bacteria 71924
206 Ga0495686_0104863 3300047472 Bacteria 1701
207 Ga0496100_0003924 3300048903 Bacteria 7816
208 Ga0496101_0000359 3300048904 Bacteria 30569
209 Ga0496104_0011953 3300048907 Bacteria 7788
210 Ga0496105_0005024 3300048908 Bacteria 10014
211 Ga0496106_0000807 3300048909 Bacteria 22662
212 Ga0496114_0002014 3300048917 Bacteria 15457
213 Ga0496115_0001580 3300048918 Bacteria 16359
214 Ga0496115_0077462 3300048918 Bacteria 2703
215 Ga0496116_0175442 3300048919 Bacteria 1155
216 Ga0496117_0007810 3300048920 Bacteria 10306
217 Ga0496118_0000714 3300048921 Bacteria 53628
218 Ga0496118_0003985 3300048921 Bacteria 18002
219 Ga0496118_0223701 3300048921 Bacteria 1093
220 Ga0496121_0000829 3300048924 Bacteria 56313
221 Ga0496121_0001307 3300048924 Bacteria 42738
222 Ga0496121_0001580 3300048924 Bacteria 37914
223 Ga0496121_0098983 3300048924 Bacteria 2255
224 Ga0496122_0005001 3300048925 Bacteria 16035
225 Ga0496123_0005702 3300048926 Bacteria 12415
226 Ga0496123_0031147 3300048926 Bacteria 3885
227 Ga0496123_0100356 3300048926 Bacteria 1686
228 Ga0496125_0002397 3300048928 Bacteria 24412
229 Ga0496125_0003619 3300048928 Bacteria 18554
230 Ga0496126_0085834 3300048929 Bacteria 2774
231 Ga0496126_0186768 3300048929 Bacteria 1757
232 Ga0495678_000026 3300049459 Bacteria 226978
233 Ga0495678_022531 3300049459 Bacteria 2752
234 Ga0495682_0009997 3300049460 Bacteria 3690
235 Ga0495682_0010675 3300049460 Bacteria 3548
236 Ga0501031_0076003 3300049568 Bacteria 2187
237 Ga0501033_0078521 3300049570 Bacteria 2422
238 Ga0501034_0007072 3300049571 Bacteria 11967
239 Ga0501036_0271327 3300049572 Bacteria 1420
240 Ga0501037_0007967 3300049573 Bacteria 7765
241 Ga0501043_0013549 3300049579 Bacteria 6380
242 Ga0501046_0018316 3300049580 Bacteria 5829
243 Ga0501070_0015983 3300049586 Bacteria 6308
244 Ga0501080_0087028 3300049742 Bacteria 2903
245 Ga0501035_0004859 3300049822 Bacteria 12747
246 Ga0501035_0038906 3300049822 Bacteria 4306
247 Ga0501035_0054578 3300049822 Bacteria 3570
248 Ga0501044_0025524 3300049823 Bacteria 6264
249 Ga0501044_0027291 3300049823 Bacteria 6036
250 nmdc:mga0sz30_112410_c1 3300050516 Bacteria 1194
251 Ga0495619_0118961 3300053085 Bacteria 1811
252 Ga0500643_000138 3300053087 Bacteria 73474
253 Ga0500555_000108 3300053103 Bacteria 39384
254 Ga0500633_0080410 3300053160 Bacteria 1178
255 Ga0500645_002528 3300053730 Bacteria 8073
256 2525557035 2524614729 Bacteria 3091755
257 2595449060 2593339238 Bacteria 4182970
258 2595452809 2593339239 Bacteria 4124669
259 2630648631 2627854209 Bacteria 3093011
260 2721025744 2718218334 Bacteria 4765486
261 2735834284 2734482264 Unclassified 5014763
262 2739225703 2738543009 Bacteria 4944499
263 2739733741 2739367700 Bacteria 4747630
264 2846040658 2846037992 Bacteria 4526407
265 2884339071 2884338543 Bacteria 4610696
266 2884411733 2884411467 Bacteria 5246714
267 2919086244 2919085039 Bacteria 4532964
268 2919407842 2919404418 Bacteria 4232372
269 2928966589 2928963466 Bacteria 5165703
270 2941473398 2941471342 Bacteria 5018624
271 Ga0157378_10015875
272 SwRhRL2b_contig_2001396
273 JGI25162J39368_1000147
274 JGI25162J39368_1002571
275 JGI25154J39366_1006186
276 JGI25157J39369_1000093
277 JGI25157J39369_1000818
278 JGI25163J39215_1000328
279 JGI25163J39215_1000500
280 JGI25164J39214_1000118
281 JGI25165J46597_1000236
282 rootH1_10008997
283 Ga0055538_1001354
284 Ga0055535_1000138
285 Ga0055542_1000186
286 Ga0055542_1000247
287 Ga0055529_1000226
288 Ga0055529_1000396
289 Ga0070680_100041772
290 Ga0070689_100006866
291 Ga0070661_100029118
292 Ga0070661_100045305
293 Ga0070675_100036448
294 Ga0070675_100212832
295 Ga0070673_100208902
296 Ga0070667_100089719
297 Ga0070713_100000090
298 Ga0070711_100077816
299 Ga0070663_100042756
300 Ga0070681_10000008
301 Ga0070685_10044917
302 Ga0068853_100048342
303 Ga0068853_100059625
304 Ga0070696_100007799
305 Ga0070696_100244229
306 Ga0068855_100018763
307 Ga0068855_100173957
308 Ga0068857_100285692
309 Ga0068854_100048632
310 Ga0068856_100000676
311 Ga0068860_100064818
312 Ga0068862_100031871
313 Ga0075369_10019528
314 Ga0099794_10004440
315 Ga0099795_10007094
316 Ga0105240_10111342
317 Ga0105247_10001155
318 Ga0105237_10000036
319 Ga0105238_10145909
320 Ga0099796_10000269
321 Ga0105239_10075496
322 Ga0157373_10188224
323 Ga0157370_10018468
324 Ga0157369_10016495
325 Ga0163162_10202123
326 Ga0157372_10072242
327 Ga0182008_10077107
328 Ga0182008_10161955
329 Ga0157376_10013121
330 Ga0182006_1000185
331 Ga0182006_1016880
332 Ga0182007_10005469
333 Ga0182007_10010065
334 Ga0182005_1001773
335 Ga0182005_1025505
336 Ga0163161_10000436
337 Ga0163161_10165471
338 Ga0206356_10082985
339 Ga0206353_11142836
340 Ga0209435_106992
341 Ga0209760_100571
342 Ga0209784_100094
343 Ga0209566_102797
344 Ga0209674_101763
345 Ga0209672_100407
346 Ga0209147_104140
347 Ga0207427_100100
348 Ga0207427_103267
349 Ga0209437_100059
350 Ga0209437_100382
351 Ga0209437_101296
352 Ga0209258_100034
353 Ga0209258_100738
354 Ga0209258_102718
355 Ga0209646_1002679
356 Ga0209026_1000119
357 Ga0209026_1000161
358 Ga0209026_1000206
359 Ga0209026_1004776
360 Ga0209148_1000001
361 Ga0209148_1000055
362 Ga0209759_1000467
363 Ga0209759_1001926
364 Ga0209759_1009613
365 Ga0209129_1000455
366 Ga0209233_1000002
367 Ga0209233_1020339
368 Ga0209233_1023614
369 Ga0209455_1000054
370 Ga0209455_1000318
371 Ga0209758_1023720
372 Ga0209256_1011333
373 Ga0207710_10008240
374 Ga0207647_10000013
375 Ga0207707_10000442
376 Ga0207695_10000938
377 Ga0207671_10004404
378 Ga0207663_10037328
379 Ga0207681_10056628
380 Ga0207659_10428379
381 Ga0207700_10000065
382 Ga0207700_10006574
383 Ga0207706_10172424
384 Ga0207670_10008701
385 Ga0207667_10008815
386 Ga0207667_10215497
387 Ga0207658_10158380
388 Ga0207639_10002808
389 Ga0207639_10023333
390 Ga0207702_10000661
391 Ga0265356_1002071
392 Ga0265327_10000348
393 Ga0265316_10010846
394 Ga0316576_10018262
395 Ga0316578_10020597
396 Ga0307516_10000530
397 Ga0316580_10035870
398 Ga0373955_0111694
399 Ga0436361_0378193
400 Ga0451789_0781782
401 Ga0451793_0776588
402 Ga0450908_000006
403 Ga0439459_0000749
404 Ga0451577_0008296
405 Ga0451577_0036489
406 Ga0466982_0000015
407 Ga0466982_0000027
408 Ga0453683_0153344
409 Ga0453683_0245356
410 Ga0453684_0000615
411 Ga0453684_0000833
412 Ga0453684_0033909
413 Ga0453684_0118165
414 Ga0453684_0143854
415 Ga0466968_0012250
416 Ga0466957_0049386
417 Ga0451576_0000201
418 Ga0451576_0037205
419 Ga0495617_000058
420 Ga0495638_0000090
421 Ga0495638_0000458
422 Ga0495638_0000536
423 Ga0495638_0000576
424 Ga0495638_0006634
425 Ga0495650_0000092
426 Ga0495650_0005112
427 Ga0495650_0010898
428 Ga0495584_0008164
429 Ga0495585_0000683
430 Ga0495585_0000999
431 Ga0495607_0000038
432 Ga0495607_0000196
433 Ga0495607_0010187
434 Ga0495606_0000222
435 Ga0495606_0000923
436 Ga0495606_0001488
437 Ga0495606_0004160
438 Ga0495606_0067430
439 Ga0495610_0074725
440 Ga0495616_0000056
441 Ga0495616_0015371
442 Ga0495620_0000479
443 Ga0495620_0001818
444 Ga0495631_0000120
445 Ga0495631_0000595
446 Ga0495632_0075747
447 Ga0495632_0140974
448 Ga0495637_0010001
449 Ga0495648_0001431
450 Ga0495648_0001523
451 Ga0495609_0007485
452 Ga0495622_0012896
453 Ga0495668_0001983
454 Ga0495668_0074430
455 Ga0495611_0000034
456 Ga0495611_0000078
457 Ga0495625_0000002
458 Ga0495625_0046953
459 Ga0495625_0132658
460 Ga0495661_0001142
461 Ga0495661_0225333
462 Ga0495670_0003624
463 Ga0495670_0008323
464 Ga0495671_0001575
465 Ga0495649_0109463
466 Ga0495589_0000192
467 Ga0495660_0000156
468 Ga0495660_0000273
469 Ga0495683_0001655
470 Ga0495679_000003
471 Ga0495673_0000004
472 Ga0495673_0000127
473 Ga0495673_0001542
474 Ga0495686_0000024
475 Ga0495686_0000375
476 Ga0495686_0104863
477 Ga0496100_0003924
478 Ga0496101_0000359
479 Ga0496104_0011953
480 Ga0496105_0005024
481 Ga0496106_0000807
482 Ga0496114_0002014
483 Ga0496115_0001580
484 Ga0496115_0077462
485 Ga0496116_0175442
486 Ga0496117_0007810
487 Ga0496118_0000714
488 Ga0496118_0003985
489 Ga0496118_0223701
490 Ga0496121_0000829
491 Ga0496121_0001307
492 Ga0496121_0001580
493 Ga0496121_0098983
494 Ga0496122_0005001
495 Ga0496123_0005702
496 Ga0496123_0031147
497 Ga0496123_0100356
498 Ga0496125_0002397
499 Ga0496125_0003619
500 Ga0496126_0085834
501 Ga0496126_0186768
502 Ga0495678_000026
503 Ga0495678_022531
504 Ga0495682_0009997
505 Ga0495682_0010675
506 Ga0501031_0076003
507 Ga0501033_0078521
508 Ga0501034_0007072
509 Ga0501036_0271327
510 Ga0501037_0007967
511 Ga0501043_0013549
512 Ga0501046_0018316
513 Ga0501070_0015983
514 Ga0501080_0087028
515 Ga0501035_0004859
516 Ga0501035_0038906
517 Ga0501035_0054578
518 Ga0501044_0025524
519 Ga0501044_0027291
520 nmdc:mga0sz30_112410_c1
521 Ga0495619_0118961
522 Ga0500643_000138
523 Ga0500555_000108
524 Ga0500633_0080410
525 Ga0500645_002528
526 2525557035
527 2595449060
528 2595452809
529 2630648631
530 2721025744
531 2735834284
532 2739225703
533 2739733741
534 2846040658
535 2884339071
536 2884411733
537 2919086244
538 2919407842
539 2928966589
540 2941473398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

68

307

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9573 7 327
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9344 7 327
6sun-assembly1.cif.gz_A amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami 0.7573 17 313
6sul-assembly2.cif.gz_D amicoumacin kinase amin in complex with amp-pnp, mg2+ and ami 0.7524 21 328
6sv5-assembly1.cif.gz_A amicoumacin kinase amin in complex with atp 0.7508 21 328
ID Description Score Start End Superfamily
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9719 155 324 1.20.1270.170
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9661 21 111 3.30.200.70
1zylA02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9523 64 264 1.10.510.10
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9496 155 324 1.20.1270.170
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9459 21 111 3.30.200.70
ID Description Score Start End GO Terms
AF-A0A661H663-F1-model_v4 Stress response kinase A 0.9903 7 107 GO:0004674
GO:0005737
AF-A0A3C0T6H6-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9899 21 327 GO:0000287
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A7W8M6T8-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9898 8 327 GO:0000287
GO:0004674
GO:0005524
GO:0005737
AF-A0A0Q5DJ26-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9893 7 327 GO:0000287
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A1G0BW38-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9893 7 327 GO:0000287
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244

Map