F376948

General Info

Members Datasets Scaffolds Average Seq Length
270 219 540 146

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11268556|Ga0163162_112685562
Length 156
Sequence MPLDKPYLDVPGTTIFDAEQSRKGYALNQFCMSLMKAENRARFKADERAYLDEWPMTEDQKQAVVARDLNRCIALGGNIYFLAKIGATDGKSFQQMAGSMTGMTETEYRDMMVGGGRSVEGNRKIGEDGDAQAHRQPQGRPSSPRRQQPARCRTFP

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
148 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
149 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
150 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
188 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
191 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
192 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
193 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
202 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
212 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
213 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
214 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
215 2643221652 Acidovorax sp. Root402 Isolate Unclassified
216 2738541337 Pelomonas sp. BT06 Isolate Unclassified
217 2738543012 Acidovorax sp. CF301 Isolate Unclassified
218 2816332133 Acidovorax radicis 2721A Isolate Unclassified
219 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 0.74
Rhizoplane 4.81
Rhizosphere 72.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_11268556 3300013306 Bacteria 837
2 JGI24033J26618_1044819 3300002155 Bacteria 624
3 rootH1_10006439 3300003316 Bacteria 3636
4 rootL2_10020853 3300003322 Bacteria 2646
5 Ga0055524_1051318 3300003775 Bacteria 932
6 Ga0055530_10039025 3300003791 Bacteria 1176
7 Ga0055531_10008251 3300003794 Bacteria 5538
8 Ga0065704_10480721 3300005289 Bacteria 682
9 Ga0065715_10131229 3300005293 Bacteria 2011
10 Ga0065707_10084750 3300005295 Bacteria 6818
11 Ga0070658_10414210 3300005327 Bacteria 1158
12 Ga0070683_100737333 3300005329 Bacteria 944
13 Ga0070670_100000863 3300005331 Bacteria 23798
14 Ga0070677_10013954 3300005333 Bacteria 2821
15 Ga0070682_100442976 3300005337 Bacteria 993
16 Ga0068868_100055153 3300005338 Bacteria 3135
17 Ga0070660_100345573 3300005339 Bacteria 1225
18 Ga0070660_101517619 3300005339 Bacteria 570
19 Ga0070689_100000047 3300005340 Bacteria 75697
20 Ga0070669_100003725 3300005353 Bacteria 11006
21 Ga0070675_100000605 3300005354 Bacteria 24695
22 Ga0070671_100023448 3300005355 Bacteria 5050
23 Ga0070674_100010407 3300005356 Bacteria 5624
24 Ga0070674_100113936 3300005356 Bacteria 1990
25 Ga0070673_100142532 3300005364 Bacteria 2023
26 Ga0070667_100435510 3300005367 Bacteria 1197
27 Ga0070667_100777994 3300005367 Bacteria 888
28 Ga0070713_100749792 3300005436 Bacteria 934
29 Ga0070710_10493328 3300005437 Bacteria 837
30 Ga0070700_100570544 3300005441 Bacteria 882
31 Ga0070678_100002173 3300005456 Bacteria 10652
32 Ga0068867_100007933 3300005459 Bacteria 7499
33 Ga0068867_100926299 3300005459 Bacteria 786
34 Ga0070679_100231634 3300005530 Bacteria 1806
35 Ga0070679_100770940 3300005530 Bacteria 905
36 Ga0068853_100338410 3300005539 Bacteria 1398
37 Ga0070672_100003662 3300005543 Bacteria 9983
38 Ga0070672_101767646 3300005543 Bacteria 556
39 Ga0070665_100586510 3300005548 Bacteria 1128
40 Ga0070664_100051993 3300005564 Bacteria 3469
41 Ga0068859_101116095 3300005617 Bacteria 868
42 Ga0068864_100702871 3300005618 Bacteria 988
43 Ga0068851_10692474 3300005834 Bacteria 627
44 Ga0068862_101817363 3300005844 Bacteria 619
45 Ga0081455_10182845 3300005937 Bacteria 1585
46 Ga0075365_10002903 3300006038 Bacteria 8643
47 Ga0075366_10028081 3300006195 Bacteria 3301
48 Ga0075366_10079277 3300006195 Bacteria 1960
49 Ga0097621_100102844 3300006237 Bacteria 2406
50 Ga0068871_100025108 3300006358 Bacteria 4632
51 Ga0075433_10032292 3300006852 Bacteria 4484
52 Ga0075434_100437721 3300006871 Bacteria 1329
53 Ga0068865_100914995 3300006881 Bacteria 764
54 Ga0075436_100125059 3300006914 Bacteria 1801
55 Ga0097620_101116020 3300006931 Bacteria 868
56 Ga0099823_1000138 3300006944 Bacteria 37983
57 Ga0075435_100018531 3300007076 Bacteria 5298
58 Ga0105240_10514490 3300009093 Bacteria 1329
59 Ga0111539_10059069 3300009094 Bacteria 4549
60 Ga0111539_11237007 3300009094 Bacteria 867
61 Ga0111539_11673136 3300009094 Bacteria 738
62 Ga0105245_11781054 3300009098 Bacteria 668
63 Ga0114129_10008622 3300009147 Bacteria 14537
64 Ga0105243_10227630 3300009148 Bacteria 1652
65 Ga0105242_11192170 3300009176 Bacteria 780
66 Ga0105238_10391618 3300009551 Bacteria 1382
67 Ga0157328_1004173 3300012478 Bacteria 790
68 Ga0157374_10353771 3300013296 Bacteria 1460
69 Ga0157372_13323146 3300013307 Bacteria 512
70 Ga0157375_10252396 3300013308 Bacteria 1925
71 Ga0157377_10857613 3300014745 Bacteria 675
72 Ga0157379_10075337 3300014968 Bacteria 3021
73 Ga0157376_10716994 3300014969 Bacteria 1007
74 Ga0163161_10125677 3300017792 Bacteria 1931
75 Ga0213871_10015598 3300021441 Bacteria 1820
76 Ga0209258_103215 3300025242 Bacteria 3649
77 Ga0209050_1005408 3300025298 Bacteria 8053
78 Ga0209256_1000840 3300025299 Bacteria 38531
79 Ga0209051_1004454 3300025303 Bacteria 8621
80 Ga0209257_1004031 3300025304 Bacteria 11813
81 Ga0207697_10337834 3300025315 Bacteria 669
82 Ga0207656_10209178 3300025321 Bacteria 945
83 Ga0207692_10533192 3300025898 Bacteria 748
84 Ga0207688_10524410 3300025901 Bacteria 743
85 Ga0207680_10116331 3300025903 Bacteria 1742
86 Ga0207645_10103197 3300025907 Bacteria 1841
87 Ga0207645_10435613 3300025907 Bacteria 884
88 Ga0207681_10044971 3300025923 Bacteria 2961
89 Ga0207694_10211078 3300025924 Bacteria 1581
90 Ga0207650_10000326 3300025925 Bacteria 46321
91 Ga0207650_10261844 3300025925 Bacteria 1403
92 Ga0207659_10000299 3300025926 Bacteria 29997
93 Ga0207659_10125702 3300025926 Bacteria 1972
94 Ga0207700_10000035 3300025928 Bacteria 119648
95 Ga0207644_10001354 3300025931 Bacteria 15752
96 Ga0207709_10067607 3300025935 Bacteria 2255
97 Ga0207670_10000064 3300025936 Bacteria 75795
98 Ga0207669_10059409 3300025937 Bacteria 2338
99 Ga0207691_10000049 3300025940 Bacteria 94813
100 Ga0207711_11017409 3300025941 Bacteria 768
101 Ga0207689_10007180 3300025942 Bacteria 9786
102 Ga0207661_10581624 3300025944 Bacteria 1027
103 Ga0207679_10102758 3300025945 Bacteria 2239
104 Ga0207679_11157588 3300025945 Bacteria 710
105 Ga0207651_10000834 3300025960 Bacteria 13379
106 Ga0207651_10029510 3300025960 Bacteria 3476
107 Ga0207651_10177582 3300025960 Bacteria 1686
108 Ga0207658_10025492 3300025986 Bacteria 4141
109 Ga0207677_10013354 3300026023 Bacteria 4756
110 Ga0207708_10586915 3300026075 Bacteria 943
111 Ga0207648_10002748 3300026089 Bacteria 18702
112 Ga0207676_10059072 3300026095 Bacteria 3027
113 Ga0207674_10308111 3300026116 Bacteria 1533
114 Ga0207675_100790514 3300026118 Bacteria 962
115 Ga0207683_10016814 3300026121 Bacteria 6225
116 Ga0209389_1023254 3300027296 Bacteria 5470
117 Ga0209371_1069657 3300027312 Bacteria 628
118 Ga0209967_1068144 3300027364 Bacteria 554
119 Ga0209970_1000463 3300027614 Bacteria 6935
120 Ga0209971_1123372 3300027682 Bacteria 637
121 Ga0207428_10054438 3300027907 Bacteria 3187
122 Ga0268266_11386510 3300028379 Bacteria 678
123 Ga0268264_10031537 3300028381 Bacteria 4344
124 Ga0265318_10100398 3300028577 Bacteria 1065
125 Ga0307515_10000011 3300028794 Bacteria 633903
126 Ga0307515_10000494 3300028794 Bacteria 94354
127 Ga0307515_10006133 3300028794 Bacteria 24177
128 Ga0307515_10006378 3300028794 Bacteria 23616
129 Ga0307515_10375235 3300028794 Bacteria 1057
130 Ga0268256_1077618 3300030500 Bacteria 628
131 Ga0307512_10118896 3300030522 Bacteria 1706
132 Ga0265332_10047800 3300031238 Bacteria 1841
133 Ga0265327_10005550 3300031251 Bacteria 10474
134 Ga0307513_10012594 3300031456 Bacteria 10427
135 Ga0307513_10070175 3300031456 Bacteria 3663
136 Ga0307513_10619773 3300031456 Bacteria 790
137 Ga0307513_10671070 3300031456 Bacteria 743
138 Ga0307509_10174955 3300031507 Bacteria 2020
139 Ga0307509_10303456 3300031507 Bacteria 1343
140 Ga0307408_100000029 3300031548 Bacteria 227806
141 Ga0307408_100086750 3300031548 Bacteria 2353
142 Ga0307508_10000096 3300031616 Bacteria 103730
143 Ga0307514_10001887 3300031649 Bacteria 23094
144 Ga0316575_10048147 3300031665 Bacteria 1695
145 Ga0316575_10230682 3300031665 Bacteria 774
146 Ga0307516_10009880 3300031730 Bacteria 10581
147 Ga0307405_10001234 3300031731 Bacteria 10638
148 Ga0307405_10156113 3300031731 Bacteria 1611
149 Ga0307413_10002493 3300031824 Bacteria 7503
150 Ga0307410_10103476 3300031852 Bacteria 2045
151 Ga0307407_10017891 3300031903 Bacteria 3570
152 Ga0307407_10505985 3300031903 Bacteria 886
153 Ga0307412_10004520 3300031911 Bacteria 7750
154 Ga0307409_100005343 3300031995 Bacteria 7374
155 Ga0307416_100005644 3300032002 Bacteria 7724
156 Ga0307414_10053083 3300032004 Bacteria 2825
157 Ga0307414_10345582 3300032004 Bacteria 1275
158 Ga0307411_10000218 3300032005 Bacteria 18566
159 Ga0307411_10003401 3300032005 Bacteria 7374
160 Ga0307411_10139997 3300032005 Bacteria 1783
161 Ga0307411_11385193 3300032005 Bacteria 643
162 Ga0373948_0000494 3300034817 Bacteria 4917
163 Ga0373958_0047065 3300034819 Bacteria 900
164 Ga0373959_0002211 3300034820 Bacteria 3101
165 Ga0373938_0105878 3300034957 Bacteria 711
166 Ga0373940_0003519 3300035088 Bacteria 3206
167 Ga0373949_0032242 3300035090 Bacteria 1253
168 Ga0373951_0017327 3300035091 Bacteria 1629
169 Ga0373932_0017217 3300035112 Bacteria 1853
170 Ga0373939_0000469 3300035114 Bacteria 10203
171 Ga0373960_0002150 3300035121 Bacteria 4439
172 Ga0373960_0154982 3300035121 Bacteria 785
173 Ga0373955_0263668 3300035172 Bacteria 1035
174 Ga0373961_0004472 3300035241 Bacteria 3379
175 Ga0373961_0210896 3300035241 Bacteria 689
176 Ga0373962_0001611 3300035242 Bacteria 5354
177 Ga0373931_0000097 3300035691 Bacteria 40104
178 Ga0373931_0203426 3300035691 Bacteria 1184
179 Ga0373937_1054057 3300036401 Bacteria 762
180 Ga0373925_0529534 3300037068 Bacteria 968
181 Ga0373925_0738637 3300037068 Bacteria 811
182 Ga0400490_31337 3300038726 Bacteria 30266
183 Ga0400490_35285 3300038726 Bacteria 7917
184 Ga0400490_37707 3300038726 Bacteria 3018
185 Ga0400490_38475 3300038726 Bacteria 2881
186 Ga0400490_43931 3300038726 Bacteria 87826
187 Ga0400491_04233 3300038727 Bacteria 1718
188 Ga0400488_13685 3300038741 Bacteria 1285
189 Ga0400488_39983 3300038741 Bacteria 2577
190 Ga0400488_57469 3300038741 Bacteria 1264
191 Ga0400487_07370 3300039110 Bacteria 1964
192 Ga0400487_42799 3300039110 Bacteria 62577
193 Ga0436365_1766397 3300039437 Bacteria 1592
194 Ga0436360_0560119 3300039438 Bacteria 1371
195 Ga0436361_0617386 3300039447 Bacteria 1252
196 Ga0436361_1121029 3300039447 Bacteria 1130
197 Ga0436361_1170147 3300039447 Bacteria 951
198 Ga0436362_1220629 3300039453 Bacteria 614
199 Ga0451793_1238400 3300041452 Bacteria 1680
200 Ga0451802_0909224 3300041460 Bacteria 1360
201 Ga0451807_1402310 3300041486 Bacteria 817
202 Ga0451835_0186570 3300041492 Bacteria 1096
203 Ga0451839_0589430 3300041496 Bacteria 865
204 Ga0451849_0673643 3300041505 Bacteria 519
205 Ga0451853_3030240 3300041512 Bacteria 701
206 Ga0439437_012236 3300042000 Bacteria 989
207 Ga0439445_0099988 3300042004 Bacteria 822
208 Ga0450888_001158 3300042126 Bacteria 2514
209 Ga0450890_002928 3300042127 Bacteria 2298
210 Ga0450891_000776 3300042129 Bacteria 3338
211 Ga0450892_000870 3300042130 Bacteria 3282
212 Ga0450889_002261 3300042144 Bacteria 1927
213 Ga0439446_0075137 3300042156 Bacteria 1039
214 Ga0439434_0199240 3300042435 Bacteria 675
215 Ga0450893_0000636 3300042532 Bacteria 5008
216 Ga0453684_0083046 3300044712 Bacteria 3988
217 Ga0453684_0183943 3300044712 Bacteria 2451
218 Ga0451576_0451562 3300045051 Bacteria 1349
219 Ga0451576_1626741 3300045051 Bacteria 670
220 Ga0495610_0042051 3300046512 Bacteria 2289
221 Ga0495643_0119634 3300046522 Bacteria 1332
222 Ga0495597_0001231 3300046542 Bacteria 19066
223 Ga0495625_0002034 3300046660 Bacteria 22774
224 Ga0495671_0401299 3300046692 Bacteria 656
225 Ga0496100_0260924 3300048903 Bacteria 1285
226 Ga0496101_0024543 3300048904 Bacteria 4173
227 Ga0496101_0732063 3300048904 Bacteria 781
228 Ga0496102_0189689 3300048905 Bacteria 1937
229 Ga0496102_0594536 3300048905 Bacteria 1029
230 Ga0496107_0054243 3300048910 Bacteria 2893
231 Ga0496107_0354513 3300048910 Bacteria 1092
232 Ga0496114_0000501 3300048917 Bacteria 28631
233 Ga0496114_0007334 3300048917 Bacteria 8706
234 Ga0496115_0024043 3300048918 Bacteria 4733
235 Ga0496121_0034694 3300048924 Bacteria 4537
236 Ga0496124_0136930 3300048927 Bacteria 1937
237 Ga0501296_042955 3300049519 Bacteria 643
238 Ga0501300_005181 3300049523 Bacteria 1930
239 Ga0501073_0010248 3300049589 Bacteria 6884
240 Ga0501198_000037 3300049649 Bacteria 52054
241 Ga0501199_025339 3300049650 Bacteria 708
242 Ga0501206_019056 3300049653 Bacteria 970
243 Ga0501211_003127 3300049658 Bacteria 1717
244 Ga0501222_000032 3300049662 Bacteria 55723
245 Ga0501223_011973 3300049663 Bacteria 1739
246 Ga0501227_123166 3300049665 Bacteria 701
247 Ga0501233_011178 3300049668 Bacteria 1781
248 Ga0501252_057125 3300049682 Bacteria 602
249 Ga0501259_039029 3300049688 Bacteria 927
250 Ga0501229_002426 3300049706 Bacteria 2197
251 Ga0501271_014166 3300049768 Bacteria 880
252 Ga0501272_001711 3300049769 Bacteria 2111
253 nmdc:mga03n38_107268_c1 3300050490 Bacteria 1355
254 nmdc:mga0yw44_71390_c1 3300050492 Bacteria 2156
255 nmdc:mga0k408_113681_c1 3300050493 Bacteria 1601
256 nmdc:mga0k408_336400_c1 3300050493 Bacteria 900
257 nmdc:mga07m45_449417_c1 3300050496 Bacteria 747
258 nmdc:mga05p37_52613_c1 3300050507 Bacteria 5006
259 nmdc:mga08y16_10513_c1 3300050511 Bacteria 9711
260 nmdc:mga0rr50_142109_c1 3300050513 Bacteria 1932
261 nmdc:mga0a205_85247_c1 3300050515 Bacteria 3051
262 2587756658 2585428062 Bacteria 6842168
263 2643745041 2643221544 Bacteria 5886209
264 2644222259 2643221639 Bacteria 6649903
265 2644258144 2643221646 Bacteria 6433402
266 2644296443 2643221652 Bacteria 5140275
267 2739053721 2738541337 Bacteria 6183410
268 2739244311 2738543012 Bacteria 7115078
269 2816469742 2816332133 Bacteria 7249298
270 2990715229 2990710928 Bacteria 5002431
271 Ga0163162_11268556
272 JGI24033J26618_1044819
273 rootH1_10006439
274 rootL2_10020853
275 Ga0055524_1051318
276 Ga0055530_10039025
277 Ga0055531_10008251
278 Ga0065704_10480721
279 Ga0065715_10131229
280 Ga0065707_10084750
281 Ga0070658_10414210
282 Ga0070683_100737333
283 Ga0070670_100000863
284 Ga0070677_10013954
285 Ga0070682_100442976
286 Ga0068868_100055153
287 Ga0070660_100345573
288 Ga0070660_101517619
289 Ga0070689_100000047
290 Ga0070669_100003725
291 Ga0070675_100000605
292 Ga0070671_100023448
293 Ga0070674_100010407
294 Ga0070674_100113936
295 Ga0070673_100142532
296 Ga0070667_100435510
297 Ga0070667_100777994
298 Ga0070713_100749792
299 Ga0070710_10493328
300 Ga0070700_100570544
301 Ga0070678_100002173
302 Ga0068867_100007933
303 Ga0068867_100926299
304 Ga0070679_100231634
305 Ga0070679_100770940
306 Ga0068853_100338410
307 Ga0070672_100003662
308 Ga0070672_101767646
309 Ga0070665_100586510
310 Ga0070664_100051993
311 Ga0068859_101116095
312 Ga0068864_100702871
313 Ga0068851_10692474
314 Ga0068862_101817363
315 Ga0081455_10182845
316 Ga0075365_10002903
317 Ga0075366_10028081
318 Ga0075366_10079277
319 Ga0097621_100102844
320 Ga0068871_100025108
321 Ga0075433_10032292
322 Ga0075434_100437721
323 Ga0068865_100914995
324 Ga0075436_100125059
325 Ga0097620_101116020
326 Ga0099823_1000138
327 Ga0075435_100018531
328 Ga0105240_10514490
329 Ga0111539_10059069
330 Ga0111539_11237007
331 Ga0111539_11673136
332 Ga0105245_11781054
333 Ga0114129_10008622
334 Ga0105243_10227630
335 Ga0105242_11192170
336 Ga0105238_10391618
337 Ga0157328_1004173
338 Ga0157374_10353771
339 Ga0157372_13323146
340 Ga0157375_10252396
341 Ga0157377_10857613
342 Ga0157379_10075337
343 Ga0157376_10716994
344 Ga0163161_10125677
345 Ga0213871_10015598
346 Ga0209258_103215
347 Ga0209050_1005408
348 Ga0209256_1000840
349 Ga0209051_1004454
350 Ga0209257_1004031
351 Ga0207697_10337834
352 Ga0207656_10209178
353 Ga0207692_10533192
354 Ga0207688_10524410
355 Ga0207680_10116331
356 Ga0207645_10103197
357 Ga0207645_10435613
358 Ga0207681_10044971
359 Ga0207694_10211078
360 Ga0207650_10000326
361 Ga0207650_10261844
362 Ga0207659_10000299
363 Ga0207659_10125702
364 Ga0207700_10000035
365 Ga0207644_10001354
366 Ga0207709_10067607
367 Ga0207670_10000064
368 Ga0207669_10059409
369 Ga0207691_10000049
370 Ga0207711_11017409
371 Ga0207689_10007180
372 Ga0207661_10581624
373 Ga0207679_10102758
374 Ga0207679_11157588
375 Ga0207651_10000834
376 Ga0207651_10029510
377 Ga0207651_10177582
378 Ga0207658_10025492
379 Ga0207677_10013354
380 Ga0207708_10586915
381 Ga0207648_10002748
382 Ga0207676_10059072
383 Ga0207674_10308111
384 Ga0207675_100790514
385 Ga0207683_10016814
386 Ga0209389_1023254
387 Ga0209371_1069657
388 Ga0209967_1068144
389 Ga0209970_1000463
390 Ga0209971_1123372
391 Ga0207428_10054438
392 Ga0268266_11386510
393 Ga0268264_10031537
394 Ga0265318_10100398
395 Ga0307515_10000011
396 Ga0307515_10000494
397 Ga0307515_10006133
398 Ga0307515_10006378
399 Ga0307515_10375235
400 Ga0268256_1077618
401 Ga0307512_10118896
402 Ga0265332_10047800
403 Ga0265327_10005550
404 Ga0307513_10012594
405 Ga0307513_10070175
406 Ga0307513_10619773
407 Ga0307513_10671070
408 Ga0307509_10174955
409 Ga0307509_10303456
410 Ga0307408_100000029
411 Ga0307408_100086750
412 Ga0307508_10000096
413 Ga0307514_10001887
414 Ga0316575_10048147
415 Ga0316575_10230682
416 Ga0307516_10009880
417 Ga0307405_10001234
418 Ga0307405_10156113
419 Ga0307413_10002493
420 Ga0307410_10103476
421 Ga0307407_10017891
422 Ga0307407_10505985
423 Ga0307412_10004520
424 Ga0307409_100005343
425 Ga0307416_100005644
426 Ga0307414_10053083
427 Ga0307414_10345582
428 Ga0307411_10000218
429 Ga0307411_10003401
430 Ga0307411_10139997
431 Ga0307411_11385193
432 Ga0373948_0000494
433 Ga0373958_0047065
434 Ga0373959_0002211
435 Ga0373938_0105878
436 Ga0373940_0003519
437 Ga0373949_0032242
438 Ga0373951_0017327
439 Ga0373932_0017217
440 Ga0373939_0000469
441 Ga0373960_0002150
442 Ga0373960_0154982
443 Ga0373955_0263668
444 Ga0373961_0004472
445 Ga0373961_0210896
446 Ga0373962_0001611
447 Ga0373931_0000097
448 Ga0373931_0203426
449 Ga0373937_1054057
450 Ga0373925_0529534
451 Ga0373925_0738637
452 Ga0400490_31337
453 Ga0400490_35285
454 Ga0400490_37707
455 Ga0400490_38475
456 Ga0400490_43931
457 Ga0400491_04233
458 Ga0400488_13685
459 Ga0400488_39983
460 Ga0400488_57469
461 Ga0400487_07370
462 Ga0400487_42799
463 Ga0436365_1766397
464 Ga0436360_0560119
465 Ga0436361_0617386
466 Ga0436361_1121029
467 Ga0436361_1170147
468 Ga0436362_1220629
469 Ga0451793_1238400
470 Ga0451802_0909224
471 Ga0451807_1402310
472 Ga0451835_0186570
473 Ga0451839_0589430
474 Ga0451849_0673643
475 Ga0451853_3030240
476 Ga0439437_012236
477 Ga0439445_0099988
478 Ga0450888_001158
479 Ga0450890_002928
480 Ga0450891_000776
481 Ga0450892_000870
482 Ga0450889_002261
483 Ga0439446_0075137
484 Ga0439434_0199240
485 Ga0450893_0000636
486 Ga0453684_0083046
487 Ga0453684_0183943
488 Ga0451576_0451562
489 Ga0451576_1626741
490 Ga0495610_0042051
491 Ga0495643_0119634
492 Ga0495597_0001231
493 Ga0495625_0002034
494 Ga0495671_0401299
495 Ga0496100_0260924
496 Ga0496101_0024543
497 Ga0496101_0732063
498 Ga0496102_0189689
499 Ga0496102_0594536
500 Ga0496107_0054243
501 Ga0496107_0354513
502 Ga0496114_0000501
503 Ga0496114_0007334
504 Ga0496115_0024043
505 Ga0496121_0034694
506 Ga0496124_0136930
507 Ga0501296_042955
508 Ga0501300_005181
509 Ga0501073_0010248
510 Ga0501198_000037
511 Ga0501199_025339
512 Ga0501206_019056
513 Ga0501211_003127
514 Ga0501222_000032
515 Ga0501223_011973
516 Ga0501227_123166
517 Ga0501233_011178
518 Ga0501252_057125
519 Ga0501259_039029
520 Ga0501229_002426
521 Ga0501271_014166
522 Ga0501272_001711
523 nmdc:mga03n38_107268_c1
524 nmdc:mga0yw44_71390_c1
525 nmdc:mga0k408_113681_c1
526 nmdc:mga0k408_336400_c1
527 nmdc:mga07m45_449417_c1
528 nmdc:mga05p37_52613_c1
529 nmdc:mga08y16_10513_c1
530 nmdc:mga0rr50_142109_c1
531 nmdc:mga0a205_85247_c1
532 2587756658
533 2643745041
534 2644222259
535 2644258144
536 2644296443
537 2739053721
538 2739244311
539 2816469742
540 2990715229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

27

113

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.9274 12 110
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.9237 12 110
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9142 12 110
7ltr-assembly1.cif.gz_D structure of the heteromeric complex between the alpha-n-methyltransferase (sonm) and a truncated construct of the ripp precursor (sona) (with sam) 0.9042 29 75
1bou-assembly1.cif.gz_C three-dimensional structure of ligab 0.9034 9 125
ID Description Score Start End Superfamily
3wkuA02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9301 12 110 1.10.700.10
3wr8A02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9138 12 110 1.10.700.10
3wraB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9133 12 110 1.10.700.10
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9093 12 109 1.10.700.10
1bouC00 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.9034 9 125 1.10.700.10
ID Description Score Start End GO Terms
AF-A0A4Q5RYM8-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9781 16 88
AF-C6XPK3-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit 0.9656 15 90 GO:0051213
AF-A0A7X1FUE0-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9651 16 89
AF-K2MTZ4-F1-model_v4 Protocatechuate 4,5-dioxygenase subunit alpha 0.9632 12 112 GO:0051213
AF-A0A1H4L239-F1-model_v4 Protocatechuate 4,5-dioxygenase alpha subunit 0.9612 12 112 GO:0051213

Map