F376955

General Info

Members Datasets Scaffolds Average Seq Length
270 167 267 460

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10054409|Ga0157375_100544093
Length 523
Sequence MHACRAIQTAWLGEIHRHGTTDEFSIVGRSKASKANERNEKPMSNLDARTRWLALYVLCLATLMIVLDVSIVGVALPSIKDDLGFSETSLAWVVNGYLLTYGGFLLLGGRLGDLYGHRRLFLIGISLFTLASLACGLATSQWELVVARGVQGLGGAVASAVSLSLMVNLFTEPGERAKAMGIFGFVASGGGSIGVLLGGIITDLISWHWIFLVNVPIGIGVVLLGMRLLPEVHIPTSARLDVWGAVTITASLIIAVYAIVNANEAGWTSGQTLGLLAVSVLLIGVFLVIEQRAKWPLVPLRLFKLRNLATADVVGILWAGAMFAWFFLTALYMQLVLGYSPLQIGLAFLPGNLIMGALSIGLSAKIVMRYGFRVPLAVGLGLASVGLLWLARAPVDGSYVVDILPSMVLLGLGAGTAFNPVLLAAMSDVEPQESGLASGVVNTSFMMGGALGLAVLASAAASRTSSLIDAGHSQAAALTSGYNLAFLIGAIFAGGGAVIGGLLLRNQEMPAHAPEGEPAMDAA

Samples

Sample ID Description Type Environment
1 2671180195 Frankia sp. CcI49 Isolate Nodule
2 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
3 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.3
Nodule 0.37
Rhizoplane 10.74
Rhizosphere 80.74
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002662 3300002705 Bacteria 6267
2 JGI25162J39368_1000369 3300002737 Bacteria 38411
3 JGI25165J46597_1000022 3300003214 Bacteria 357959
4 Ga0055538_1000011 3300003751 Bacteria 357959
5 Ga0055539_1000016 3300003752 Bacteria 358248
6 Ga0055533_1000019 3300003756 Bacteria 357959
7 Ga0055525_1000042 3300003759 Bacteria 279804
8 Ga0055541_1000017 3300003841 Bacteria 286811
9 Ga0070683_100009330 3300005329 Bacteria 8385
10 Ga0070683_100024415 3300005329 Bacteria 5415
11 Ga0070682_100000016 3300005337 Bacteria 239799
12 Ga0070682_100081488 3300005337 Bacteria 2095
13 Ga0070660_100010889 3300005339 Bacteria 6437
14 Ga0070668_100043685 3300005347 Bacteria 3436
15 Ga0070669_100001187 3300005353 Bacteria 18972
16 Ga0070674_100039425 3300005356 Bacteria 3190
17 Ga0070667_100000001 3300005367 Bacteria 1108638
18 Ga0070714_100001027 3300005435 Bacteria 19882
19 Ga0070713_100000557 3300005436 Bacteria 23759
20 Ga0070713_100040077 3300005436 Bacteria 3806
21 Ga0070694_100000007 3300005444 Bacteria 99088
22 Ga0070681_10073468 3300005458 Bacteria 3381
23 Ga0070685_10051643 3300005466 Bacteria 2377
24 Ga0070706_100001439 3300005467 Bacteria 25115
25 Ga0070707_100094064 3300005468 Bacteria 2902
26 Ga0070698_100191462 3300005471 Bacteria 1983
27 Ga0070699_100047743 3300005518 Bacteria 3705
28 Ga0070679_100150973 3300005530 Bacteria 2300
29 Ga0070684_100000407 3300005535 Bacteria 29480
30 Ga0070684_100001069 3300005535 Bacteria 19609
31 Ga0070696_100087295 3300005546 Bacteria 2216
32 Ga0070693_100000663 3300005547 Bacteria 15238
33 Ga0070664_100062485 3300005564 Bacteria 3175
34 Ga0068857_100001170 3300005577 Bacteria 20459
35 Ga0068854_100001094 3300005578 Bacteria 16298
36 Ga0068856_100144109 3300005614 Bacteria 2390
37 Ga0068856_100174064 3300005614 Bacteria 2165
38 Ga0068861_100001455 3300005719 Bacteria 14984
39 Ga0068861_100107261 3300005719 Bacteria 2233
40 Ga0068861_100158430 3300005719 Bacteria 1865
41 Ga0068862_100159910 3300005844 Bacteria 2010
42 Ga0081455_10001937 3300005937 Bacteria 24871
43 Ga0081455_10004689 3300005937 Bacteria 15213
44 Ga0081455_10039547 3300005937 Bacteria 4167
45 Ga0081538_10013405 3300005981 Bacteria 6492
46 Ga0081540_1001270 3300005983 Bacteria 21977
47 Ga0081540_1001920 3300005983 Bacteria 17417
48 Ga0081540_1021046 3300005983 Bacteria 3901
49 Ga0081539_10000062 3300005985 Bacteria 249871
50 Ga0075365_10017013 3300006038 Bacteria 4440
51 Ga0075365_10047072 3300006038 Bacteria 2834
52 Ga0070712_100042267 3300006175 Bacteria 3134
53 Ga0075428_100012172 3300006844 Bacteria 9568
54 Ga0075428_100056833 3300006844 Bacteria 4284
55 Ga0075430_100013611 3300006846 Bacteria 6933
56 Ga0075430_100075889 3300006846 Bacteria 2818
57 Ga0075431_100056403 3300006847 Bacteria 4052
58 Ga0075429_100034145 3300006880 Bacteria 4419
59 Ga0111539_10021844 3300009094 Bacteria 7869
60 Ga0111539_10117699 3300009094 Bacteria 3114
61 Ga0111539_10162154 3300009094 Bacteria 2615
62 Ga0105245_10004853 3300009098 Bacteria 11841
63 Ga0105245_10095170 3300009098 Bacteria 2747
64 Ga0114129_10003391 3300009147 Bacteria 22391
65 Ga0114129_10187840 3300009147 Bacteria 2807
66 Ga0114129_10297396 3300009147 Bacteria 2153
67 Ga0105242_10105313 3300009176 Bacteria 2396
68 Ga0157342_1001354 3300012507 Bacteria 1791
69 Ga0157370_10004305 3300013104 Bacteria 16361
70 Ga0157372_10005573 3300013307 Bacteria 13383
71 Ga0157375_10054409 3300013308 Bacteria 3941
72 Ga0157375_10267449 3300013308 Bacteria 1871
73 Ga0209784_100019 3300025224 Bacteria 453558
74 Ga0209566_100017 3300025225 Bacteria 453558
75 Ga0209674_100031 3300025226 Bacteria 453558
76 Ga0209563_100035 3300025230 Bacteria 453558
77 Ga0207427_100639 3300025231 Bacteria 16992
78 Ga0209437_100038 3300025233 Bacteria 453558
79 Ga0209677_100020 3300025253 Bacteria 453558
80 Ga0209233_1000049 3300025261 Bacteria 453558
81 Ga0207656_10001368 3300025321 Bacteria 8036
82 Ga0207688_10045550 3300025901 Bacteria 2447
83 Ga0207699_10000305 3300025906 Bacteria 26269
84 Ga0207684_10000458 3300025910 Bacteria 53238
85 Ga0207693_10053990 3300025915 Bacteria 3153
86 Ga0207657_10007362 3300025919 Bacteria 11291
87 Ga0207652_10053008 3300025921 Bacteria 3483
88 Ga0207646_10080491 3300025922 Bacteria 2912
89 Ga0207681_10001013 3300025923 Bacteria 18329
90 Ga0207659_10119216 3300025926 Bacteria 2020
91 Ga0207687_10001348 3300025927 Bacteria 16798
92 Ga0207687_10011234 3300025927 Bacteria 5848
93 Ga0207687_10033361 3300025927 Bacteria 3492
94 Ga0207700_10000001 3300025928 Bacteria 1122509
95 Ga0207700_10000432 3300025928 Bacteria 24652
96 Ga0207664_10016255 3300025929 Bacteria 5424
97 Ga0207664_10221315 3300025929 Bacteria 1642
98 Ga0207706_10142866 3300025933 Bacteria 2105
99 Ga0207704_10044713 3300025938 Bacteria 2626
100 Ga0207665_10009644 3300025939 Bacteria 6341
101 Ga0207691_10068180 3300025940 Bacteria 3214
102 Ga0207661_10008791 3300025944 Bacteria 7226
103 Ga0207661_10232088 3300025944 Bacteria 1634
104 Ga0207640_10000122 3300025981 Bacteria 59302
105 Ga0207658_10000003 3300025986 Bacteria 1151934
106 Ga0207708_10006643 3300026075 Bacteria 8557
107 Ga0207674_10001150 3300026116 Bacteria 34275
108 Ga0207674_10009427 3300026116 Bacteria 11153
109 Ga0207675_100105498 3300026118 Bacteria 2656
110 Ga0307513_10000557 3300031456 Bacteria 53384
111 Ga0307409_100010981 3300031995 Bacteria 5675
112 Ga0307416_100053935 3300032002 Bacteria 3229
113 Ga0373947_0029783 3300035725 Bacteria 3204
114 Ga0373925_0104989 3300037068 Bacteria 2176
115 Ga0395899_0001266 3300037312 Bacteria 21971
116 Ga0395899_0004284 3300037312 Bacteria 11152
117 Ga0395899_0005078 3300037312 Bacteria 10241
118 Ga0395899_0010070 3300037312 Bacteria 7247
119 Ga0395899_0026323 3300037312 Bacteria 4389
120 Ga0395899_0157532 3300037312 Bacteria 1606
121 Ga0395900_0005305 3300037418 Bacteria 13510
122 Ga0395900_0005887 3300037418 Bacteria 12804
123 Ga0395900_0005938 3300037418 Bacteria 12745
124 Ga0395900_0034160 3300037418 Bacteria 5236
125 Ga0395900_0072710 3300037418 Bacteria 3535
126 Ga0395900_0075638 3300037418 Bacteria 3461
127 Ga0395900_0082770 3300037418 Bacteria 3297
128 Ga0395900_0262507 3300037418 Bacteria 1724
129 Ga0395900_0263516 3300037418 Bacteria 1720
130 Ga0395900_0263665 3300037418 Bacteria 1720
131 Ga0395898_0000723 3300037466 Bacteria 58117
132 Ga0395898_0004029 3300037466 Bacteria 16152
133 Ga0395898_0006846 3300037466 Bacteria 12122
134 Ga0395898_0007873 3300037466 Bacteria 11305
135 Ga0395898_0016351 3300037466 Bacteria 7594
136 Ga0395898_0139435 3300037466 Bacteria 2321
137 Ga0395898_0170683 3300037466 Bacteria 2079
138 Ga0395898_0206361 3300037466 Bacteria 1875
139 Ga0395905_0002134 3300037471 Bacteria 22436
140 Ga0395905_0005783 3300037471 Bacteria 12567
141 Ga0395905_0008308 3300037471 Bacteria 10242
142 Ga0395905_0019419 3300037471 Bacteria 6443
143 Ga0395905_0026909 3300037471 Bacteria 5424
144 Ga0395905_0119147 3300037471 Bacteria 2481
145 Ga0395905_0149314 3300037471 Bacteria 2199
146 Ga0395905_0268948 3300037471 Bacteria 1590
147 Ga0395905_0306063 3300037471 Bacteria 1477
148 Ga0436364_0847497 3300037853 Bacteria 4274
149 Ga0395901_0012376 3300038443 Bacteria 8654
150 Ga0395901_0016470 3300038443 Bacteria 7531
151 Ga0395901_0055459 3300038443 Bacteria 4121
152 Ga0395901_0058065 3300038443 Bacteria 4025
153 Ga0395901_0096479 3300038443 Bacteria 3098
154 Ga0395901_0131316 3300038443 Bacteria 2632
155 Ga0395901_0172362 3300038443 Bacteria 2270
156 Ga0395901_0178667 3300038443 Bacteria 2226
157 Ga0395901_0322403 3300038443 Bacteria 1598
158 Ga0436362_0907662 3300039453 Bacteria 5537
159 Ga0439466_0030083 3300041411 Bacteria 1865
160 Ga0451853_3502454 3300041512 Bacteria 1439
161 Ga0439448_0010194 3300042005 Bacteria 2780
162 Ga0466966_0093863 3300044684 Bacteria 1860
163 Ga0466961_0008415 3300044693 Bacteria 6568
164 Ga0466961_0015314 3300044693 Bacteria 4925
165 Ga0466961_0031362 3300044693 Bacteria 3416
166 Ga0466963_0001137 3300044694 Bacteria 13906
167 Ga0466963_0002758 3300044694 Bacteria 9907
168 Ga0466964_0012251 3300044706 Bacteria 3245
169 Ga0466971_0000469 3300044719 Bacteria 15840
170 Ga0466957_0004480 3300044842 Bacteria 7791
171 Ga0466957_0060408 3300044842 Bacteria 2324
172 Ga0466958_0001601 3300045836 Bacteria 10877
173 Ga0466967_0000004 3300045976 Bacteria 155664
174 Ga0466967_0013895 3300045976 Bacteria 6244
175 Ga0466967_0016237 3300045976 Bacteria 5863
176 Ga0466967_0018330 3300045976 Bacteria 5591
177 Ga0466967_0102151 3300045976 Bacteria 2622
178 Ga0466967_0110814 3300045976 Bacteria 2521
179 Ga0466967_0222182 3300045976 Bacteria 1795
180 Ga0495592_0031623 3300046454 Bacteria 3999
181 Ga0495603_0006859 3300046455 Bacteria 6831
182 Ga0495629_0006857 3300046459 Bacteria 8410
183 Ga0495651_0013932 3300046462 Bacteria 6218
184 Ga0495580_0000405 3300046472 Bacteria 35466
185 Ga0495582_0000667 3300046473 Bacteria 18903
186 Ga0495662_0005991 3300046476 Bacteria 6078
187 Ga0495664_0001735 3300046477 Bacteria 11583
188 Ga0495585_0110456 3300046492 Bacteria 1463
189 Ga0495618_0000058 3300046514 Bacteria 79638
190 Ga0495618_0019387 3300046514 Bacteria 4184
191 Ga0495630_0000722 3300046517 Bacteria 23376
192 Ga0495666_0000844 3300046526 Bacteria 14185
193 Ga0495640_0014372 3300046533 Bacteria 5995
194 Ga0495586_0009421 3300046535 Bacteria 5196
195 Ga0495587_0001191 3300046536 Bacteria 17191
196 Ga0495634_0000661 3300046642 Bacteria 33530
197 Ga0495634_0120166 3300046642 Bacteria 1683
198 Ga0495661_0006285 3300046665 Bacteria 8356
199 Ga0495623_0020521 3300046679 Bacteria 4270
200 Ga0495646_0000880 3300046680 Bacteria 17085
201 Ga0495658_0118525 3300046683 Bacteria 1599
202 Ga0495613_0008092 3300046689 Bacteria 7817
203 Ga0495613_0021831 3300046689 Bacteria 4772
204 Ga0495613_0073122 3300046689 Bacteria 2499
205 Ga0495600_0003045 3300046809 Bacteria 9785
206 Ga0495581_0004478 3300047315 Bacteria 8077
207 Ga0495581_0137788 3300047315 Bacteria 1423
208 Ga0495604_0005494 3300047317 Bacteria 10052
209 Ga0495604_0060483 3300047317 Bacteria 2901
210 Ga0495674_0016106 3300047319 Bacteria 6978
211 Ga0495676_0003111 3300047321 Bacteria 15010
212 Ga0495680_0003526 3300047322 Bacteria 15341
213 Ga0495680_0006737 3300047322 Bacteria 10623
214 Ga0495593_0002387 3300047673 Bacteria 11288
215 Ga0495614_0003427 3300048089 Bacteria 7095
216 Ga0496100_0024023 3300048903 Bacteria 3712
217 Ga0496101_0041179 3300048904 Bacteria 3293
218 Ga0496101_0096682 3300048904 Bacteria 2204
219 Ga0496102_0046644 3300048905 Bacteria 3935
220 Ga0496102_0170303 3300048905 Bacteria 2050
221 Ga0496104_0000224 3300048907 Bacteria 49763
222 Ga0496104_0034143 3300048907 Bacteria 4741
223 Ga0496104_0136824 3300048907 Bacteria 2354
224 Ga0496105_0001260 3300048908 Bacteria 17703
225 Ga0496105_0005525 3300048908 Bacteria 9592
226 Ga0496105_0046932 3300048908 Bacteria 3565
227 Ga0496108_0000024 3300048911 Bacteria 183389
228 Ga0496108_0020244 3300048911 Bacteria 5468
229 Ga0496108_0139721 3300048911 Bacteria 2087
230 Ga0496109_0000033 3300048912 Bacteria 160496
231 Ga0496109_0001074 3300048912 Bacteria 22668
232 Ga0496109_0003276 3300048912 Bacteria 13512
233 Ga0496109_0045047 3300048912 Bacteria 4003
234 Ga0496109_0199320 3300048912 Bacteria 1882
235 Ga0496110_0000072 3300048913 Bacteria 51313
236 Ga0496110_0011346 3300048913 Bacteria 7289
237 Ga0496110_0071234 3300048913 Bacteria 3082
238 Ga0496111_0003749 3300048914 Bacteria 9467
239 Ga0496111_0031422 3300048914 Bacteria 3782
240 Ga0496112_0087850 3300048915 Bacteria 3076
241 Ga0496112_0109611 3300048915 Bacteria 2731
242 Ga0496113_0019839 3300048916 Bacteria 4713
243 Ga0496114_0013751 3300048917 Bacteria 6488
244 Ga0496115_0169910 3300048918 Bacteria 1803
245 Ga0501070_0056243 3300049586 Bacteria 3261
246 Ga0501076_0087902 3300049592 Bacteria 2498
247 Ga0501079_0219573 3300049741 Bacteria 1485
248 Ga0501081_0005380 3300049743 Bacteria 8263
249 Ga0501081_0064083 3300049743 Bacteria 2552
250 Ga0501035_0167308 3300049822 Bacteria 1901
251 nmdc:mga05p37_185650_c1 3300050507 Bacteria 2528
252 nmdc:mga05p37_268760_c1 3300050507 Bacteria 2038
253 nmdc:mga0qj67_34948_c1 3300050509 Bacteria 3928
254 nmdc:mga06r32_20792_c1 3300050510 Bacteria 6047
255 nmdc:mga08y16_10615_c1 3300050511 Bacteria 9663
256 nmdc:mga08y16_202460_c1 3300050511 Bacteria 2057
257 nmdc:mga0rr50_7987_c1 3300050513 Bacteria 6565
258 nmdc:mga0a205_204636_c1 3300050515 Bacteria 1863
259 Ga0495601_0000654 3300053077 Bacteria 18468
260 Ga0495619_0000020 3300053085 Bacteria 201556
261 Ga0495619_0019670 3300053085 Bacteria 4294
262 Ga0495619_0020674 3300053085 Bacteria 4196
263 Ga0495619_0064023 3300053085 Bacteria 2451
264 Ga0501084_0092115 3300054114 Bacteria 2545
265 Ga0466962_0004873 3300061719 Bacteria 6454
266 Ga0466962_0045439 3300061719 Bacteria 2099
267 Ga0530510_0119875 3300061734 Bacteria 1931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10142866 Ga0207706_101428662 399
2 3300044693 Ga0466961_0015314 Ga0466961_0015314_103_1476 399
3 3300025940 Ga0207691_10068180 Ga0207691_100681802 400
4 3300053085 Ga0495619_0000020 Ga0495619_0000020_190392_191801 402
5 3300031456 Ga0307513_10000557 Ga0307513_1000055743 403
6 3300046454 Ga0495592_0031623 Ga0495592_0031623_291_1649 403
7 3300046455 Ga0495603_0006859 Ga0495603_0006859_5409_6767 403
8 3300046459 Ga0495629_0006857 Ga0495629_0006857_1719_3077 403
9 3300046472 Ga0495580_0000405 Ga0495580_0000405_28066_29424 403
10 3300046473 Ga0495582_0000667 Ga0495582_0000667_8886_10244 403
11 3300046476 Ga0495662_0005991 Ga0495662_0005991_344_1702 403
12 3300046477 Ga0495664_0001735 Ga0495664_0001735_5945_7303 403
13 3300046514 Ga0495618_0019387 Ga0495618_0019387_2024_3382 403
14 3300046517 Ga0495630_0000722 Ga0495630_0000722_6921_8279 403
15 3300046526 Ga0495666_0000844 Ga0495666_0000844_4829_6187 403
16 3300046535 Ga0495586_0009421 Ga0495586_0009421_1956_3314 403
17 3300046536 Ga0495587_0001191 Ga0495587_0001191_8780_10138 403
18 3300046642 Ga0495634_0000661 Ga0495634_0000661_5500_6858 403
19 3300046665 Ga0495661_0006285 Ga0495661_0006285_401_1759 403
20 3300046679 Ga0495623_0020521 Ga0495623_0020521_908_2266 403
21 3300046680 Ga0495646_0000880 Ga0495646_0000880_9964_11322 403
22 3300046689 Ga0495613_0008092 Ga0495613_0008092_5881_7239 403
23 3300047315 Ga0495581_0004478 Ga0495581_0004478_1138_2496 403
24 3300047317 Ga0495604_0005494 Ga0495604_0005494_2918_4276 403
25 3300047321 Ga0495676_0003111 Ga0495676_0003111_7823_9181 403
26 3300047322 Ga0495680_0003526 Ga0495680_0003526_9027_10385 403
27 3300047673 Ga0495593_0002387 Ga0495593_0002387_8666_10024 403
28 3300048089 Ga0495614_0003427 Ga0495614_0003427_4957_6315 403
29 3300012507 Ga0157342_1001354 Ga0157342_10013543 405
30 3300047315 Ga0495581_0137788 Ga0495581_0137788_117_1403 412
31 3300013104 Ga0157370_10004305 Ga0157370_100043056 414
32 3300053077 Ga0495601_0000654 Ga0495601_0000654_16240_17712 414
33 3300005337 Ga0070682_100000016 Ga0070682_100000016235 416
34 3300046683 Ga0495658_0118525 Ga0495658_0118525_49_1437 416
35 3300049741 Ga0501079_0219573 Ga0501079_0219573_80_1465 417
36 3300005578 Ga0068854_100001094 Ga0068854_1000010946 419
37 3300009098 Ga0105245_10004853 Ga0105245_100048537 419
38 3300025321 Ga0207656_10001368 Ga0207656_100013686 419
39 3300025927 Ga0207687_10001348 Ga0207687_100013489 419
40 3300025981 Ga0207640_10000122 Ga0207640_1000012248 419
41 3300041512 Ga0451853_3502454 Ga0451853_3502454_21_1307 419
42 3300013307 Ga0157372_10005573 Ga0157372_100055734 420
43 3300005466 Ga0070685_10051643 Ga0070685_100516433 422
44 3300005844 Ga0068862_100159910 Ga0068862_1001599102 422
45 3300025938 Ga0207704_10044713 Ga0207704_100447132 422
46 3300025926 Ga0207659_10119216 Ga0207659_101192162 424
47 3300005347 Ga0070668_100043685 Ga0070668_1000436853 427
48 3300005719 Ga0068861_100107261 Ga0068861_1001072613 427
49 3300026075 Ga0207708_10006643 Ga0207708_100066433 427
50 3300005937 Ga0081455_10039547 Ga0081455_100395473 429
51 3300044694 Ga0466963_0002758 Ga0466963_0002758_5945_7393 429
52 3300005436 Ga0070713_100000557 Ga0070713_1000005573 432
53 3300025928 Ga0207700_10000432 Ga0207700_100004323 432
54 3300025906 Ga0207699_10000305 Ga0207699_100003058 434
55 3300054114 Ga0501084_0092115 Ga0501084_0092115_197_1630 434
56 3300045976 Ga0466967_0102151 Ga0466967_0102151_21_1400 435
57 3300038443 Ga0395901_0131316 Ga0395901_0131316_396_1811 436
58 3300044842 Ga0466957_0060408 Ga0466957_0060408_17_1426 436
59 3300048912 Ga0496109_0001074 Ga0496109_0001074_12494_13942 436
60 3300048913 Ga0496110_0000072 Ga0496110_0000072_41562_43010 436
61 3300048914 Ga0496111_0031422 Ga0496111_0031422_200_1648 436
62 3300048916 Ga0496113_0019839 Ga0496113_0019839_998_2446 436
63 3300045976 Ga0466967_0222182 Ga0466967_0222182_173_1624 437
64 3300046642 Ga0495634_0120166 Ga0495634_0120166_92_1543 437
65 3300046689 Ga0495613_0021831 Ga0495613_0021831_762_2213 437
66 3300037312 Ga0395899_0005078 Ga0395899_0005078_8141_9598 438
67 3300037418 Ga0395900_0005938 Ga0395900_0005938_8419_9876 438
68 3300037466 Ga0395898_0000723 Ga0395898_0000723_33641_35098 438
69 3300037471 Ga0395905_0002134 Ga0395905_0002134_257_1714 438
70 3300049743 Ga0501081_0005380 Ga0501081_0005380_1077_2537 438
71 3300005356 Ga0070674_100039425 Ga0070674_1000394252 439
72 3300005614 Ga0068856_100144109 Ga0068856_1001441093 439
73 3300037471 Ga0395905_0119147 Ga0395905_0119147_12_1457 439
74 3300037853 Ga0436364_0847497 Ga0436364_0847497_594_2033 439
75 3300038443 Ga0395901_0016470 Ga0395901_0016470_3302_4747 439
76 3300045976 Ga0466967_0018330 Ga0466967_0018330_39_1511 439
77 3300048904 Ga0496101_0096682 Ga0496101_0096682_543_2006 439
78 3300048907 Ga0496104_0000224 Ga0496104_0000224_306_1769 439
79 3300048908 Ga0496105_0001260 Ga0496105_0001260_2001_3464 439
80 3300048912 Ga0496109_0003276 Ga0496109_0003276_10323_11786 439
81 3300048914 Ga0496111_0003749 Ga0496111_0003749_6178_7641 439
82 3300005329 Ga0070683_100024415 Ga0070683_1000244154 440
83 3300005337 Ga0070682_100081488 Ga0070682_1000814882 440
84 3300005458 Ga0070681_10073468 Ga0070681_100734681 440
85 3300005535 Ga0070684_100001069 Ga0070684_10000106921 440
86 3300005547 Ga0070693_100000663 Ga0070693_10000066313 440
87 3300013308 Ga0157375_10267449 Ga0157375_102674492 440
88 3300025927 Ga0207687_10011234 Ga0207687_100112341 440
89 3300048905 Ga0496102_0046644 Ga0496102_0046644_701_2164 440
90 3300048905 Ga0496102_0170303 Ga0496102_0170303_227_1678 440
91 3300048908 Ga0496105_0046932 Ga0496105_0046932_1939_3402 440
92 3300048912 Ga0496109_0045047 Ga0496109_0045047_1659_3110 440
93 3300048913 Ga0496110_0011346 Ga0496110_0011346_1614_3065 440
94 3300048918 Ga0496115_0169910 Ga0496115_0169910_325_1788 440
95 3300050515 nmdc:mga0a205_204636_c1 nmdc:mga0a205_204636_c1_23_1474 440
96 3300046514 Ga0495618_0000058 Ga0495618_0000058_16377_17852 442
97 3300046809 Ga0495600_0003045 Ga0495600_0003045_8120_9595 442
98 3300005546 Ga0070696_100087295 Ga0070696_1000872952 443
99 3300048903 Ga0496100_0024023 Ga0496100_0024023_1852_3393 445
100 3300061719 Ga0466962_0045439 Ga0466962_0045439_410_1849 445
101 3300044684 Ga0466966_0093863 Ga0466966_0093863_358_1821 446
102 3300044693 Ga0466961_0008415 Ga0466961_0008415_3585_5018 446
103 3300044693 Ga0466961_0031362 Ga0466961_0031362_1899_3362 446
104 3300044694 Ga0466963_0001137 Ga0466963_0001137_11529_12962 446
105 3300044706 Ga0466964_0012251 Ga0466964_0012251_1494_2927 446
106 3300044719 Ga0466971_0000469 Ga0466971_0000469_2585_4018 446
107 3300044842 Ga0466957_0004480 Ga0466957_0004480_1600_3033 446
108 3300045836 Ga0466958_0001601 Ga0466958_0001601_9008_10441 446
109 3300061719 Ga0466962_0004873 Ga0466962_0004873_3632_5065 446
110 3300005367 Ga0070667_100000001 Ga0070667_100000001511 447
111 3300005467 Ga0070706_100001439 Ga0070706_10000143920 447
112 3300025910 Ga0207684_10000458 Ga0207684_100004589 447
113 3300025986 Ga0207658_10000003 Ga0207658_10000003869 447
114 3300005937 Ga0081455_10001937 Ga0081455_1000193713 448
115 3300048911 Ga0496108_0000024 Ga0496108_0000024_49662_51131 448
116 3300048912 Ga0496109_0000033 Ga0496109_0000033_26769_28238 448
117 3300005518 Ga0070699_100047743 Ga0070699_1000477433 449
118 3300048915 Ga0496112_0087850 Ga0496112_0087850_1355_2800 449
119 3300048912 Ga0496109_0199320 Ga0496109_0199320_12_1406 451
120 3300045976 Ga0466967_0000004 Ga0466967_0000004_9114_10580 454
121 3300005435 Ga0070714_100001027 Ga0070714_1000010271 455
122 3300025929 Ga0207664_10016255 Ga0207664_100162552 455
123 3300038443 Ga0395901_0178667 Ga0395901_0178667_61_1521 456
124 3300046492 Ga0495585_0110456 Ga0495585_0110456_53_1450 457
125 3300006175 Ga0070712_100042267 Ga0070712_1000422674 458
126 3300025915 Ga0207693_10053990 Ga0207693_100539902 458
127 3300048911 Ga0496108_0020244 Ga0496108_0020244_2371_3834 458
128 3300005468 Ga0070707_100094064 Ga0070707_1000940642 459
129 3300025922 Ga0207646_10080491 Ga0207646_100804913 459
130 3300037312 Ga0395899_0001266 Ga0395899_0001266_10607_12064 459
131 3300037418 Ga0395900_0005887 Ga0395900_0005887_4349_5806 459
132 3300037466 Ga0395898_0004029 Ga0395898_0004029_7303_8760 459
133 3300037471 Ga0395905_0008308 Ga0395905_0008308_1458_2915 459
134 3300037418 Ga0395900_0082770 Ga0395900_0082770_55_1521 461
135 3300038443 Ga0395901_0322403 Ga0395901_0322403_18_1484 461
136 3300045976 Ga0466967_0013895 Ga0466967_0013895_1942_3393 461
137 3300045976 Ga0466967_0110814 Ga0466967_0110814_233_1678 461
138 3300005436 Ga0070713_100040077 Ga0070713_1000400774 462
139 3300025928 Ga0207700_10000001 Ga0207700_10000001627 462
140 3300025929 Ga0207664_10221315 Ga0207664_102213152 462
141 3300025939 Ga0207665_10009644 Ga0207665_100096443 462
142 3300037418 Ga0395900_0263665 Ga0395900_0263665_67_1527 462
143 3300031995 Ga0307409_100010981 Ga0307409_1000109813 463
144 3300039453 Ga0436362_0907662 Ga0436362_0907662_2679_4133 463
145 3300045976 Ga0466967_0016237 Ga0466967_0016237_242_1699 463
146 3300048904 Ga0496101_0041179 Ga0496101_0041179_853_2313 463
147 3300048907 Ga0496104_0034143 Ga0496104_0034143_696_2156 463
148 3300048917 Ga0496114_0013751 Ga0496114_0013751_2927_4387 463
149 3300005444 Ga0070694_100000007 Ga0070694_10000000754 466
150 3300053085 Ga0495619_0019670 Ga0495619_0019670_2079_3536 466
151 3300005535 Ga0070684_100000407 Ga0070684_1000004071 468
152 3300005564 Ga0070664_100062485 Ga0070664_1000624853 468
153 3300005577 Ga0068857_100001170 Ga0068857_1000011706 468
154 3300025944 Ga0207661_10008791 Ga0207661_100087914 468
155 3300026116 Ga0207674_10001150 Ga0207674_1000115020 468
156 3300005719 Ga0068861_100158430 Ga0068861_1001584301 469
157 3300005983 Ga0081540_1001920 Ga0081540_10019209 469
158 3300005983 Ga0081540_1021046 Ga0081540_10210465 469
159 3300009147 Ga0114129_10187840 Ga0114129_101878402 469
160 3300026118 Ga0207675_100105498 Ga0207675_1001054981 469
161 3300042005 Ga0439448_0010194 Ga0439448_0010194_830_2272 469
162 3300050513 nmdc:mga0rr50_7987_c1 nmdc:mga0rr50_7987_c1_5052_6494 469
163 3300009094 Ga0111539_10162154 Ga0111539_101621543 471
164 3300046462 Ga0495651_0013932 Ga0495651_0013932_384_1841 471
165 3300046533 Ga0495640_0014372 Ga0495640_0014372_746_2203 471
166 3300046689 Ga0495613_0073122 Ga0495613_0073122_582_2039 471
167 3300047317 Ga0495604_0060483 Ga0495604_0060483_405_1862 471
168 3300047319 Ga0495674_0016106 Ga0495674_0016106_1197_2654 471
169 3300047322 Ga0495680_0006737 Ga0495680_0006737_3085_4542 471
170 3300049586 Ga0501070_0056243 Ga0501070_0056243_756_2294 471
171 3300050511 nmdc:mga08y16_202460_c1 nmdc:mga08y16_202460_c1_382_1809 471
172 3300053085 Ga0495619_0064023 Ga0495619_0064023_327_1784 471
173 3300061734 Ga0530510_0119875 Ga0530510_0119875_399_1832 473
174 3300006844 Ga0075428_100012172 Ga0075428_1000121722 474
175 3300006844 Ga0075428_100056833 Ga0075428_1000568332 474
176 3300006846 Ga0075430_100013611 Ga0075430_1000136118 474
177 3300006847 Ga0075431_100056403 Ga0075431_1000564032 474
178 3300006880 Ga0075429_100034145 Ga0075429_1000341452 474
179 3300009147 Ga0114129_10003391 Ga0114129_100033916 474
180 3300037466 Ga0395898_0139435 Ga0395898_0139435_738_2177 474
181 3300037471 Ga0395905_0026909 Ga0395905_0026909_459_1898 474
182 3300048907 Ga0496104_0136824 Ga0496104_0136824_724_2166 474
183 3300050510 nmdc:mga06r32_20792_c1 nmdc:mga06r32_20792_c1_1986_3434 474
184 3300005937 Ga0081455_10004689 Ga0081455_100046897 475
185 3300005985 Ga0081539_10000062 Ga0081539_10000062149 475
186 3300048911 Ga0496108_0139721 Ga0496108_0139721_540_1979 475
187 3300049743 Ga0501081_0064083 Ga0501081_0064083_498_1949 475
188 3300005339 Ga0070660_100010889 Ga0070660_1000108895 476
189 3300005353 Ga0070669_100001187 Ga0070669_1000011873 476
190 3300005530 Ga0070679_100150973 Ga0070679_1001509731 476
191 3300005719 Ga0068861_100001455 Ga0068861_1000014557 476
192 3300005981 Ga0081538_10013405 Ga0081538_100134052 476
193 3300006846 Ga0075430_100075889 Ga0075430_1000758892 476
194 3300009094 Ga0111539_10117699 Ga0111539_101176994 476
195 3300025919 Ga0207657_10007362 Ga0207657_100073629 476
196 3300025921 Ga0207652_10053008 Ga0207652_100530081 476
197 3300025923 Ga0207681_10001013 Ga0207681_100010134 476
198 3300032002 Ga0307416_100053935 Ga0307416_1000539355 476
199 3300037312 Ga0395899_0004284 Ga0395899_0004284_1098_2543 476
200 3300037418 Ga0395900_0072710 Ga0395900_0072710_808_2256 476
201 3300037418 Ga0395900_0075638 Ga0395900_0075638_1321_2766 476
202 3300037466 Ga0395898_0006846 Ga0395898_0006846_1987_3432 476
203 3300037471 Ga0395905_0005783 Ga0395905_0005783_390_1835 476
204 3300038443 Ga0395901_0055459 Ga0395901_0055459_210_1655 476
205 3300038443 Ga0395901_0058065 Ga0395901_0058065_916_2376 476
206 3300048908 Ga0496105_0005525 Ga0496105_0005525_5412_6881 476
207 3300050507 nmdc:mga05p37_185650_c1 nmdc:mga05p37_185650_c1_692_2146 476
208 3300053085 Ga0495619_0020674 Ga0495619_0020674_482_1951 476
209 3300002737 JGI25162J39368_1000369 JGI25162J39368_100036930 477
210 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022144 477
211 3300003751 Ga0055538_1000011 Ga0055538_1000011213 477
212 3300003752 Ga0055539_1000016 Ga0055539_1000016144 477
213 3300003756 Ga0055533_1000019 Ga0055533_1000019144 477
214 3300003759 Ga0055525_1000042 Ga0055525_1000042217 477
215 3300003841 Ga0055541_1000017 Ga0055541_100001778 477
216 3300005329 Ga0070683_100009330 Ga0070683_1000093303 477
217 3300005471 Ga0070698_100191462 Ga0070698_1001914622 477
218 3300005614 Ga0068856_100174064 Ga0068856_1001740641 477
219 3300005983 Ga0081540_1001270 Ga0081540_10012706 477
220 3300006038 Ga0075365_10047072 Ga0075365_100470722 477
221 3300009094 Ga0111539_10021844 Ga0111539_100218444 477
222 3300009147 Ga0114129_10297396 Ga0114129_102973961 477
223 3300009176 Ga0105242_10105313 Ga0105242_101053133 477
224 3300025224 Ga0209784_100019 Ga0209784_100019222 477
225 3300025225 Ga0209566_100017 Ga0209566_100017222 477
226 3300025226 Ga0209674_100031 Ga0209674_100031222 477
227 3300025230 Ga0209563_100035 Ga0209563_100035222 477
228 3300025231 Ga0207427_100639 Ga0207427_10063914 477
229 3300025233 Ga0209437_100038 Ga0209437_100038222 477
230 3300025253 Ga0209677_100020 Ga0209677_100020222 477
231 3300025261 Ga0209233_1000049 Ga0209233_1000049222 477
232 3300025901 Ga0207688_10045550 Ga0207688_100455502 477
233 3300025927 Ga0207687_10033361 Ga0207687_100333614 477
234 3300025944 Ga0207661_10232088 Ga0207661_102320881 477
235 3300026116 Ga0207674_10009427 Ga0207674_100094273 477
236 3300037312 Ga0395899_0010070 Ga0395899_0010070_2705_4162 477
237 3300037312 Ga0395899_0026323 Ga0395899_0026323_1479_2930 477
238 3300037418 Ga0395900_0034160 Ga0395900_0034160_2370_3866 477
239 3300037418 Ga0395900_0263516 Ga0395900_0263516_116_1573 477
240 3300037466 Ga0395898_0016351 Ga0395898_0016351_3836_5293 477
241 3300037466 Ga0395898_0170683 Ga0395898_0170683_539_1990 477
242 3300037466 Ga0395898_0206361 Ga0395898_0206361_220_1677 477
243 3300037471 Ga0395905_0019419 Ga0395905_0019419_3019_4476 477
244 3300037471 Ga0395905_0149314 Ga0395905_0149314_176_1639 477
245 3300037471 Ga0395905_0306063 Ga0395905_0306063_14_1465 477
246 3300038443 Ga0395901_0012376 Ga0395901_0012376_5032_6483 477
247 3300038443 Ga0395901_0172362 Ga0395901_0172362_373_1869 477
248 3300041411 Ga0439466_0030083 Ga0439466_0030083_110_1555 477
249 3300048913 Ga0496110_0071234 Ga0496110_0071234_156_1601 477
250 3300048915 Ga0496112_0109611 Ga0496112_0109611_1131_2615 477
251 3300049822 Ga0501035_0167308 Ga0501035_0167308_165_1619 477
252 3300050507 nmdc:mga05p37_268760_c1 nmdc:mga05p37_268760_c1_510_1961 477
253 3300050509 nmdc:mga0qj67_34948_c1 nmdc:mga0qj67_34948_c1_172_1623 477
254 3300050511 nmdc:mga08y16_10615_c1 nmdc:mga08y16_10615_c1_2922_4379 477
255 iso_pu_bacteria 2671180195 2671834653 477
256 3300006038 Ga0075365_10017013 Ga0075365_100170132 478
257 3300009098 Ga0105245_10095170 Ga0105245_100951702 478
258 3300013308 Ga0157375_10054409 Ga0157375_100544093 478
259 3300035725 Ga0373947_0029783 Ga0373947_0029783_742_2199 478
260 3300037068 Ga0373925_0104989 Ga0373925_0104989_186_1643 478
261 3300037312 Ga0395899_0157532 Ga0395899_0157532_54_1514 478
262 3300037418 Ga0395900_0005305 Ga0395900_0005305_9113_10573 478
263 3300037418 Ga0395900_0262507 Ga0395900_0262507_158_1666 478
264 3300037466 Ga0395898_0007873 Ga0395898_0007873_2166_3626 478
265 3300037471 Ga0395905_0268948 Ga0395905_0268948_111_1571 478
266 3300038443 Ga0395901_0096479 Ga0395901_0096479_1524_2984 478
267 3300049592 Ga0501076_0087902 Ga0501076_0087902_667_2226 478
268 iso_pu_bacteria 2684623035 2686539894 479
269 iso_pu_bacteria 2895880812 2895881866 479
270 3300002705 JGI25156J39149_1002662 JGI25156J39149_10026622 488

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

58

453

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8662 19 474
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8584 20 465
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8569 14 474
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8558 19 474
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.855 20 474
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9705 25 212 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9609 22 195 1.20.1250.20
af_P9WJY5_55_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9575 24 267 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9575 23 228 1.20.1250.20
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9528 23 215 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A536KPV3-F1-model_v4 MFS transporter 0.9803 18 479 GO:0016020
GO:0022857
AF-A0A1C6VJW4-F1-model_v4 Drug resistance transporter, EmrB/QacA subfamily 0.9798 14 476 GO:0016020
GO:0022857
AF-A0A3N9WGG5-F1-model_v4 deleted 0.9789 14 426
AF-A0A7Y5XVJ3-F1-model_v4 MFS transporter 0.9786 14 248 GO:0016020
GO:0022857
AF-A0A4P7HEX3-F1-model_v4 MFS transporter 0.9785 31 479 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map