F376987

General Info

Members Datasets Scaffolds Average Seq Length
270 169 540 359

Family's Representative Sequence

Representative Sequence 3300025711|Ga0207696_1027147|Ga0207696_10271472
Length 396
Sequence MTMTSSAPSRRPQSSLRSASSPWSSKPPLSGDTQVNLQPAADTNASRHSLEIRGISKAYGRFPALKDVSLQARDKEFLALLGPSGSGKTTLLRVLAGLETPDGGEVRFDDEDFLALPVRRRRIGMVFQHYALFRHMTVAQNIAFGLNVRPKAERPSKSEVADRVADLLSLVQLEGLGKRFPAQLSGGQRQRVALARALAIEPRMLLLDEPFGALDAQVRRELRRWLRELHDRAGVTTVFVTHDQEEALDLADRVAILKDGELVQLGAPSELYEAPANPFVYDFLGPACRLPGVVAEGRLRVADWESAAPHDAPQGEVEVFFRPDEVAFAPADGAGLAAQVRGAAARGPKLRIDCLIEGRAMELEAHSRDAPAGVAPGLAVRVKPLRPRVYATAGGA

Samples

Sample ID Description Type Environment
1 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
144 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
156 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
157 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
158 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
159 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
160 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
163 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
164 2818991457 Xanthomonas translucens 569 Isolate Unclassified
165 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
166 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
167 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
168 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
169 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.07
Nodule 0.37
Rhizoplane 2.22
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207696_1027147 3300025711 Bacteria 1766
2 Ga0055536_1008936 3300003781 Bacteria 4226
3 Ga0055530_10000014 3300003791 Bacteria 151346
4 Ga0055531_10002725 3300003794 Bacteria 11624
5 Ga0058692_1000156 3300003856 Bacteria 43208
6 Ga0055543_1007335 3300004625 Bacteria 2562
7 Ga0065165_1001235 3300005262 Bacteria 29240
8 Ga0065704_10070660 3300005289 Bacteria 18154
9 Ga0070658_10012246 3300005327 Bacteria 6886
10 Ga0070670_100000246 3300005331 Bacteria 48778
11 Ga0070670_100017416 3300005331 Bacteria 6163
12 Ga0070670_100033451 3300005331 Bacteria 4428
13 Ga0070666_10025301 3300005335 Bacteria 3869
14 Ga0070666_10159409 3300005335 Bacteria 1577
15 Ga0070680_100000322 3300005336 Bacteria 32136
16 Ga0070660_100019594 3300005339 Bacteria 4960
17 Ga0070660_100028298 3300005339 Bacteria 4191
18 Ga0070668_100005544 3300005347 Bacteria 9366
19 Ga0070668_100011764 3300005347 Bacteria 6516
20 Ga0070668_100020270 3300005347 Bacteria 5016
21 Ga0070671_100001249 3300005355 Bacteria 19052
22 Ga0070659_100000808 3300005366 Bacteria 22817
23 Ga0070659_100005973 3300005366 Bacteria 8778
24 Ga0070667_100000206 3300005367 Bacteria 69487
25 Ga0070667_100002655 3300005367 Bacteria 15481
26 Ga0070667_100008154 3300005367 Bacteria 8682
27 Ga0070667_100021179 3300005367 Bacteria 5401
28 Ga0070663_100078444 3300005455 Bacteria 2421
29 Ga0070681_10008733 3300005458 Bacteria 9941
30 Ga0070681_10054794 3300005458 Bacteria 3973
31 Ga0070679_100004595 3300005530 Bacteria 12743
32 Ga0070679_100255479 3300005530 Bacteria 1708
33 Ga0070665_100000183 3300005548 Bacteria 111514
34 Ga0070665_100003684 3300005548 Bacteria 16246
35 Ga0068855_100013035 3300005563 Bacteria 10027
36 Ga0068855_100027545 3300005563 Bacteria 6797
37 Ga0068855_100058009 3300005563 Bacteria 4536
38 Ga0068855_100123938 3300005563 Bacteria 2956
39 Ga0070664_100004468 3300005564 Bacteria 11228
40 Ga0068859_100001200 3300005617 Bacteria 26449
41 Ga0068859_100012401 3300005617 Bacteria 8575
42 Ga0068864_100004293 3300005618 Bacteria 11716
43 Ga0068864_100010922 3300005618 Bacteria 7508
44 Ga0068864_100049605 3300005618 Bacteria 3611
45 Ga0068863_100000023 3300005841 Bacteria 186490
46 Ga0068863_100000562 3300005841 Bacteria 37687
47 Ga0068863_100001912 3300005841 Bacteria 20698
48 Ga0068863_100141224 3300005841 Bacteria 2302
49 Ga0068863_100264395 3300005841 Bacteria 1664
50 Ga0068863_100420107 3300005841 Bacteria 1310
51 Ga0068858_100000322 3300005842 Bacteria 50648
52 Ga0068858_100024774 3300005842 Bacteria 5588
53 Ga0068858_100127984 3300005842 Bacteria 2380
54 Ga0068858_100180874 3300005842 Bacteria 1991
55 Ga0068860_100002136 3300005843 Bacteria 20866
56 Ga0068860_100002815 3300005843 Bacteria 18088
57 Ga0068860_100034157 3300005843 Bacteria 4877
58 Ga0068862_100000445 3300005844 Bacteria 44965
59 Ga0068862_100037519 3300005844 Bacteria 4107
60 Ga0075365_10080415 3300006038 Bacteria 2206
61 Ga0075368_10005369 3300006042 Bacteria 4406
62 Ga0075364_10019701 3300006051 Bacteria 4237
63 Ga0075367_10001045 3300006178 Bacteria 11428
64 Ga0075370_10051555 3300006353 Bacteria 2334
65 Ga0097620_100001200 3300006931 Bacteria 26449
66 Ga0097620_100012401 3300006931 Bacteria 8575
67 Ga0079104_1011184 3300006946 Bacteria 2901
68 Ga0105251_10000512 3300009011 Bacteria 36654
69 Ga0105250_10037060 3300009092 Bacteria 1957
70 Ga0105240_10002841 3300009093 Bacteria 27371
71 Ga0105240_10051155 3300009093 Bacteria 5202
72 Ga0105240_10339715 3300009093 Bacteria 1706
73 Ga0105240_10374145 3300009093 Bacteria 1610
74 Ga0105240_10560413 3300009093 Bacteria 1263
75 Ga0105247_10021044 3300009101 Bacteria 3924
76 Ga0105243_10003890 3300009148 Bacteria 11923
77 Ga0105248_10000125 3300009177 Bacteria 88470
78 Ga0105248_10003711 3300009177 Bacteria 16933
79 Ga0105248_10004666 3300009177 Bacteria 15173
80 Ga0105248_10041283 3300009177 Bacteria 5172
81 Ga0105248_10041634 3300009177 Bacteria 5150
82 Ga0105238_10018406 3300009551 Bacteria 7110
83 Ga0105238_10027478 3300009551 Bacteria 5800
84 Ga0105238_10063736 3300009551 Bacteria 3686
85 Ga0105249_10027890 3300009553 Bacteria 5096
86 Ga0157373_10021651 3300013100 Bacteria 4665
87 Ga0157373_10032707 3300013100 Bacteria 3743
88 Ga0157369_10051662 3300013105 Bacteria 4448
89 Ga0163162_10282800 3300013306 Bacteria 1791
90 Ga0163163_10005186 3300014325 Bacteria 11237
91 Ga0163163_10042855 3300014325 Bacteria 4435
92 Ga0157379_10014984 3300014968 Bacteria 6800
93 Ga0157379_10059696 3300014968 Bacteria 3410
94 Ga0209026_1005635 3300025250 Bacteria 3304
95 Ga0209148_1003646 3300025254 Bacteria 4116
96 Ga0209676_1000156 3300025292 Bacteria 163255
97 Ga0209758_1000817 3300025297 Bacteria 43865
98 Ga0209050_1000034 3300025298 Bacteria 433906
99 Ga0209257_1000052 3300025304 Bacteria 430947
100 Ga0209257_1001468 3300025304 Bacteria 27780
101 Ga0207713_1000576 3300025735 Bacteria 36484
102 Ga0207710_10079028 3300025900 Bacteria 1523
103 Ga0207680_10070482 3300025903 Bacteria 2164
104 Ga0207705_10005918 3300025909 Bacteria 9096
105 Ga0207707_10002280 3300025912 Bacteria 17316
106 Ga0207707_10021399 3300025912 Bacteria 5654
107 Ga0207695_10004342 3300025913 Bacteria 19417
108 Ga0207695_10022391 3300025913 Bacteria 7172
109 Ga0207695_10032707 3300025913 Bacteria 5687
110 Ga0207695_10039308 3300025913 Bacteria 5086
111 Ga0207660_10003636 3300025917 Bacteria 10051
112 Ga0207657_10046050 3300025919 Bacteria 3822
113 Ga0207657_10160670 3300025919 Bacteria 1825
114 Ga0207652_10005270 3300025921 Bacteria 10494
115 Ga0207694_10032436 3300025924 Bacteria 3998
116 Ga0207694_10088929 3300025924 Bacteria 2435
117 Ga0207694_10095303 3300025924 Bacteria 2352
118 Ga0207694_10252231 3300025924 Bacteria 1444
119 Ga0207650_10000031 3300025925 Bacteria 230128
120 Ga0207650_10005033 3300025925 Bacteria 9023
121 Ga0207644_10002064 3300025931 Bacteria 13005
122 Ga0207690_10000307 3300025932 Bacteria 33710
123 Ga0207690_10017017 3300025932 Bacteria 4434
124 Ga0207709_10002649 3300025935 Bacteria 11126
125 Ga0207711_10000728 3300025941 Bacteria 32348
126 Ga0207711_10002777 3300025941 Bacteria 15406
127 Ga0207711_10012936 3300025941 Bacteria 6932
128 Ga0207679_10065774 3300025945 Bacteria 2715
129 Ga0207667_10006701 3300025949 Bacteria 13920
130 Ga0207667_10018872 3300025949 Bacteria 7717
131 Ga0207667_10082776 3300025949 Bacteria 3323
132 Ga0207712_10015205 3300025961 Bacteria 4961
133 Ga0207668_10001289 3300025972 Bacteria 14923
134 Ga0207668_10005052 3300025972 Bacteria 7765
135 Ga0207668_10007519 3300025972 Bacteria 6483
136 Ga0207658_10001519 3300025986 Bacteria 18018
137 Ga0207658_10016980 3300025986 Bacteria 5009
138 Ga0207658_10046492 3300025986 Bacteria 3170
139 Ga0207658_10067669 3300025986 Bacteria 2691
140 Ga0207703_10000532 3300026035 Bacteria 39270
141 Ga0207703_10003504 3300026035 Bacteria 13122
142 Ga0207703_10076841 3300026035 Bacteria 2770
143 Ga0207703_10101705 3300026035 Bacteria 2437
144 Ga0207678_10236423 3300026067 Bacteria 1565
145 Ga0207641_10000286 3300026088 Bacteria 63418
146 Ga0207641_10000697 3300026088 Bacteria 36201
147 Ga0207641_10010912 3300026088 Bacteria 7445
148 Ga0207641_10258247 3300026088 Bacteria 1630
149 Ga0207676_10000188 3300026095 Bacteria 54316
150 Ga0207676_10008062 3300026095 Bacteria 7488
151 Ga0207675_100092280 3300026118 Bacteria 2848
152 Ga0209371_1000294 3300027312 Bacteria 56307
153 Ga0268266_10000062 3300028379 Bacteria 253490
154 Ga0268266_10004837 3300028379 Bacteria 12790
155 Ga0268266_10288763 3300028379 Bacteria 1527
156 Ga0268265_10063902 3300028380 Bacteria 2833
157 Ga0268264_10000361 3300028381 Bacteria 67632
158 Ga0268264_10006079 3300028381 Bacteria 10200
159 Ga0268264_10048544 3300028381 Bacteria 3531
160 Ga0265338_10035662 3300028800 Bacteria 4774
161 Ga0268256_1000258 3300030500 Bacteria 56249
162 Ga0307511_10031864 3300030521 Bacteria 4700
163 Ga0265327_10012156 3300031251 Bacteria 5840
164 Ga0307513_10002328 3300031456 Bacteria 26445
165 Ga0307513_10003571 3300031456 Bacteria 21043
166 Ga0265314_10117064 3300031711 Bacteria 1684
167 Ga0307516_10000042 3300031730 Bacteria 142687
168 Ga0307414_10359545 3300032004 Bacteria 1252
169 Ga0307510_10006879 3300033180 Bacteria 13571
170 Ga0373936_0003176 3300035113 Bacteria 6152
171 Ga0373927_0000964 3300035695 Bacteria 21888
172 Ga0373925_0000895 3300037068 Bacteria 27228
173 Ga0373925_0079906 3300037068 Bacteria 2485
174 Ga0395899_0000710 3300037312 Bacteria 33413
175 Ga0395900_0000016 3300037418 Bacteria 382407
176 Ga0395900_0018603 3300037418 Bacteria 7085
177 Ga0395900_0391602 3300037418 Bacteria 1355
178 Ga0395898_0015311 3300037466 Bacteria 7869
179 Ga0395905_0033423 3300037471 Bacteria 4831
180 Ga0395905_0043734 3300037471 Bacteria 4201
181 Ga0395905_0052958 3300037471 Bacteria 3799
182 Ga0395905_0054468 3300037471 Bacteria 3743
183 Ga0395905_0211501 3300037471 Bacteria 1817
184 Ga0395901_0000028 3300038443 Bacteria 242653
185 Ga0395901_0103802 3300038443 Bacteria 2982
186 Ga0395901_0196074 3300038443 Bacteria 2117
187 Ga0436361_0923429 3300039447 Bacteria 2289
188 Ga0439436_0010779 3300041404 Bacteria 2785
189 Ga0439465_0002399 3300041413 Bacteria 6135
190 Ga0439465_0022810 3300041413 Bacteria 1967
191 Ga0439445_0010663 3300042004 Bacteria 2179
192 Ga0439449_0000054 3300042007 Bacteria 34695
193 Ga0495629_0013753 3300046459 Bacteria 5839
194 Ga0495620_0024006 3300046515 Bacteria 2906
195 Ga0495642_0037666 3300046528 Bacteria 1957
196 Ga0495622_0004361 3300046557 Bacteria 6588
197 Ga0495611_0088593 3300046648 Bacteria 1429
198 Ga0495625_0028283 3300046660 Bacteria 4206
199 Ga0495624_0147082 3300046690 Bacteria 1442
200 Ga0495681_0073271 3300047470 Bacteria 1547
201 Ga0496100_0146486 3300048903 Bacteria 1680
202 Ga0496102_0074701 3300048905 Bacteria 3116
203 Ga0496103_0055512 3300048906 Bacteria 2457
204 Ga0496114_0012813 3300048917 Bacteria 6713
205 Ga0496115_0007324 3300048918 Bacteria 8116
206 Ga0496115_0010380 3300048918 Bacteria 6958
207 Ga0496117_0006181 3300048920 Bacteria 12219
208 Ga0496117_0050604 3300048920 Bacteria 2945
209 Ga0496118_0006260 3300048921 Bacteria 13160
210 Ga0496118_0012788 3300048921 Bacteria 8013
211 Ga0496119_0000561 3300048922 Bacteria 50104
212 Ga0496119_0010818 3300048922 Bacteria 7636
213 Ga0496120_0000682 3300048923 Bacteria 49890
214 Ga0496121_0000053 3300048924 Bacteria 312611
215 Ga0496122_0001277 3300048925 Bacteria 41880
216 Ga0496123_0000752 3300048926 Bacteria 52435
217 Ga0496124_0003779 3300048927 Bacteria 18184
218 Ga0496126_0037606 3300048929 Bacteria 4515
219 Ga0496126_0117827 3300048929 Bacteria 2306
220 Ga0501033_0022550 3300049570 Bacteria 4750
221 Ga0501033_0068341 3300049570 Bacteria 2612
222 Ga0501033_0143412 3300049570 Bacteria 1726
223 Ga0501034_0008451 3300049571 Bacteria 10874
224 Ga0501034_0349515 3300049571 Bacteria 1407
225 Ga0501037_0225733 3300049573 Bacteria 1316
226 Ga0501043_0033144 3300049579 Bacteria 4063
227 Ga0501043_0190827 3300049579 Bacteria 1593
228 Ga0501047_0241853 3300049581 Bacteria 1655
229 Ga0501047_0248481 3300049581 Bacteria 1627
230 Ga0501048_0067673 3300049582 Bacteria 2524
231 Ga0501073_0020612 3300049589 Bacteria 4754
232 Ga0501225_0000451 3300049705 Bacteria 12848
233 Ga0501035_0098378 3300049822 Bacteria 2568
234 Ga0501044_0001630 3300049823 Bacteria 26311
235 Ga0501044_0040640 3300049823 Bacteria 4846
236 Ga0501044_0171270 3300049823 Bacteria 2142
237 Ga0501044_0256079 3300049823 Bacteria 1689
238 nmdc:mga00v17_15794_c1 3300050491 Bacteria 4245
239 nmdc:mga06z11_102880_c1 3300050494 Bacteria 1570
240 nmdc:mga04h51_12850_c1 3300050495 Bacteria 2359
241 nmdc:mga07m45_5477_c1 3300050496 Bacteria 6321
242 Ga0500635_0000085 3300053080 Bacteria 59878
243 Ga0500647_0036569 3300053091 Bacteria 2348
244 Ga0500583_0135777 3300053092 Bacteria 1221
245 Ga0500651_0004168 3300053093 Bacteria 8061
246 Ga0500566_0006076 3300053094 Bacteria 7178
247 Ga0500641_0001894 3300053096 Bacteria 7430
248 Ga0500555_002775 3300053103 Bacteria 5025
249 Ga0500562_000501 3300053108 Bacteria 9535
250 Ga0500569_001292 3300053109 Bacteria 4674
251 Ga0500595_003747 3300053119 Bacteria 7003
252 Ga0500614_003640 3300053123 Bacteria 3308
253 Ga0500559_0016002 3300053136 Bacteria 3167
254 Ga0500590_024275 3300053148 Bacteria 3146
255 Ga0500619_000660 3300053154 Bacteria 5860
256 Ga0500624_014143 3300053157 Bacteria 1203
257 Ga0500637_0140941 3300053178 Bacteria 1395
258 Ga0500645_016044 3300053730 Bacteria 2364
259 Ga0500596_000560 3300053735 Bacteria 7063
260 Ga0501082_0009056 3300060353 Bacteria 8586
261 Ga0501082_0123091 3300060353 Bacteria 2249
262 Ga0501082_0129783 3300060353 Bacteria 2187
263 2643906264 2643221579 Bacteria 4443405
264 2643915284 2643221581 Bacteria 3893603
265 2819660582 2818991457 Bacteria 5323295
266 2852688885 2852684882 Bacteria 5463342
267 2919130142 2919130084 Bacteria 5301837
268 2923519166 2923516293 Bacteria 3716336
269 2929198860 2929195423 Bacteria 5325372
270 8002869546 8002869464 Bacteria 3588529
271 Ga0207696_1027147
272 Ga0055536_1008936
273 Ga0055530_10000014
274 Ga0055531_10002725
275 Ga0058692_1000156
276 Ga0055543_1007335
277 Ga0065165_1001235
278 Ga0065704_10070660
279 Ga0070658_10012246
280 Ga0070670_100000246
281 Ga0070670_100017416
282 Ga0070670_100033451
283 Ga0070666_10025301
284 Ga0070666_10159409
285 Ga0070680_100000322
286 Ga0070660_100019594
287 Ga0070660_100028298
288 Ga0070668_100005544
289 Ga0070668_100011764
290 Ga0070668_100020270
291 Ga0070671_100001249
292 Ga0070659_100000808
293 Ga0070659_100005973
294 Ga0070667_100000206
295 Ga0070667_100002655
296 Ga0070667_100008154
297 Ga0070667_100021179
298 Ga0070663_100078444
299 Ga0070681_10008733
300 Ga0070681_10054794
301 Ga0070679_100004595
302 Ga0070679_100255479
303 Ga0070665_100000183
304 Ga0070665_100003684
305 Ga0068855_100013035
306 Ga0068855_100027545
307 Ga0068855_100058009
308 Ga0068855_100123938
309 Ga0070664_100004468
310 Ga0068859_100001200
311 Ga0068859_100012401
312 Ga0068864_100004293
313 Ga0068864_100010922
314 Ga0068864_100049605
315 Ga0068863_100000023
316 Ga0068863_100000562
317 Ga0068863_100001912
318 Ga0068863_100141224
319 Ga0068863_100264395
320 Ga0068863_100420107
321 Ga0068858_100000322
322 Ga0068858_100024774
323 Ga0068858_100127984
324 Ga0068858_100180874
325 Ga0068860_100002136
326 Ga0068860_100002815
327 Ga0068860_100034157
328 Ga0068862_100000445
329 Ga0068862_100037519
330 Ga0075365_10080415
331 Ga0075368_10005369
332 Ga0075364_10019701
333 Ga0075367_10001045
334 Ga0075370_10051555
335 Ga0097620_100001200
336 Ga0097620_100012401
337 Ga0079104_1011184
338 Ga0105251_10000512
339 Ga0105250_10037060
340 Ga0105240_10002841
341 Ga0105240_10051155
342 Ga0105240_10339715
343 Ga0105240_10374145
344 Ga0105240_10560413
345 Ga0105247_10021044
346 Ga0105243_10003890
347 Ga0105248_10000125
348 Ga0105248_10003711
349 Ga0105248_10004666
350 Ga0105248_10041283
351 Ga0105248_10041634
352 Ga0105238_10018406
353 Ga0105238_10027478
354 Ga0105238_10063736
355 Ga0105249_10027890
356 Ga0157373_10021651
357 Ga0157373_10032707
358 Ga0157369_10051662
359 Ga0163162_10282800
360 Ga0163163_10005186
361 Ga0163163_10042855
362 Ga0157379_10014984
363 Ga0157379_10059696
364 Ga0209026_1005635
365 Ga0209148_1003646
366 Ga0209676_1000156
367 Ga0209758_1000817
368 Ga0209050_1000034
369 Ga0209257_1000052
370 Ga0209257_1001468
371 Ga0207713_1000576
372 Ga0207710_10079028
373 Ga0207680_10070482
374 Ga0207705_10005918
375 Ga0207707_10002280
376 Ga0207707_10021399
377 Ga0207695_10004342
378 Ga0207695_10022391
379 Ga0207695_10032707
380 Ga0207695_10039308
381 Ga0207660_10003636
382 Ga0207657_10046050
383 Ga0207657_10160670
384 Ga0207652_10005270
385 Ga0207694_10032436
386 Ga0207694_10088929
387 Ga0207694_10095303
388 Ga0207694_10252231
389 Ga0207650_10000031
390 Ga0207650_10005033
391 Ga0207644_10002064
392 Ga0207690_10000307
393 Ga0207690_10017017
394 Ga0207709_10002649
395 Ga0207711_10000728
396 Ga0207711_10002777
397 Ga0207711_10012936
398 Ga0207679_10065774
399 Ga0207667_10006701
400 Ga0207667_10018872
401 Ga0207667_10082776
402 Ga0207712_10015205
403 Ga0207668_10001289
404 Ga0207668_10005052
405 Ga0207668_10007519
406 Ga0207658_10001519
407 Ga0207658_10016980
408 Ga0207658_10046492
409 Ga0207658_10067669
410 Ga0207703_10000532
411 Ga0207703_10003504
412 Ga0207703_10076841
413 Ga0207703_10101705
414 Ga0207678_10236423
415 Ga0207641_10000286
416 Ga0207641_10000697
417 Ga0207641_10010912
418 Ga0207641_10258247
419 Ga0207676_10000188
420 Ga0207676_10008062
421 Ga0207675_100092280
422 Ga0209371_1000294
423 Ga0268266_10000062
424 Ga0268266_10004837
425 Ga0268266_10288763
426 Ga0268265_10063902
427 Ga0268264_10000361
428 Ga0268264_10006079
429 Ga0268264_10048544
430 Ga0265338_10035662
431 Ga0268256_1000258
432 Ga0307511_10031864
433 Ga0265327_10012156
434 Ga0307513_10002328
435 Ga0307513_10003571
436 Ga0265314_10117064
437 Ga0307516_10000042
438 Ga0307414_10359545
439 Ga0307510_10006879
440 Ga0373936_0003176
441 Ga0373927_0000964
442 Ga0373925_0000895
443 Ga0373925_0079906
444 Ga0395899_0000710
445 Ga0395900_0000016
446 Ga0395900_0018603
447 Ga0395900_0391602
448 Ga0395898_0015311
449 Ga0395905_0033423
450 Ga0395905_0043734
451 Ga0395905_0052958
452 Ga0395905_0054468
453 Ga0395905_0211501
454 Ga0395901_0000028
455 Ga0395901_0103802
456 Ga0395901_0196074
457 Ga0436361_0923429
458 Ga0439436_0010779
459 Ga0439465_0002399
460 Ga0439465_0022810
461 Ga0439445_0010663
462 Ga0439449_0000054
463 Ga0495629_0013753
464 Ga0495620_0024006
465 Ga0495642_0037666
466 Ga0495622_0004361
467 Ga0495611_0088593
468 Ga0495625_0028283
469 Ga0495624_0147082
470 Ga0495681_0073271
471 Ga0496100_0146486
472 Ga0496102_0074701
473 Ga0496103_0055512
474 Ga0496114_0012813
475 Ga0496115_0007324
476 Ga0496115_0010380
477 Ga0496117_0006181
478 Ga0496117_0050604
479 Ga0496118_0006260
480 Ga0496118_0012788
481 Ga0496119_0000561
482 Ga0496119_0010818
483 Ga0496120_0000682
484 Ga0496121_0000053
485 Ga0496122_0001277
486 Ga0496123_0000752
487 Ga0496124_0003779
488 Ga0496126_0037606
489 Ga0496126_0117827
490 Ga0501033_0022550
491 Ga0501033_0068341
492 Ga0501033_0143412
493 Ga0501034_0008451
494 Ga0501034_0349515
495 Ga0501037_0225733
496 Ga0501043_0033144
497 Ga0501043_0190827
498 Ga0501047_0241853
499 Ga0501047_0248481
500 Ga0501048_0067673
501 Ga0501073_0020612
502 Ga0501225_0000451
503 Ga0501035_0098378
504 Ga0501044_0001630
505 Ga0501044_0040640
506 Ga0501044_0171270
507 Ga0501044_0256079
508 nmdc:mga00v17_15794_c1
509 nmdc:mga06z11_102880_c1
510 nmdc:mga04h51_12850_c1
511 nmdc:mga07m45_5477_c1
512 Ga0500635_0000085
513 Ga0500647_0036569
514 Ga0500583_0135777
515 Ga0500651_0004168
516 Ga0500566_0006076
517 Ga0500641_0001894
518 Ga0500555_002775
519 Ga0500562_000501
520 Ga0500569_001292
521 Ga0500595_003747
522 Ga0500614_003640
523 Ga0500559_0016002
524 Ga0500590_024275
525 Ga0500619_000660
526 Ga0500624_014143
527 Ga0500637_0140941
528 Ga0500645_016044
529 Ga0500596_000560
530 Ga0501082_0009056
531 Ga0501082_0123091
532 Ga0501082_0129783
533 2643906264
534 2643915284
535 2819660582
536 2852688885
537 2919130142
538 2923519166
539 2929198860
540 8002869546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

65

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9536 1 237
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9409 3 220
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9277 3 237
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9235 3 237
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9221 3 221
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9711 1 220 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 1 220 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9657 1 219 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9641 3 239 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9591 1 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382ZAC4-F1-model_v4 ABC transporter domain-containing protein 0.9751 2 213 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A528M0S6-F1-model_v4 ABC transporter ATP-binding protein 0.9741 2 200 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9722 1 155 GO:0005524
GO:0016887
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9722 3 158 GO:0005524
GO:0016887
AF-A0A534HSD0-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9661 3 221 GO:0005524
GO:0016887

Map