F377013

General Info

Members Datasets Scaffolds Average Seq Length
270 160 540 248

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10397426|Ga0207640_103974261
Length 268
Sequence VFEGCGLLFLIRRYLSLITNHSMEKAITAEKLSKRFGAFTAVDEISFEVEKGEIFGFLGANGAGKTTAIRMLCGLSLPTSGKATVAGFDVFRENEKIKKNIGYMSQKFSLYEDLTVKENIRFYAGIYGMTDSYIRDQTISLLKQLHMEKEANLLVKSLPLGWKQKLAFSVAIFHHPKIVFLDEPTGGVDPVTRREFWIMIYEAAASGITVFVTTHYMDEAEYCNRVSIMVDGKIEALDSPGGLRKRFNAASMDDVFLKLARKATRSEV

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
155 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
156 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
157 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
158 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
159 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
160 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 0
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10397426 3300025981 Bacteria 1121
2 SwRhRL2b_contig_449108 2162886007 Bacteria 1827
3 rootH2_10006910 3300003320 Bacteria 14945
4 rootH2_10072708 3300003320 Bacteria 30934
5 rootL2_10032084 3300003322 Bacteria 14316
6 rootL2_10108747 3300003322 Bacteria 13225
7 rootL2_10224709 3300003322 Bacteria 2330
8 rootH1_10011906 3300003323 Bacteria 17140
9 rootH1_10059685 3300003323 Bacteria 20803
10 rootH1_10068010 3300003323 Bacteria 13848
11 Ga0065714_10156490 3300005288 Bacteria 1075
12 Ga0065704_10071719 3300005289 Bacteria 10104
13 Ga0065704_10107451 3300005289 Bacteria 2055
14 Ga0065712_10003559 3300005290 Bacteria 3652
15 Ga0065712_10003882 3300005290 Bacteria 3480
16 Ga0065712_10122019 3300005290 Bacteria 1657
17 Ga0065715_10112754 3300005293 Bacteria 2517
18 Ga0070658_10059816 3300005327 Bacteria 3102
19 Ga0070676_10174996 3300005328 Unclassified 1391
20 Ga0070683_100045843 3300005329 Bacteria 4036
21 Ga0070683_100422780 3300005329 Bacteria 1271
22 Ga0070670_100045621 3300005331 Bacteria 3768
23 Ga0070670_100052471 3300005331 Bacteria 3502
24 Ga0068869_100051001 3300005334 Bacteria 3001
25 Ga0068869_100079522 3300005334 Bacteria 2443
26 Ga0070666_10024006 3300005335 Bacteria 3971
27 Ga0070680_100246458 3300005336 Bacteria 1510
28 Ga0070680_100281513 3300005336 Bacteria 1409
29 Ga0068868_100579538 3300005338 Bacteria 992
30 Ga0070660_100042442 3300005339 Bacteria 3471
31 Ga0070660_100121560 3300005339 Bacteria 2084
32 Ga0070689_100005552 3300005340 Bacteria 8626
33 Ga0070661_100246336 3300005344 Bacteria 1378
34 Ga0070669_100142253 3300005353 Bacteria 1850
35 Ga0070675_100038109 3300005354 Bacteria 3917
36 Ga0070675_100069281 3300005354 Bacteria 2922
37 Ga0070675_100875220 3300005354 Bacteria 823
38 Ga0070673_100015640 3300005364 Bacteria 5336
39 Ga0070673_100201860 3300005364 Bacteria 1712
40 Ga0070673_100509081 3300005364 Bacteria 1090
41 Ga0070673_100538544 3300005364 Bacteria 1059
42 Ga0070700_100118306 3300005441 Bacteria 1772
43 Ga0070662_100035067 3300005457 Bacteria 3541
44 Ga0070681_10218468 3300005458 Bacteria 1822
45 Ga0068867_100026406 3300005459 Bacteria 4170
46 Ga0068867_100043860 3300005459 Bacteria 3275
47 Ga0068867_100044291 3300005459 Bacteria 3260
48 Ga0068867_100189628 3300005459 Bacteria 1640
49 Ga0068867_100361077 3300005459 Bacteria 1215
50 Ga0070685_10046013 3300005466 Bacteria 2504
51 Ga0070679_100016413 3300005530 Bacteria 7141
52 Ga0070679_100060368 3300005530 Bacteria 3779
53 Ga0070679_100648559 3300005530 Bacteria 998
54 Ga0070684_100339862 3300005535 Bacteria 1380
55 Ga0070684_100512850 3300005535 Bacteria 1111
56 Ga0068855_100093294 3300005563 Bacteria 3471
57 Ga0068855_100147476 3300005563 Bacteria 2677
58 Ga0070664_100021517 3300005564 Bacteria 5316
59 Ga0070664_100267950 3300005564 Bacteria 1538
60 Ga0068857_100370205 3300005577 Bacteria 1329
61 Ga0068854_100260727 3300005578 Bacteria 1388
62 Ga0068856_100014270 3300005614 Bacteria 7682
63 Ga0070702_100037384 3300005615 Bacteria 2696
64 Ga0070702_100168862 3300005615 Bacteria 1421
65 Ga0068852_100004584 3300005616 Bacteria 9786
66 Ga0068852_100310666 3300005616 Bacteria 1528
67 Ga0068852_100543847 3300005616 Bacteria 1161
68 Ga0068859_100083833 3300005617 Bacteria 3231
69 Ga0068859_101202391 3300005617 Bacteria 835
70 Ga0068864_100394855 3300005618 Bacteria 1313
71 Ga0068861_100003722 3300005719 Bacteria 10171
72 Ga0068861_100067004 3300005719 Bacteria 2769
73 Ga0068861_100084504 3300005719 Bacteria 2492
74 Ga0068861_100646131 3300005719 Bacteria 977
75 Ga0068851_10069679 3300005834 Bacteria 1817
76 Ga0068870_10018783 3300005840 Bacteria 3343
77 Ga0068870_10390730 3300005840 Bacteria 903
78 Ga0068858_100200067 3300005842 Bacteria 1889
79 Ga0068858_100254162 3300005842 Bacteria 1670
80 Ga0068860_100264020 3300005843 Bacteria 1679
81 Ga0068860_100292596 3300005843 Bacteria 1594
82 Ga0068860_100396900 3300005843 Bacteria 1364
83 Ga0068860_100455156 3300005843 Bacteria 1273
84 Ga0068862_100001846 3300005844 Bacteria 19205
85 Ga0068862_100348326 3300005844 Bacteria 1374
86 Ga0075366_10015555 3300006195 Bacteria 4364
87 Ga0075366_10256875 3300006195 Bacteria 1066
88 Ga0068871_100284508 3300006358 Bacteria 1447
89 Ga0097620_100083839 3300006931 Bacteria 3231
90 Ga0097620_101202446 3300006931 Bacteria 835
91 Ga0111539_10030939 3300009094 Bacteria 6504
92 Ga0105247_10001960 3300009101 Bacteria 14314
93 Ga0105243_10086995 3300009148 Bacteria 2564
94 Ga0105242_10097719 3300009176 Bacteria 2483
95 Ga0105242_10414254 3300009176 Bacteria 1261
96 Ga0105249_10010218 3300009553 Bacteria 8243
97 Ga0105249_10248796 3300009553 Bacteria 1761
98 Ga0105239_10108087 3300010375 Bacteria 3082
99 Ga0105239_10886688 3300010375 Bacteria 1024
100 Ga0157373_10112275 3300013100 Bacteria 1916
101 Ga0157373_10390612 3300013100 Bacteria 996
102 Ga0157373_10411597 3300013100 Bacteria 970
103 Ga0157373_10438423 3300013100 Bacteria 939
104 Ga0157371_10235921 3300013102 Bacteria 1315
105 Ga0157370_10000263 3300013104 Bacteria 66700
106 Ga0157370_10040110 3300013104 Bacteria 4521
107 Ga0157370_10300908 3300013104 Bacteria 1481
108 Ga0157370_10360536 3300013104 Bacteria 1340
109 Ga0157370_10521452 3300013104 Bacteria 1090
110 Ga0157369_10018964 3300013105 Bacteria 7705
111 Ga0157369_10143018 3300013105 Bacteria 2530
112 Ga0157374_10093860 3300013296 Bacteria 2866
113 Ga0157374_10303341 3300013296 Bacteria 1580
114 Ga0157378_10070192 3300013297 Bacteria 3145
115 Ga0157378_10265627 3300013297 Bacteria 1648
116 Ga0163162_10008228 3300013306 Bacteria 10180
117 Ga0163162_10522511 3300013306 Bacteria 1316
118 Ga0157372_10179954 3300013307 Bacteria 2447
119 Ga0157372_10251374 3300013307 Bacteria 2052
120 Ga0157372_10382191 3300013307 Bacteria 1641
121 Ga0157372_10389715 3300013307 Bacteria 1623
122 Ga0157372_10545156 3300013307 Bacteria 1352
123 Ga0157372_10547575 3300013307 Bacteria 1349
124 Ga0157372_10593173 3300013307 Bacteria 1291
125 Ga0157372_10779968 3300013307 Bacteria 1111
126 Ga0157372_10943697 3300013307 Bacteria 1000
127 Ga0157375_10020661 3300013308 Bacteria 6020
128 Ga0157375_10249320 3300013308 Bacteria 1936
129 Ga0157375_10367105 3300013308 Bacteria 1606
130 Ga0163163_10012099 3300014325 Bacteria 7852
131 Ga0163163_10266199 3300014325 Bacteria 1765
132 Ga0157380_10000038 3300014326 Bacteria 78487
133 Ga0157380_10190878 3300014326 Bacteria 1808
134 Ga0157377_10003612 3300014745 Bacteria 7007
135 Ga0157377_10229918 3300014745 Bacteria 1192
136 Ga0209050_1011973 3300025298 Bacteria 4039
137 Ga0207697_10049929 3300025315 Bacteria 1727
138 Ga0207710_10000402 3300025900 Bacteria 28743
139 Ga0207688_10044351 3300025901 Bacteria 2478
140 Ga0207647_10341810 3300025904 Bacteria 848
141 Ga0207643_10008516 3300025908 Bacteria 5501
142 Ga0207705_10018203 3300025909 Bacteria 5022
143 Ga0207707_10488224 3300025912 Bacteria 1051
144 Ga0207660_10414270 3300025917 Bacteria 1086
145 Ga0207657_10011684 3300025919 Bacteria 8701
146 Ga0207657_10040619 3300025919 Unclassified 4120
147 Ga0207657_10047393 3300025919 Bacteria 3758
148 Ga0207652_10003426 3300025921 Bacteria 13089
149 Ga0207652_10244354 3300025921 Bacteria 1618
150 Ga0207650_10011970 3300025925 Bacteria 5980
151 Ga0207650_10217565 3300025925 Bacteria 1536
152 Ga0207659_10035323 3300025926 Bacteria 3454
153 Ga0207659_10558919 3300025926 Bacteria 973
154 Ga0207644_10030541 3300025931 Bacteria 3749
155 Ga0207644_10164578 3300025931 Bacteria 1727
156 Ga0207706_10038970 3300025933 Bacteria 4215
157 Ga0207686_10272489 3300025934 Bacteria 1246
158 Ga0207670_10106031 3300025936 Bacteria 2015
159 Ga0207669_10104826 3300025937 Bacteria 1879
160 Ga0207689_10022557 3300025942 Bacteria 5290
161 Ga0207689_10063044 3300025942 Bacteria 3049
162 Ga0207689_10503458 3300025942 Bacteria 1015
163 Ga0207661_10068137 3300025944 Bacteria 2897
164 Ga0207679_10310507 3300025945 Bacteria 1362
165 Ga0207679_10314481 3300025945 Bacteria 1354
166 Ga0207679_10430395 3300025945 Bacteria 1166
167 Ga0207667_10126177 3300025949 Bacteria 2636
168 Ga0207712_10098223 3300025961 Bacteria 2171
169 Ga0207668_10029317 3300025972 Bacteria 3607
170 Ga0207640_10208624 3300025981 Bacteria 1486
171 Ga0207677_10124763 3300026023 Bacteria 1944
172 Ga0207677_10400013 3300026023 Bacteria 1164
173 Ga0207703_10161075 3300026035 Bacteria 1965
174 Ga0207703_10310194 3300026035 Bacteria 1442
175 Ga0207639_10062835 3300026041 Bacteria 2873
176 Ga0207702_10156912 3300026078 Bacteria 2075
177 Ga0207641_10344297 3300026088 Bacteria 1419
178 Ga0207641_10589184 3300026088 Bacteria 1088
179 Ga0207648_10001472 3300026089 Bacteria 25920
180 Ga0207648_10314652 3300026089 Bacteria 1406
181 Ga0207648_10316426 3300026089 Bacteria 1402
182 Ga0207676_10094143 3300026095 Bacteria 2468
183 Ga0207674_10085805 3300026116 Bacteria 3143
184 Ga0207674_10086903 3300026116 Bacteria 3121
185 Ga0207674_10250443 3300026116 Bacteria 1718
186 Ga0207674_10606747 3300026116 Bacteria 1057
187 Ga0207674_10717096 3300026116 Bacteria 965
188 Ga0207675_100000326 3300026118 Bacteria 45358
189 Ga0207675_100088494 3300026118 Bacteria 2909
190 Ga0207675_100138665 3300026118 Bacteria 2309
191 Ga0207675_100565476 3300026118 Bacteria 1137
192 Ga0207675_100790663 3300026118 Bacteria 962
193 Ga0207683_10270054 3300026121 Bacteria 1553
194 Ga0207698_10228438 3300026142 Bacteria 1687
195 Ga0209974_10053888 3300027876 Bacteria 1355
196 Ga0268265_10306369 3300028380 Bacteria 1432
197 Ga0268265_10462583 3300028380 Bacteria 1187
198 Ga0268264_10049534 3300028381 Bacteria 3495
199 Ga0265324_10078425 3300029957 Bacteria 1124
200 Ga0265339_10075301 3300031249 Bacteria 1792
201 Ga0265316_10004228 3300031344 Bacteria 14342
202 Ga0307513_10032496 3300031456 Bacteria 5883
203 Ga0307408_100000389 3300031548 Bacteria 40047
204 Ga0316575_10001864 3300031665 Bacteria 6936
205 Ga0265342_10000260 3300031712 Bacteria 59291
206 Ga0307412_10096152 3300031911 Bacteria 2084
207 Ga0373937_0413784 3300036401 Bacteria 1279
208 Ga0451853_3770812 3300041512 Bacteria 1326
209 Ga0439431_0004255 3300041997 Bacteria 3142
210 Ga0450923_000172 3300042125 Bacteria 6008
211 Ga0451577_0080423 3300042876 Bacteria 2906
212 Ga0451577_0557572 3300042876 Bacteria 1040
213 Ga0466972_0008769 3300044658 Bacteria 5072
214 Ga0466982_0038491 3300044672 Bacteria 2884
215 Ga0466965_0079538 3300044683 Bacteria 1656
216 Ga0466964_0073064 3300044706 Bacteria 1455
217 Ga0453684_0001177 3300044712 Bacteria 81167
218 Ga0453684_0024925 3300044712 Bacteria 8709
219 Ga0453684_0102698 3300044712 Bacteria 3495
220 Ga0453684_0206583 3300044712 Bacteria 2285
221 Ga0453684_0399824 3300044712 Bacteria 1539
222 Ga0466970_0034855 3300044765 Bacteria 2665
223 Ga0466960_0256447 3300044901 Bacteria 973
224 Ga0451576_0051766 3300045051 Bacteria 4305
225 Ga0451576_0286026 3300045051 Bacteria 1724
226 Ga0451576_0419380 3300045051 Bacteria 1404
227 Ga0466967_0030803 3300045976 Bacteria 4506
228 Ga0495638_0000121 3300046460 Bacteria 126440
229 Ga0495668_0001412 3300046616 Bacteria 23403
230 Ga0495625_0197916 3300046660 Bacteria 1328
231 Ga0495625_0296788 3300046660 Bacteria 1035
232 Ga0495674_0250125 3300047319 Bacteria 1459
233 Ga0495672_0010073 3300047320 Bacteria 6766
234 Ga0495672_0027491 3300047320 Bacteria 3614
235 Ga0495686_0010384 3300047472 Bacteria 6628
236 Ga0501031_0092582 3300049568 Bacteria 1972
237 Ga0501032_0146848 3300049569 Bacteria 1552
238 Ga0501034_0000410 3300049571 Bacteria 72148
239 Ga0501034_0261489 3300049571 Bacteria 1673
240 Ga0501036_0092754 3300049572 Bacteria 2551
241 Ga0501037_0076590 3300049573 Bacteria 2428
242 Ga0501038_0140087 3300049574 Bacteria 1979
243 Ga0501039_0021533 3300049575 Bacteria 4944
244 Ga0501043_0015489 3300049579 Bacteria 5973
245 Ga0501043_0207202 3300049579 Bacteria 1520
246 Ga0501070_0022775 3300049586 Bacteria 5244
247 Ga0501221_081651 3300049704 Bacteria 779
248 Ga0501035_0107318 3300049822 Bacteria 2448
249 Ga0501035_0473145 3300049822 Bacteria 1034
250 Ga0501044_0012233 3300049823 Bacteria 9292
251 Ga0501044_0097796 3300049823 Bacteria 2956
252 Ga0501044_0211579 3300049823 Bacteria 1893
253 Ga0501284_00021 3300050005 Bacteria 89729
254 nmdc:mga0k408_5067_c1 3300050493 Bacteria 6981
255 Ga0500578_0000150 3300053086 Bacteria 83541
256 Ga0500583_0040426 3300053092 Bacteria 2113
257 Ga0500641_0024124 3300053096 Bacteria 2343
258 Ga0500616_0000004 3300053153 Bacteria 1002714
259 Ga0500616_0043042 3300053153 Bacteria 2415
260 Ga0500611_000006 3300053727 Bacteria 226069
261 Ga0500645_034285 3300053730 Bacteria 1516
262 Ga0500645_060690 3300053730 Bacteria 1094
263 Ga0501082_0302198 3300060353 Bacteria 1394
264 2644009901 2643221600 Bacteria 5530138
265 2644369730 2643221667 Bacteria 5627472
266 2883071736 2883068021 Bacteria 6192739
267 2896088337 2896085136 Bacteria 6129793
268 2896111813 2896109856 Bacteria 7140722
269 2919192018 2919191525 Bacteria 5765973
270 8054310611 8054307821 Bacteria 5212224
271 Ga0207640_10397426
272 SwRhRL2b_contig_449108
273 rootH2_10006910
274 rootH2_10072708
275 rootL2_10032084
276 rootL2_10108747
277 rootL2_10224709
278 rootH1_10011906
279 rootH1_10059685
280 rootH1_10068010
281 Ga0065714_10156490
282 Ga0065704_10071719
283 Ga0065704_10107451
284 Ga0065712_10003559
285 Ga0065712_10003882
286 Ga0065712_10122019
287 Ga0065715_10112754
288 Ga0070658_10059816
289 Ga0070676_10174996
290 Ga0070683_100045843
291 Ga0070683_100422780
292 Ga0070670_100045621
293 Ga0070670_100052471
294 Ga0068869_100051001
295 Ga0068869_100079522
296 Ga0070666_10024006
297 Ga0070680_100246458
298 Ga0070680_100281513
299 Ga0068868_100579538
300 Ga0070660_100042442
301 Ga0070660_100121560
302 Ga0070689_100005552
303 Ga0070661_100246336
304 Ga0070669_100142253
305 Ga0070675_100038109
306 Ga0070675_100069281
307 Ga0070675_100875220
308 Ga0070673_100015640
309 Ga0070673_100201860
310 Ga0070673_100509081
311 Ga0070673_100538544
312 Ga0070700_100118306
313 Ga0070662_100035067
314 Ga0070681_10218468
315 Ga0068867_100026406
316 Ga0068867_100043860
317 Ga0068867_100044291
318 Ga0068867_100189628
319 Ga0068867_100361077
320 Ga0070685_10046013
321 Ga0070679_100016413
322 Ga0070679_100060368
323 Ga0070679_100648559
324 Ga0070684_100339862
325 Ga0070684_100512850
326 Ga0068855_100093294
327 Ga0068855_100147476
328 Ga0070664_100021517
329 Ga0070664_100267950
330 Ga0068857_100370205
331 Ga0068854_100260727
332 Ga0068856_100014270
333 Ga0070702_100037384
334 Ga0070702_100168862
335 Ga0068852_100004584
336 Ga0068852_100310666
337 Ga0068852_100543847
338 Ga0068859_100083833
339 Ga0068859_101202391
340 Ga0068864_100394855
341 Ga0068861_100003722
342 Ga0068861_100067004
343 Ga0068861_100084504
344 Ga0068861_100646131
345 Ga0068851_10069679
346 Ga0068870_10018783
347 Ga0068870_10390730
348 Ga0068858_100200067
349 Ga0068858_100254162
350 Ga0068860_100264020
351 Ga0068860_100292596
352 Ga0068860_100396900
353 Ga0068860_100455156
354 Ga0068862_100001846
355 Ga0068862_100348326
356 Ga0075366_10015555
357 Ga0075366_10256875
358 Ga0068871_100284508
359 Ga0097620_100083839
360 Ga0097620_101202446
361 Ga0111539_10030939
362 Ga0105247_10001960
363 Ga0105243_10086995
364 Ga0105242_10097719
365 Ga0105242_10414254
366 Ga0105249_10010218
367 Ga0105249_10248796
368 Ga0105239_10108087
369 Ga0105239_10886688
370 Ga0157373_10112275
371 Ga0157373_10390612
372 Ga0157373_10411597
373 Ga0157373_10438423
374 Ga0157371_10235921
375 Ga0157370_10000263
376 Ga0157370_10040110
377 Ga0157370_10300908
378 Ga0157370_10360536
379 Ga0157370_10521452
380 Ga0157369_10018964
381 Ga0157369_10143018
382 Ga0157374_10093860
383 Ga0157374_10303341
384 Ga0157378_10070192
385 Ga0157378_10265627
386 Ga0163162_10008228
387 Ga0163162_10522511
388 Ga0157372_10179954
389 Ga0157372_10251374
390 Ga0157372_10382191
391 Ga0157372_10389715
392 Ga0157372_10545156
393 Ga0157372_10547575
394 Ga0157372_10593173
395 Ga0157372_10779968
396 Ga0157372_10943697
397 Ga0157375_10020661
398 Ga0157375_10249320
399 Ga0157375_10367105
400 Ga0163163_10012099
401 Ga0163163_10266199
402 Ga0157380_10000038
403 Ga0157380_10190878
404 Ga0157377_10003612
405 Ga0157377_10229918
406 Ga0209050_1011973
407 Ga0207697_10049929
408 Ga0207710_10000402
409 Ga0207688_10044351
410 Ga0207647_10341810
411 Ga0207643_10008516
412 Ga0207705_10018203
413 Ga0207707_10488224
414 Ga0207660_10414270
415 Ga0207657_10011684
416 Ga0207657_10040619
417 Ga0207657_10047393
418 Ga0207652_10003426
419 Ga0207652_10244354
420 Ga0207650_10011970
421 Ga0207650_10217565
422 Ga0207659_10035323
423 Ga0207659_10558919
424 Ga0207644_10030541
425 Ga0207644_10164578
426 Ga0207706_10038970
427 Ga0207686_10272489
428 Ga0207670_10106031
429 Ga0207669_10104826
430 Ga0207689_10022557
431 Ga0207689_10063044
432 Ga0207689_10503458
433 Ga0207661_10068137
434 Ga0207679_10310507
435 Ga0207679_10314481
436 Ga0207679_10430395
437 Ga0207667_10126177
438 Ga0207712_10098223
439 Ga0207668_10029317
440 Ga0207640_10208624
441 Ga0207677_10124763
442 Ga0207677_10400013
443 Ga0207703_10161075
444 Ga0207703_10310194
445 Ga0207639_10062835
446 Ga0207702_10156912
447 Ga0207641_10344297
448 Ga0207641_10589184
449 Ga0207648_10001472
450 Ga0207648_10314652
451 Ga0207648_10316426
452 Ga0207676_10094143
453 Ga0207674_10085805
454 Ga0207674_10086903
455 Ga0207674_10250443
456 Ga0207674_10606747
457 Ga0207674_10717096
458 Ga0207675_100000326
459 Ga0207675_100088494
460 Ga0207675_100138665
461 Ga0207675_100565476
462 Ga0207675_100790663
463 Ga0207683_10270054
464 Ga0207698_10228438
465 Ga0209974_10053888
466 Ga0268265_10306369
467 Ga0268265_10462583
468 Ga0268264_10049534
469 Ga0265324_10078425
470 Ga0265339_10075301
471 Ga0265316_10004228
472 Ga0307513_10032496
473 Ga0307408_100000389
474 Ga0316575_10001864
475 Ga0265342_10000260
476 Ga0307412_10096152
477 Ga0373937_0413784
478 Ga0451853_3770812
479 Ga0439431_0004255
480 Ga0450923_000172
481 Ga0451577_0080423
482 Ga0451577_0557572
483 Ga0466972_0008769
484 Ga0466982_0038491
485 Ga0466965_0079538
486 Ga0466964_0073064
487 Ga0453684_0001177
488 Ga0453684_0024925
489 Ga0453684_0102698
490 Ga0453684_0206583
491 Ga0453684_0399824
492 Ga0466970_0034855
493 Ga0466960_0256447
494 Ga0451576_0051766
495 Ga0451576_0286026
496 Ga0451576_0419380
497 Ga0466967_0030803
498 Ga0495638_0000121
499 Ga0495668_0001412
500 Ga0495625_0197916
501 Ga0495625_0296788
502 Ga0495674_0250125
503 Ga0495672_0010073
504 Ga0495672_0027491
505 Ga0495686_0010384
506 Ga0501031_0092582
507 Ga0501032_0146848
508 Ga0501034_0000410
509 Ga0501034_0261489
510 Ga0501036_0092754
511 Ga0501037_0076590
512 Ga0501038_0140087
513 Ga0501039_0021533
514 Ga0501043_0015489
515 Ga0501043_0207202
516 Ga0501070_0022775
517 Ga0501221_081651
518 Ga0501035_0107318
519 Ga0501035_0473145
520 Ga0501044_0012233
521 Ga0501044_0097796
522 Ga0501044_0211579
523 Ga0501284_00021
524 nmdc:mga0k408_5067_c1
525 Ga0500578_0000150
526 Ga0500583_0040426
527 Ga0500641_0024124
528 Ga0500616_0000004
529 Ga0500616_0043042
530 Ga0500611_000006
531 Ga0500645_034285
532 Ga0500645_060690
533 Ga0501082_0302198
534 2644009901
535 2644369730
536 2883071736
537 2896088337
538 2896111813
539 2919192018
540 8054310611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

186

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

75

217

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.957 3 225
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9551 3 225
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9536 4 218
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9485 5 237
7e7o-assembly1.cif.gz_A cryo-em structure of human abca4 in nrpe-bound state 0.9408 3 226
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 3 224 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 2 230 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9571 6 227 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 1 243 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9541 2 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y2MRM8-F1-model_v4 ABC transporter ATP-binding protein 0.9885 1 240 GO:0005524
GO:0016887
AF-A0A4R2F7J7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9876 1 239 GO:0005524
GO:0016887
AF-A0A562PFS4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9861 3 110 GO:0005524
GO:0016887
AF-A0A428Z536-F1-model_v4 Transport permease protein 0.9808 3 226 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-A0A7V3NIK6-F1-model_v4 ABC transporter ATP-binding protein 0.9807 8 225 GO:0005524
GO:0016887

Map