F376987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 270 | 169 | 540 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300025711|Ga0207696_1027147|Ga0207696_10271472 |
| Length | 396 |
| Sequence | MTMTSSAPSRRPQSSLRSASSPWSSKPPLSGDTQVNLQPAADTNASRHSLEIRGISKAYGRFPALKDVSLQARDKEFLALLGPSGSGKTTLLRVLAGLETPDGGEVRFDDEDFLALPVRRRRIGMVFQHYALFRHMTVAQNIAFGLNVRPKAERPSKSEVADRVADLLSLVQLEGLGKRFPAQLSGGQRQRVALARALAIEPRMLLLDEPFGALDAQVRRELRRWLRELHDRAGVTTVFVTHDQEEALDLADRVAILKDGELVQLGAPSELYEAPANPFVYDFLGPACRLPGVVAEGRLRVADWESAAPHDAPQGEVEVFFRPDEVAFAPADGAGLAAQVRGAAARGPKLRIDCLIEGRAMELEAHSRDAPAGVAPGLAVRVKPLRPRVYATAGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 51 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 94 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 103 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 104 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 105 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 106 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 107 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 116 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 117 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 118 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 119 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 120 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 121 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 122 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 123 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 124 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 125 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 126 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 127 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 128 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 137 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 140 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 141 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 142 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 143 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 144 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 145 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 146 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 147 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 148 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 149 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 150 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 151 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 152 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 153 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 154 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 155 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 156 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 157 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 158 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 159 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 160 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 161 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 163 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 164 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 165 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 166 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 167 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 168 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 169 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.04 |
| Metatranscriptomes | 0 |
| Isolates | 2.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.07 |
| Nodule | 0.37 |
| Rhizoplane | 2.22 |
| Rhizosphere | 74.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207696_1027147 | 3300025711 | Bacteria | 1766 |
| 2 | Ga0055536_1008936 | 3300003781 | Bacteria | 4226 |
| 3 | Ga0055530_10000014 | 3300003791 | Bacteria | 151346 |
| 4 | Ga0055531_10002725 | 3300003794 | Bacteria | 11624 |
| 5 | Ga0058692_1000156 | 3300003856 | Bacteria | 43208 |
| 6 | Ga0055543_1007335 | 3300004625 | Bacteria | 2562 |
| 7 | Ga0065165_1001235 | 3300005262 | Bacteria | 29240 |
| 8 | Ga0065704_10070660 | 3300005289 | Bacteria | 18154 |
| 9 | Ga0070658_10012246 | 3300005327 | Bacteria | 6886 |
| 10 | Ga0070670_100000246 | 3300005331 | Bacteria | 48778 |
| 11 | Ga0070670_100017416 | 3300005331 | Bacteria | 6163 |
| 12 | Ga0070670_100033451 | 3300005331 | Bacteria | 4428 |
| 13 | Ga0070666_10025301 | 3300005335 | Bacteria | 3869 |
| 14 | Ga0070666_10159409 | 3300005335 | Bacteria | 1577 |
| 15 | Ga0070680_100000322 | 3300005336 | Bacteria | 32136 |
| 16 | Ga0070660_100019594 | 3300005339 | Bacteria | 4960 |
| 17 | Ga0070660_100028298 | 3300005339 | Bacteria | 4191 |
| 18 | Ga0070668_100005544 | 3300005347 | Bacteria | 9366 |
| 19 | Ga0070668_100011764 | 3300005347 | Bacteria | 6516 |
| 20 | Ga0070668_100020270 | 3300005347 | Bacteria | 5016 |
| 21 | Ga0070671_100001249 | 3300005355 | Bacteria | 19052 |
| 22 | Ga0070659_100000808 | 3300005366 | Bacteria | 22817 |
| 23 | Ga0070659_100005973 | 3300005366 | Bacteria | 8778 |
| 24 | Ga0070667_100000206 | 3300005367 | Bacteria | 69487 |
| 25 | Ga0070667_100002655 | 3300005367 | Bacteria | 15481 |
| 26 | Ga0070667_100008154 | 3300005367 | Bacteria | 8682 |
| 27 | Ga0070667_100021179 | 3300005367 | Bacteria | 5401 |
| 28 | Ga0070663_100078444 | 3300005455 | Bacteria | 2421 |
| 29 | Ga0070681_10008733 | 3300005458 | Bacteria | 9941 |
| 30 | Ga0070681_10054794 | 3300005458 | Bacteria | 3973 |
| 31 | Ga0070679_100004595 | 3300005530 | Bacteria | 12743 |
| 32 | Ga0070679_100255479 | 3300005530 | Bacteria | 1708 |
| 33 | Ga0070665_100000183 | 3300005548 | Bacteria | 111514 |
| 34 | Ga0070665_100003684 | 3300005548 | Bacteria | 16246 |
| 35 | Ga0068855_100013035 | 3300005563 | Bacteria | 10027 |
| 36 | Ga0068855_100027545 | 3300005563 | Bacteria | 6797 |
| 37 | Ga0068855_100058009 | 3300005563 | Bacteria | 4536 |
| 38 | Ga0068855_100123938 | 3300005563 | Bacteria | 2956 |
| 39 | Ga0070664_100004468 | 3300005564 | Bacteria | 11228 |
| 40 | Ga0068859_100001200 | 3300005617 | Bacteria | 26449 |
| 41 | Ga0068859_100012401 | 3300005617 | Bacteria | 8575 |
| 42 | Ga0068864_100004293 | 3300005618 | Bacteria | 11716 |
| 43 | Ga0068864_100010922 | 3300005618 | Bacteria | 7508 |
| 44 | Ga0068864_100049605 | 3300005618 | Bacteria | 3611 |
| 45 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 46 | Ga0068863_100000562 | 3300005841 | Bacteria | 37687 |
| 47 | Ga0068863_100001912 | 3300005841 | Bacteria | 20698 |
| 48 | Ga0068863_100141224 | 3300005841 | Bacteria | 2302 |
| 49 | Ga0068863_100264395 | 3300005841 | Bacteria | 1664 |
| 50 | Ga0068863_100420107 | 3300005841 | Bacteria | 1310 |
| 51 | Ga0068858_100000322 | 3300005842 | Bacteria | 50648 |
| 52 | Ga0068858_100024774 | 3300005842 | Bacteria | 5588 |
| 53 | Ga0068858_100127984 | 3300005842 | Bacteria | 2380 |
| 54 | Ga0068858_100180874 | 3300005842 | Bacteria | 1991 |
| 55 | Ga0068860_100002136 | 3300005843 | Bacteria | 20866 |
| 56 | Ga0068860_100002815 | 3300005843 | Bacteria | 18088 |
| 57 | Ga0068860_100034157 | 3300005843 | Bacteria | 4877 |
| 58 | Ga0068862_100000445 | 3300005844 | Bacteria | 44965 |
| 59 | Ga0068862_100037519 | 3300005844 | Bacteria | 4107 |
| 60 | Ga0075365_10080415 | 3300006038 | Bacteria | 2206 |
| 61 | Ga0075368_10005369 | 3300006042 | Bacteria | 4406 |
| 62 | Ga0075364_10019701 | 3300006051 | Bacteria | 4237 |
| 63 | Ga0075367_10001045 | 3300006178 | Bacteria | 11428 |
| 64 | Ga0075370_10051555 | 3300006353 | Bacteria | 2334 |
| 65 | Ga0097620_100001200 | 3300006931 | Bacteria | 26449 |
| 66 | Ga0097620_100012401 | 3300006931 | Bacteria | 8575 |
| 67 | Ga0079104_1011184 | 3300006946 | Bacteria | 2901 |
| 68 | Ga0105251_10000512 | 3300009011 | Bacteria | 36654 |
| 69 | Ga0105250_10037060 | 3300009092 | Bacteria | 1957 |
| 70 | Ga0105240_10002841 | 3300009093 | Bacteria | 27371 |
| 71 | Ga0105240_10051155 | 3300009093 | Bacteria | 5202 |
| 72 | Ga0105240_10339715 | 3300009093 | Bacteria | 1706 |
| 73 | Ga0105240_10374145 | 3300009093 | Bacteria | 1610 |
| 74 | Ga0105240_10560413 | 3300009093 | Bacteria | 1263 |
| 75 | Ga0105247_10021044 | 3300009101 | Bacteria | 3924 |
| 76 | Ga0105243_10003890 | 3300009148 | Bacteria | 11923 |
| 77 | Ga0105248_10000125 | 3300009177 | Bacteria | 88470 |
| 78 | Ga0105248_10003711 | 3300009177 | Bacteria | 16933 |
| 79 | Ga0105248_10004666 | 3300009177 | Bacteria | 15173 |
| 80 | Ga0105248_10041283 | 3300009177 | Bacteria | 5172 |
| 81 | Ga0105248_10041634 | 3300009177 | Bacteria | 5150 |
| 82 | Ga0105238_10018406 | 3300009551 | Bacteria | 7110 |
| 83 | Ga0105238_10027478 | 3300009551 | Bacteria | 5800 |
| 84 | Ga0105238_10063736 | 3300009551 | Bacteria | 3686 |
| 85 | Ga0105249_10027890 | 3300009553 | Bacteria | 5096 |
| 86 | Ga0157373_10021651 | 3300013100 | Bacteria | 4665 |
| 87 | Ga0157373_10032707 | 3300013100 | Bacteria | 3743 |
| 88 | Ga0157369_10051662 | 3300013105 | Bacteria | 4448 |
| 89 | Ga0163162_10282800 | 3300013306 | Bacteria | 1791 |
| 90 | Ga0163163_10005186 | 3300014325 | Bacteria | 11237 |
| 91 | Ga0163163_10042855 | 3300014325 | Bacteria | 4435 |
| 92 | Ga0157379_10014984 | 3300014968 | Bacteria | 6800 |
| 93 | Ga0157379_10059696 | 3300014968 | Bacteria | 3410 |
| 94 | Ga0209026_1005635 | 3300025250 | Bacteria | 3304 |
| 95 | Ga0209148_1003646 | 3300025254 | Bacteria | 4116 |
| 96 | Ga0209676_1000156 | 3300025292 | Bacteria | 163255 |
| 97 | Ga0209758_1000817 | 3300025297 | Bacteria | 43865 |
| 98 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 99 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 100 | Ga0209257_1001468 | 3300025304 | Bacteria | 27780 |
| 101 | Ga0207713_1000576 | 3300025735 | Bacteria | 36484 |
| 102 | Ga0207710_10079028 | 3300025900 | Bacteria | 1523 |
| 103 | Ga0207680_10070482 | 3300025903 | Bacteria | 2164 |
| 104 | Ga0207705_10005918 | 3300025909 | Bacteria | 9096 |
| 105 | Ga0207707_10002280 | 3300025912 | Bacteria | 17316 |
| 106 | Ga0207707_10021399 | 3300025912 | Bacteria | 5654 |
| 107 | Ga0207695_10004342 | 3300025913 | Bacteria | 19417 |
| 108 | Ga0207695_10022391 | 3300025913 | Bacteria | 7172 |
| 109 | Ga0207695_10032707 | 3300025913 | Bacteria | 5687 |
| 110 | Ga0207695_10039308 | 3300025913 | Bacteria | 5086 |
| 111 | Ga0207660_10003636 | 3300025917 | Bacteria | 10051 |
| 112 | Ga0207657_10046050 | 3300025919 | Bacteria | 3822 |
| 113 | Ga0207657_10160670 | 3300025919 | Bacteria | 1825 |
| 114 | Ga0207652_10005270 | 3300025921 | Bacteria | 10494 |
| 115 | Ga0207694_10032436 | 3300025924 | Bacteria | 3998 |
| 116 | Ga0207694_10088929 | 3300025924 | Bacteria | 2435 |
| 117 | Ga0207694_10095303 | 3300025924 | Bacteria | 2352 |
| 118 | Ga0207694_10252231 | 3300025924 | Bacteria | 1444 |
| 119 | Ga0207650_10000031 | 3300025925 | Bacteria | 230128 |
| 120 | Ga0207650_10005033 | 3300025925 | Bacteria | 9023 |
| 121 | Ga0207644_10002064 | 3300025931 | Bacteria | 13005 |
| 122 | Ga0207690_10000307 | 3300025932 | Bacteria | 33710 |
| 123 | Ga0207690_10017017 | 3300025932 | Bacteria | 4434 |
| 124 | Ga0207709_10002649 | 3300025935 | Bacteria | 11126 |
| 125 | Ga0207711_10000728 | 3300025941 | Bacteria | 32348 |
| 126 | Ga0207711_10002777 | 3300025941 | Bacteria | 15406 |
| 127 | Ga0207711_10012936 | 3300025941 | Bacteria | 6932 |
| 128 | Ga0207679_10065774 | 3300025945 | Bacteria | 2715 |
| 129 | Ga0207667_10006701 | 3300025949 | Bacteria | 13920 |
| 130 | Ga0207667_10018872 | 3300025949 | Bacteria | 7717 |
| 131 | Ga0207667_10082776 | 3300025949 | Bacteria | 3323 |
| 132 | Ga0207712_10015205 | 3300025961 | Bacteria | 4961 |
| 133 | Ga0207668_10001289 | 3300025972 | Bacteria | 14923 |
| 134 | Ga0207668_10005052 | 3300025972 | Bacteria | 7765 |
| 135 | Ga0207668_10007519 | 3300025972 | Bacteria | 6483 |
| 136 | Ga0207658_10001519 | 3300025986 | Bacteria | 18018 |
| 137 | Ga0207658_10016980 | 3300025986 | Bacteria | 5009 |
| 138 | Ga0207658_10046492 | 3300025986 | Bacteria | 3170 |
| 139 | Ga0207658_10067669 | 3300025986 | Bacteria | 2691 |
| 140 | Ga0207703_10000532 | 3300026035 | Bacteria | 39270 |
| 141 | Ga0207703_10003504 | 3300026035 | Bacteria | 13122 |
| 142 | Ga0207703_10076841 | 3300026035 | Bacteria | 2770 |
| 143 | Ga0207703_10101705 | 3300026035 | Bacteria | 2437 |
| 144 | Ga0207678_10236423 | 3300026067 | Bacteria | 1565 |
| 145 | Ga0207641_10000286 | 3300026088 | Bacteria | 63418 |
| 146 | Ga0207641_10000697 | 3300026088 | Bacteria | 36201 |
| 147 | Ga0207641_10010912 | 3300026088 | Bacteria | 7445 |
| 148 | Ga0207641_10258247 | 3300026088 | Bacteria | 1630 |
| 149 | Ga0207676_10000188 | 3300026095 | Bacteria | 54316 |
| 150 | Ga0207676_10008062 | 3300026095 | Bacteria | 7488 |
| 151 | Ga0207675_100092280 | 3300026118 | Bacteria | 2848 |
| 152 | Ga0209371_1000294 | 3300027312 | Bacteria | 56307 |
| 153 | Ga0268266_10000062 | 3300028379 | Bacteria | 253490 |
| 154 | Ga0268266_10004837 | 3300028379 | Bacteria | 12790 |
| 155 | Ga0268266_10288763 | 3300028379 | Bacteria | 1527 |
| 156 | Ga0268265_10063902 | 3300028380 | Bacteria | 2833 |
| 157 | Ga0268264_10000361 | 3300028381 | Bacteria | 67632 |
| 158 | Ga0268264_10006079 | 3300028381 | Bacteria | 10200 |
| 159 | Ga0268264_10048544 | 3300028381 | Bacteria | 3531 |
| 160 | Ga0265338_10035662 | 3300028800 | Bacteria | 4774 |
| 161 | Ga0268256_1000258 | 3300030500 | Bacteria | 56249 |
| 162 | Ga0307511_10031864 | 3300030521 | Bacteria | 4700 |
| 163 | Ga0265327_10012156 | 3300031251 | Bacteria | 5840 |
| 164 | Ga0307513_10002328 | 3300031456 | Bacteria | 26445 |
| 165 | Ga0307513_10003571 | 3300031456 | Bacteria | 21043 |
| 166 | Ga0265314_10117064 | 3300031711 | Bacteria | 1684 |
| 167 | Ga0307516_10000042 | 3300031730 | Bacteria | 142687 |
| 168 | Ga0307414_10359545 | 3300032004 | Bacteria | 1252 |
| 169 | Ga0307510_10006879 | 3300033180 | Bacteria | 13571 |
| 170 | Ga0373936_0003176 | 3300035113 | Bacteria | 6152 |
| 171 | Ga0373927_0000964 | 3300035695 | Bacteria | 21888 |
| 172 | Ga0373925_0000895 | 3300037068 | Bacteria | 27228 |
| 173 | Ga0373925_0079906 | 3300037068 | Bacteria | 2485 |
| 174 | Ga0395899_0000710 | 3300037312 | Bacteria | 33413 |
| 175 | Ga0395900_0000016 | 3300037418 | Bacteria | 382407 |
| 176 | Ga0395900_0018603 | 3300037418 | Bacteria | 7085 |
| 177 | Ga0395900_0391602 | 3300037418 | Bacteria | 1355 |
| 178 | Ga0395898_0015311 | 3300037466 | Bacteria | 7869 |
| 179 | Ga0395905_0033423 | 3300037471 | Bacteria | 4831 |
| 180 | Ga0395905_0043734 | 3300037471 | Bacteria | 4201 |
| 181 | Ga0395905_0052958 | 3300037471 | Bacteria | 3799 |
| 182 | Ga0395905_0054468 | 3300037471 | Bacteria | 3743 |
| 183 | Ga0395905_0211501 | 3300037471 | Bacteria | 1817 |
| 184 | Ga0395901_0000028 | 3300038443 | Bacteria | 242653 |
| 185 | Ga0395901_0103802 | 3300038443 | Bacteria | 2982 |
| 186 | Ga0395901_0196074 | 3300038443 | Bacteria | 2117 |
| 187 | Ga0436361_0923429 | 3300039447 | Bacteria | 2289 |
| 188 | Ga0439436_0010779 | 3300041404 | Bacteria | 2785 |
| 189 | Ga0439465_0002399 | 3300041413 | Bacteria | 6135 |
| 190 | Ga0439465_0022810 | 3300041413 | Bacteria | 1967 |
| 191 | Ga0439445_0010663 | 3300042004 | Bacteria | 2179 |
| 192 | Ga0439449_0000054 | 3300042007 | Bacteria | 34695 |
| 193 | Ga0495629_0013753 | 3300046459 | Bacteria | 5839 |
| 194 | Ga0495620_0024006 | 3300046515 | Bacteria | 2906 |
| 195 | Ga0495642_0037666 | 3300046528 | Bacteria | 1957 |
| 196 | Ga0495622_0004361 | 3300046557 | Bacteria | 6588 |
| 197 | Ga0495611_0088593 | 3300046648 | Bacteria | 1429 |
| 198 | Ga0495625_0028283 | 3300046660 | Bacteria | 4206 |
| 199 | Ga0495624_0147082 | 3300046690 | Bacteria | 1442 |
| 200 | Ga0495681_0073271 | 3300047470 | Bacteria | 1547 |
| 201 | Ga0496100_0146486 | 3300048903 | Bacteria | 1680 |
| 202 | Ga0496102_0074701 | 3300048905 | Bacteria | 3116 |
| 203 | Ga0496103_0055512 | 3300048906 | Bacteria | 2457 |
| 204 | Ga0496114_0012813 | 3300048917 | Bacteria | 6713 |
| 205 | Ga0496115_0007324 | 3300048918 | Bacteria | 8116 |
| 206 | Ga0496115_0010380 | 3300048918 | Bacteria | 6958 |
| 207 | Ga0496117_0006181 | 3300048920 | Bacteria | 12219 |
| 208 | Ga0496117_0050604 | 3300048920 | Bacteria | 2945 |
| 209 | Ga0496118_0006260 | 3300048921 | Bacteria | 13160 |
| 210 | Ga0496118_0012788 | 3300048921 | Bacteria | 8013 |
| 211 | Ga0496119_0000561 | 3300048922 | Bacteria | 50104 |
| 212 | Ga0496119_0010818 | 3300048922 | Bacteria | 7636 |
| 213 | Ga0496120_0000682 | 3300048923 | Bacteria | 49890 |
| 214 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 215 | Ga0496122_0001277 | 3300048925 | Bacteria | 41880 |
| 216 | Ga0496123_0000752 | 3300048926 | Bacteria | 52435 |
| 217 | Ga0496124_0003779 | 3300048927 | Bacteria | 18184 |
| 218 | Ga0496126_0037606 | 3300048929 | Bacteria | 4515 |
| 219 | Ga0496126_0117827 | 3300048929 | Bacteria | 2306 |
| 220 | Ga0501033_0022550 | 3300049570 | Bacteria | 4750 |
| 221 | Ga0501033_0068341 | 3300049570 | Bacteria | 2612 |
| 222 | Ga0501033_0143412 | 3300049570 | Bacteria | 1726 |
| 223 | Ga0501034_0008451 | 3300049571 | Bacteria | 10874 |
| 224 | Ga0501034_0349515 | 3300049571 | Bacteria | 1407 |
| 225 | Ga0501037_0225733 | 3300049573 | Bacteria | 1316 |
| 226 | Ga0501043_0033144 | 3300049579 | Bacteria | 4063 |
| 227 | Ga0501043_0190827 | 3300049579 | Bacteria | 1593 |
| 228 | Ga0501047_0241853 | 3300049581 | Bacteria | 1655 |
| 229 | Ga0501047_0248481 | 3300049581 | Bacteria | 1627 |
| 230 | Ga0501048_0067673 | 3300049582 | Bacteria | 2524 |
| 231 | Ga0501073_0020612 | 3300049589 | Bacteria | 4754 |
| 232 | Ga0501225_0000451 | 3300049705 | Bacteria | 12848 |
| 233 | Ga0501035_0098378 | 3300049822 | Bacteria | 2568 |
| 234 | Ga0501044_0001630 | 3300049823 | Bacteria | 26311 |
| 235 | Ga0501044_0040640 | 3300049823 | Bacteria | 4846 |
| 236 | Ga0501044_0171270 | 3300049823 | Bacteria | 2142 |
| 237 | Ga0501044_0256079 | 3300049823 | Bacteria | 1689 |
| 238 | nmdc:mga00v17_15794_c1 | 3300050491 | Bacteria | 4245 |
| 239 | nmdc:mga06z11_102880_c1 | 3300050494 | Bacteria | 1570 |
| 240 | nmdc:mga04h51_12850_c1 | 3300050495 | Bacteria | 2359 |
| 241 | nmdc:mga07m45_5477_c1 | 3300050496 | Bacteria | 6321 |
| 242 | Ga0500635_0000085 | 3300053080 | Bacteria | 59878 |
| 243 | Ga0500647_0036569 | 3300053091 | Bacteria | 2348 |
| 244 | Ga0500583_0135777 | 3300053092 | Bacteria | 1221 |
| 245 | Ga0500651_0004168 | 3300053093 | Bacteria | 8061 |
| 246 | Ga0500566_0006076 | 3300053094 | Bacteria | 7178 |
| 247 | Ga0500641_0001894 | 3300053096 | Bacteria | 7430 |
| 248 | Ga0500555_002775 | 3300053103 | Bacteria | 5025 |
| 249 | Ga0500562_000501 | 3300053108 | Bacteria | 9535 |
| 250 | Ga0500569_001292 | 3300053109 | Bacteria | 4674 |
| 251 | Ga0500595_003747 | 3300053119 | Bacteria | 7003 |
| 252 | Ga0500614_003640 | 3300053123 | Bacteria | 3308 |
| 253 | Ga0500559_0016002 | 3300053136 | Bacteria | 3167 |
| 254 | Ga0500590_024275 | 3300053148 | Bacteria | 3146 |
| 255 | Ga0500619_000660 | 3300053154 | Bacteria | 5860 |
| 256 | Ga0500624_014143 | 3300053157 | Bacteria | 1203 |
| 257 | Ga0500637_0140941 | 3300053178 | Bacteria | 1395 |
| 258 | Ga0500645_016044 | 3300053730 | Bacteria | 2364 |
| 259 | Ga0500596_000560 | 3300053735 | Bacteria | 7063 |
| 260 | Ga0501082_0009056 | 3300060353 | Bacteria | 8586 |
| 261 | Ga0501082_0123091 | 3300060353 | Bacteria | 2249 |
| 262 | Ga0501082_0129783 | 3300060353 | Bacteria | 2187 |
| 263 | 2643906264 | 2643221579 | Bacteria | 4443405 |
| 264 | 2643915284 | 2643221581 | Bacteria | 3893603 |
| 265 | 2819660582 | 2818991457 | Bacteria | 5323295 |
| 266 | 2852688885 | 2852684882 | Bacteria | 5463342 |
| 267 | 2919130142 | 2919130084 | Bacteria | 5301837 |
| 268 | 2923519166 | 2923516293 | Bacteria | 3716336 |
| 269 | 2929198860 | 2929195423 | Bacteria | 5325372 |
| 270 | 8002869546 | 8002869464 | Bacteria | 3588529 |
| 271 | Ga0207696_1027147 | |||
| 272 | Ga0055536_1008936 | |||
| 273 | Ga0055530_10000014 | |||
| 274 | Ga0055531_10002725 | |||
| 275 | Ga0058692_1000156 | |||
| 276 | Ga0055543_1007335 | |||
| 277 | Ga0065165_1001235 | |||
| 278 | Ga0065704_10070660 | |||
| 279 | Ga0070658_10012246 | |||
| 280 | Ga0070670_100000246 | |||
| 281 | Ga0070670_100017416 | |||
| 282 | Ga0070670_100033451 | |||
| 283 | Ga0070666_10025301 | |||
| 284 | Ga0070666_10159409 | |||
| 285 | Ga0070680_100000322 | |||
| 286 | Ga0070660_100019594 | |||
| 287 | Ga0070660_100028298 | |||
| 288 | Ga0070668_100005544 | |||
| 289 | Ga0070668_100011764 | |||
| 290 | Ga0070668_100020270 | |||
| 291 | Ga0070671_100001249 | |||
| 292 | Ga0070659_100000808 | |||
| 293 | Ga0070659_100005973 | |||
| 294 | Ga0070667_100000206 | |||
| 295 | Ga0070667_100002655 | |||
| 296 | Ga0070667_100008154 | |||
| 297 | Ga0070667_100021179 | |||
| 298 | Ga0070663_100078444 | |||
| 299 | Ga0070681_10008733 | |||
| 300 | Ga0070681_10054794 | |||
| 301 | Ga0070679_100004595 | |||
| 302 | Ga0070679_100255479 | |||
| 303 | Ga0070665_100000183 | |||
| 304 | Ga0070665_100003684 | |||
| 305 | Ga0068855_100013035 | |||
| 306 | Ga0068855_100027545 | |||
| 307 | Ga0068855_100058009 | |||
| 308 | Ga0068855_100123938 | |||
| 309 | Ga0070664_100004468 | |||
| 310 | Ga0068859_100001200 | |||
| 311 | Ga0068859_100012401 | |||
| 312 | Ga0068864_100004293 | |||
| 313 | Ga0068864_100010922 | |||
| 314 | Ga0068864_100049605 | |||
| 315 | Ga0068863_100000023 | |||
| 316 | Ga0068863_100000562 | |||
| 317 | Ga0068863_100001912 | |||
| 318 | Ga0068863_100141224 | |||
| 319 | Ga0068863_100264395 | |||
| 320 | Ga0068863_100420107 | |||
| 321 | Ga0068858_100000322 | |||
| 322 | Ga0068858_100024774 | |||
| 323 | Ga0068858_100127984 | |||
| 324 | Ga0068858_100180874 | |||
| 325 | Ga0068860_100002136 | |||
| 326 | Ga0068860_100002815 | |||
| 327 | Ga0068860_100034157 | |||
| 328 | Ga0068862_100000445 | |||
| 329 | Ga0068862_100037519 | |||
| 330 | Ga0075365_10080415 | |||
| 331 | Ga0075368_10005369 | |||
| 332 | Ga0075364_10019701 | |||
| 333 | Ga0075367_10001045 | |||
| 334 | Ga0075370_10051555 | |||
| 335 | Ga0097620_100001200 | |||
| 336 | Ga0097620_100012401 | |||
| 337 | Ga0079104_1011184 | |||
| 338 | Ga0105251_10000512 | |||
| 339 | Ga0105250_10037060 | |||
| 340 | Ga0105240_10002841 | |||
| 341 | Ga0105240_10051155 | |||
| 342 | Ga0105240_10339715 | |||
| 343 | Ga0105240_10374145 | |||
| 344 | Ga0105240_10560413 | |||
| 345 | Ga0105247_10021044 | |||
| 346 | Ga0105243_10003890 | |||
| 347 | Ga0105248_10000125 | |||
| 348 | Ga0105248_10003711 | |||
| 349 | Ga0105248_10004666 | |||
| 350 | Ga0105248_10041283 | |||
| 351 | Ga0105248_10041634 | |||
| 352 | Ga0105238_10018406 | |||
| 353 | Ga0105238_10027478 | |||
| 354 | Ga0105238_10063736 | |||
| 355 | Ga0105249_10027890 | |||
| 356 | Ga0157373_10021651 | |||
| 357 | Ga0157373_10032707 | |||
| 358 | Ga0157369_10051662 | |||
| 359 | Ga0163162_10282800 | |||
| 360 | Ga0163163_10005186 | |||
| 361 | Ga0163163_10042855 | |||
| 362 | Ga0157379_10014984 | |||
| 363 | Ga0157379_10059696 | |||
| 364 | Ga0209026_1005635 | |||
| 365 | Ga0209148_1003646 | |||
| 366 | Ga0209676_1000156 | |||
| 367 | Ga0209758_1000817 | |||
| 368 | Ga0209050_1000034 | |||
| 369 | Ga0209257_1000052 | |||
| 370 | Ga0209257_1001468 | |||
| 371 | Ga0207713_1000576 | |||
| 372 | Ga0207710_10079028 | |||
| 373 | Ga0207680_10070482 | |||
| 374 | Ga0207705_10005918 | |||
| 375 | Ga0207707_10002280 | |||
| 376 | Ga0207707_10021399 | |||
| 377 | Ga0207695_10004342 | |||
| 378 | Ga0207695_10022391 | |||
| 379 | Ga0207695_10032707 | |||
| 380 | Ga0207695_10039308 | |||
| 381 | Ga0207660_10003636 | |||
| 382 | Ga0207657_10046050 | |||
| 383 | Ga0207657_10160670 | |||
| 384 | Ga0207652_10005270 | |||
| 385 | Ga0207694_10032436 | |||
| 386 | Ga0207694_10088929 | |||
| 387 | Ga0207694_10095303 | |||
| 388 | Ga0207694_10252231 | |||
| 389 | Ga0207650_10000031 | |||
| 390 | Ga0207650_10005033 | |||
| 391 | Ga0207644_10002064 | |||
| 392 | Ga0207690_10000307 | |||
| 393 | Ga0207690_10017017 | |||
| 394 | Ga0207709_10002649 | |||
| 395 | Ga0207711_10000728 | |||
| 396 | Ga0207711_10002777 | |||
| 397 | Ga0207711_10012936 | |||
| 398 | Ga0207679_10065774 | |||
| 399 | Ga0207667_10006701 | |||
| 400 | Ga0207667_10018872 | |||
| 401 | Ga0207667_10082776 | |||
| 402 | Ga0207712_10015205 | |||
| 403 | Ga0207668_10001289 | |||
| 404 | Ga0207668_10005052 | |||
| 405 | Ga0207668_10007519 | |||
| 406 | Ga0207658_10001519 | |||
| 407 | Ga0207658_10016980 | |||
| 408 | Ga0207658_10046492 | |||
| 409 | Ga0207658_10067669 | |||
| 410 | Ga0207703_10000532 | |||
| 411 | Ga0207703_10003504 | |||
| 412 | Ga0207703_10076841 | |||
| 413 | Ga0207703_10101705 | |||
| 414 | Ga0207678_10236423 | |||
| 415 | Ga0207641_10000286 | |||
| 416 | Ga0207641_10000697 | |||
| 417 | Ga0207641_10010912 | |||
| 418 | Ga0207641_10258247 | |||
| 419 | Ga0207676_10000188 | |||
| 420 | Ga0207676_10008062 | |||
| 421 | Ga0207675_100092280 | |||
| 422 | Ga0209371_1000294 | |||
| 423 | Ga0268266_10000062 | |||
| 424 | Ga0268266_10004837 | |||
| 425 | Ga0268266_10288763 | |||
| 426 | Ga0268265_10063902 | |||
| 427 | Ga0268264_10000361 | |||
| 428 | Ga0268264_10006079 | |||
| 429 | Ga0268264_10048544 | |||
| 430 | Ga0265338_10035662 | |||
| 431 | Ga0268256_1000258 | |||
| 432 | Ga0307511_10031864 | |||
| 433 | Ga0265327_10012156 | |||
| 434 | Ga0307513_10002328 | |||
| 435 | Ga0307513_10003571 | |||
| 436 | Ga0265314_10117064 | |||
| 437 | Ga0307516_10000042 | |||
| 438 | Ga0307414_10359545 | |||
| 439 | Ga0307510_10006879 | |||
| 440 | Ga0373936_0003176 | |||
| 441 | Ga0373927_0000964 | |||
| 442 | Ga0373925_0000895 | |||
| 443 | Ga0373925_0079906 | |||
| 444 | Ga0395899_0000710 | |||
| 445 | Ga0395900_0000016 | |||
| 446 | Ga0395900_0018603 | |||
| 447 | Ga0395900_0391602 | |||
| 448 | Ga0395898_0015311 | |||
| 449 | Ga0395905_0033423 | |||
| 450 | Ga0395905_0043734 | |||
| 451 | Ga0395905_0052958 | |||
| 452 | Ga0395905_0054468 | |||
| 453 | Ga0395905_0211501 | |||
| 454 | Ga0395901_0000028 | |||
| 455 | Ga0395901_0103802 | |||
| 456 | Ga0395901_0196074 | |||
| 457 | Ga0436361_0923429 | |||
| 458 | Ga0439436_0010779 | |||
| 459 | Ga0439465_0002399 | |||
| 460 | Ga0439465_0022810 | |||
| 461 | Ga0439445_0010663 | |||
| 462 | Ga0439449_0000054 | |||
| 463 | Ga0495629_0013753 | |||
| 464 | Ga0495620_0024006 | |||
| 465 | Ga0495642_0037666 | |||
| 466 | Ga0495622_0004361 | |||
| 467 | Ga0495611_0088593 | |||
| 468 | Ga0495625_0028283 | |||
| 469 | Ga0495624_0147082 | |||
| 470 | Ga0495681_0073271 | |||
| 471 | Ga0496100_0146486 | |||
| 472 | Ga0496102_0074701 | |||
| 473 | Ga0496103_0055512 | |||
| 474 | Ga0496114_0012813 | |||
| 475 | Ga0496115_0007324 | |||
| 476 | Ga0496115_0010380 | |||
| 477 | Ga0496117_0006181 | |||
| 478 | Ga0496117_0050604 | |||
| 479 | Ga0496118_0006260 | |||
| 480 | Ga0496118_0012788 | |||
| 481 | Ga0496119_0000561 | |||
| 482 | Ga0496119_0010818 | |||
| 483 | Ga0496120_0000682 | |||
| 484 | Ga0496121_0000053 | |||
| 485 | Ga0496122_0001277 | |||
| 486 | Ga0496123_0000752 | |||
| 487 | Ga0496124_0003779 | |||
| 488 | Ga0496126_0037606 | |||
| 489 | Ga0496126_0117827 | |||
| 490 | Ga0501033_0022550 | |||
| 491 | Ga0501033_0068341 | |||
| 492 | Ga0501033_0143412 | |||
| 493 | Ga0501034_0008451 | |||
| 494 | Ga0501034_0349515 | |||
| 495 | Ga0501037_0225733 | |||
| 496 | Ga0501043_0033144 | |||
| 497 | Ga0501043_0190827 | |||
| 498 | Ga0501047_0241853 | |||
| 499 | Ga0501047_0248481 | |||
| 500 | Ga0501048_0067673 | |||
| 501 | Ga0501073_0020612 | |||
| 502 | Ga0501225_0000451 | |||
| 503 | Ga0501035_0098378 | |||
| 504 | Ga0501044_0001630 | |||
| 505 | Ga0501044_0040640 | |||
| 506 | Ga0501044_0171270 | |||
| 507 | Ga0501044_0256079 | |||
| 508 | nmdc:mga00v17_15794_c1 | |||
| 509 | nmdc:mga06z11_102880_c1 | |||
| 510 | nmdc:mga04h51_12850_c1 | |||
| 511 | nmdc:mga07m45_5477_c1 | |||
| 512 | Ga0500635_0000085 | |||
| 513 | Ga0500647_0036569 | |||
| 514 | Ga0500583_0135777 | |||
| 515 | Ga0500651_0004168 | |||
| 516 | Ga0500566_0006076 | |||
| 517 | Ga0500641_0001894 | |||
| 518 | Ga0500555_002775 | |||
| 519 | Ga0500562_000501 | |||
| 520 | Ga0500569_001292 | |||
| 521 | Ga0500595_003747 | |||
| 522 | Ga0500614_003640 | |||
| 523 | Ga0500559_0016002 | |||
| 524 | Ga0500590_024275 | |||
| 525 | Ga0500619_000660 | |||
| 526 | Ga0500624_014143 | |||
| 527 | Ga0500637_0140941 | |||
| 528 | Ga0500645_016044 | |||
| 529 | Ga0500596_000560 | |||
| 530 | Ga0501082_0009056 | |||
| 531 | Ga0501082_0123091 | |||
| 532 | Ga0501082_0129783 | |||
| 533 | 2643906264 | |||
| 534 | 2643915284 | |||
| 535 | 2819660582 | |||
| 536 | 2852688885 | |||
| 537 | 2919130142 | |||
| 538 | 2923519166 | |||
| 539 | 2929198860 | |||
| 540 | 8002869546 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9536 | 1 | 237 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9409 | 3 | 220 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9277 | 3 | 237 |
| 3c41-assembly1.cif.gz_K | abc protein artp in complex with amp-pnp/mg2+ | 0.9235 | 3 | 237 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9221 | 3 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9711 | 1 | 220 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9667 | 1 | 220 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9657 | 1 | 219 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9641 | 3 | 239 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9591 | 1 | 219 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382ZAC4-F1-model_v4 | ABC transporter domain-containing protein | 0.9751 | 2 | 213 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A528M0S6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9741 | 2 | 200 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A2V9R859-F1-model_v4 | ABC transporter domain-containing protein | 0.9722 | 1 | 155 |
GO:0005524
GO:0016887 |
| AF-A0A0P9DFL4-F1-model_v4 | ABC transporter domain-containing protein | 0.9722 | 3 | 158 |
GO:0005524
GO:0016887 |
| AF-A0A534HSD0-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9661 | 3 | 221 |
GO:0005524
GO:0016887 |