F377296

General Info

Members Datasets Scaffolds Average Seq Length
270 155 540 166

Family's Representative Sequence

Representative Sequence 3300053157|Ga0500624_000135|Ga0500624_000135_2464_3042
Length 192
Sequence LIIINCPYKTRPIAARLFLTINKKIKMKTIKIFIIIFLLSVTAVKAQFTKAELQVSGLTCALCAKSTEKSLRTLPFISDIKTDLIRNVFILTFKNDVPVNFEQISKKVQGSGFSVNSLKATFNFDNTKIADNRFSYGGDTYKLLNAADKTLSGNVSLTIVDNGFAPKSVSKKYLGQVTDTAPASGRIYHLAI

Samples

Sample ID Description Type Environment
1 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
136 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
137 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
141 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
145 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
149 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
150 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
151 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
152 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
153 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
154 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
155 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 1.85
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 0.37
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500624_000135 3300053157 Bacteria 31636
2 JGI24740J21852_10018607 3300001979 Bacteria 2458
3 JGI24739J22299_10036423 3300001989 Bacteria 1662
4 JGI24739J22299_10105861 3300001989 Bacteria 846
5 JGI24739J22299_10214418 3300001989 Unclassified 564
6 JGI24737J22298_10000211 3300001990 Bacteria 19043
7 JGI24743J22301_10015820 3300001991 Bacteria 1402
8 JGI24735J21928_10000011 3300002067 Bacteria 217841
9 JGI24744J21845_10009357 3300002077 Bacteria 2010
10 JGI25162J39368_1000086 3300002737 Bacteria 107401
11 rootH1_10128277 3300003316 Bacteria 3266
12 rootH2_10000579 3300003320 Bacteria 178428
13 rootH2_10156055 3300003320 Bacteria 3466
14 rootH1_10033794 3300003323 Bacteria 2332
15 Ga0055529_1012391 3300003763 Bacteria 1091
16 Ga0058863_11009948 3300004799 Bacteria 2035
17 Ga0065714_10019082 3300005288 Bacteria 1534
18 Ga0065714_10066431 3300005288 Bacteria 6873
19 Ga0065714_10091796 3300005288 Bacteria 1898
20 Ga0065714_10156303 3300005288 Bacteria 1076
21 Ga0070658_10000069 3300005327 Bacteria 101140
22 Ga0070658_10043109 3300005327 Bacteria 3646
23 Ga0070658_10083928 3300005327 Bacteria 2619
24 Ga0070676_10000138 3300005328 Bacteria 28188
25 Ga0068869_100158390 3300005334 Bacteria 1761
26 Ga0070680_100063704 3300005336 Bacteria 3021
27 Ga0068868_100027027 3300005338 Bacteria 4376
28 Ga0070660_100186998 3300005339 Bacteria 1677
29 Ga0070660_101336808 3300005339 Bacteria 608
30 Ga0070671_100726840 3300005355 Bacteria 862
31 Ga0070673_100007603 3300005364 Bacteria 7169
32 Ga0070681_10002600 3300005458 Bacteria 16566
33 Ga0068867_100003760 3300005459 Bacteria 10683
34 Ga0070684_100224742 3300005535 Unclassified 1713
35 Ga0068853_100018241 3300005539 Bacteria 5806
36 Ga0068853_100034736 3300005539 Bacteria 4281
37 Ga0068853_100119832 3300005539 Unclassified 2346
38 Ga0068853_100393034 3300005539 Bacteria 1297
39 Ga0070665_100000017 3300005548 Bacteria 448013
40 Ga0068855_100000141 3300005563 Bacteria 92463
41 Ga0068855_100000489 3300005563 Bacteria 48884
42 Ga0068855_100012432 3300005563 Bacteria 10282
43 Ga0068855_100024915 3300005563 Bacteria 7158
44 Ga0068855_100058452 3300005563 Bacteria 4516
45 Ga0068855_100801779 3300005563 Bacteria 1001
46 Ga0068855_101307080 3300005563 Bacteria 750
47 Ga0068854_100049531 3300005578 Bacteria 3001
48 Ga0068856_100026783 3300005614 Bacteria 5622
49 Ga0068856_100104893 3300005614 Bacteria 2821
50 Ga0068856_100390018 3300005614 Bacteria 1412
51 Ga0068856_100422826 3300005614 Bacteria 1352
52 Ga0068856_101671656 3300005614 Bacteria 649
53 Ga0068852_100002521 3300005616 Bacteria 12616
54 Ga0068852_100508957 3300005616 Bacteria 1200
55 Ga0068866_10295470 3300005718 Bacteria 1009
56 Ga0068870_10227317 3300005840 Bacteria 1145
57 Ga0075366_10000026 3300006195 Bacteria 51752
58 Ga0075366_10000682 3300006195 Bacteria 16076
59 Ga0097621_100004042 3300006237 Bacteria 10175
60 Ga0075370_10231549 3300006353 Bacteria 1093
61 Ga0068871_100001920 3300006358 Bacteria 14064
62 Ga0068865_100000223 3300006881 Bacteria 31553
63 Ga0105240_10007283 3300009093 Bacteria 16106
64 Ga0105240_10021014 3300009093 Bacteria 8687
65 Ga0105240_10064747 3300009093 Bacteria 4541
66 Ga0105240_10200697 3300009093 Bacteria 2337
67 Ga0105240_10373561 3300009093 Bacteria 1611
68 Ga0105240_10410158 3300009093 Bacteria 1524
69 Ga0105240_10558999 3300009093 Bacteria 1265
70 Ga0105240_10585914 3300009093 Bacteria 1230
71 Ga0105240_11107456 3300009093 Bacteria 842
72 Ga0105241_10003752 3300009174 Bacteria 11269
73 Ga0105241_10059718 3300009174 Bacteria 2933
74 Ga0105241_10066239 3300009174 Unclassified 2793
75 Ga0105241_10136616 3300009174 Bacteria 1991
76 Ga0105242_10014530 3300009176 Bacteria 6100
77 Ga0105237_10000782 3300009545 Bacteria 43496
78 Ga0105237_10001513 3300009545 Bacteria 30535
79 Ga0105237_10019875 3300009545 Bacteria 6935
80 Ga0105237_10020293 3300009545 Bacteria 6854
81 Ga0105237_10034771 3300009545 Bacteria 5100
82 Ga0105237_10111105 3300009545 Bacteria 2732
83 Ga0105237_10138522 3300009545 Bacteria 2428
84 Ga0105237_10385459 3300009545 Bacteria 1406
85 Ga0105238_10005009 3300009551 Bacteria 13092
86 Ga0105238_10106396 3300009551 Bacteria 2787
87 Ga0105239_10001541 3300010375 Bacteria 30447
88 Ga0105239_10001835 3300010375 Bacteria 27813
89 Ga0105239_10011111 3300010375 Bacteria 10049
90 Ga0105239_10101425 3300010375 Bacteria 3184
91 Ga0105239_10204786 3300010375 Bacteria 2211
92 Ga0105239_10213232 3300010375 Bacteria 2165
93 Ga0105239_10825054 3300010375 Bacteria 1063
94 Ga0157370_10280585 3300013104 Bacteria 1539
95 Ga0157369_10031646 3300013105 Bacteria 5823
96 Ga0157374_10002377 3300013296 Bacteria 15856
97 Ga0157374_10004748 3300013296 Bacteria 11393
98 Ga0157374_10487183 3300013296 Unclassified 1237
99 Ga0157378_10078042 3300013297 Bacteria 2986
100 Ga0163162_10000071 3300013306 Bacteria 94831
101 Ga0163162_12061106 3300013306 Bacteria 654
102 Ga0157372_10021745 3300013307 Bacteria 6933
103 Ga0157372_10239394 3300013307 Bacteria 2105
104 Ga0157375_10005697 3300013308 Bacteria 10839
105 Ga0157376_10229057 3300014969 Bacteria 1725
106 Ga0157376_11082027 3300014969 Bacteria 827
107 Ga0163161_10021220 3300017792 Bacteria 4566
108 Ga0206350_11095099 3300020080 Bacteria 1461
109 Ga0209437_100144 3300025233 Bacteria 164794
110 Ga0209455_1002982 3300025272 Bacteria 6223
111 Ga0207642_10137956 3300025899 Bacteria 1282
112 Ga0207647_10004699 3300025904 Bacteria 10108
113 Ga0207645_10000956 3300025907 Bacteria 23938
114 Ga0207643_10271409 3300025908 Bacteria 1050
115 Ga0207705_10000032 3300025909 Bacteria 224376
116 Ga0207705_10452171 3300025909 Bacteria 996
117 Ga0207705_10840690 3300025909 Bacteria 712
118 Ga0207654_10006889 3300025911 Bacteria 5721
119 Ga0207654_10103356 3300025911 Bacteria 1759
120 Ga0207707_10020724 3300025912 Bacteria 5742
121 Ga0207695_10020575 3300025913 Bacteria 7554
122 Ga0207695_10101543 3300025913 Bacteria 2870
123 Ga0207695_10176899 3300025913 Bacteria 2056
124 Ga0207695_10365328 3300025913 Bacteria 1329
125 Ga0207671_10001617 3300025914 Bacteria 25642
126 Ga0207671_10003176 3300025914 Bacteria 16589
127 Ga0207671_10044807 3300025914 Bacteria 3271
128 Ga0207671_10081518 3300025914 Bacteria 2427
129 Ga0207671_10250452 3300025914 Bacteria 1392
130 Ga0207671_10274991 3300025914 Bacteria 1327
131 Ga0207660_10023487 3300025917 Bacteria 4165
132 Ga0207657_10051073 3300025919 Bacteria 3595
133 Ga0207649_11041735 3300025920 Bacteria 644
134 Ga0207652_10001318 3300025921 Bacteria 22041
135 Ga0207694_10057536 3300025924 Bacteria 3022
136 Ga0207686_10102926 3300025934 Bacteria 1910
137 Ga0207704_10000138 3300025938 Bacteria 39263
138 Ga0207667_10000030 3300025949 Bacteria 327226
139 Ga0207667_10000408 3300025949 Bacteria 58389
140 Ga0207667_10054795 3300025949 Bacteria 4194
141 Ga0207667_10701756 3300025949 Bacteria 1014
142 Ga0207667_10781020 3300025949 Bacteria 953
143 Ga0207667_10786694 3300025949 Unclassified 949
144 Ga0207651_10007781 3300025960 Bacteria 5731
145 Ga0207640_10043527 3300025981 Bacteria 2870
146 Ga0207677_10100700 3300026023 Bacteria 2125
147 Ga0207639_10011518 3300026041 Bacteria 6143
148 Ga0207639_10029246 3300026041 Bacteria 4032
149 Ga0207639_10136870 3300026041 Bacteria 2035
150 Ga0207639_10335681 3300026041 Bacteria 1346
151 Ga0207639_11523441 3300026041 Bacteria 627
152 Ga0207702_10008393 3300026078 Bacteria 8716
153 Ga0207702_10046459 3300026078 Bacteria 3655
154 Ga0207702_10228224 3300026078 Bacteria 1739
155 Ga0207702_10799109 3300026078 Unclassified 932
156 Ga0207648_10000495 3300026089 Bacteria 43912
157 Ga0207683_10152679 3300026121 Bacteria 2084
158 Ga0207698_10003110 3300026142 Bacteria 9958
159 Ga0268266_10000195 3300028379 Bacteria 105788
160 Ga0307517_10000212 3300028786 Bacteria 99215
161 Ga0307515_10001565 3300028794 Bacteria 51101
162 Ga0307515_10006038 3300028794 Bacteria 24361
163 Ga0307515_10292698 3300028794 Bacteria 1322
164 Ga0265338_10026555 3300028800 Bacteria 5836
165 Ga0307507_10000111 3300033179 Bacteria 134722
166 Ga0307510_10009321 3300033180 Bacteria 11695
167 Ga0373941_0044221 3300035115 Bacteria 1389
168 Ga0395899_0002293 3300037312 Bacteria 15606
169 Ga0395899_0676155 3300037312 Unclassified 650
170 Ga0395900_0001731 3300037418 Bacteria 25191
171 Ga0395900_1181397 3300037418 Bacteria 681
172 Ga0395898_0004986 3300037466 Bacteria 14394
173 Ga0395905_0000987 3300037471 Bacteria 36490
174 Ga0395905_0326835 3300037471 Bacteria 1424
175 Ga0395901_0000822 3300038443 Bacteria 34379
176 Ga0439445_0091195 3300042004 Bacteria 858
177 Ga0439448_0000331 3300042005 Bacteria 10524
178 Ga0466967_1428526 3300045976 Bacteria 689
179 Ga0495629_0167714 3300046459 Bacteria 1525
180 Ga0495638_0059069 3300046460 Bacteria 2376
181 Ga0495638_0180129 3300046460 Bacteria 1206
182 Ga0495651_0028091 3300046462 Bacteria 4385
183 Ga0495650_0000050 3300046471 Bacteria 318894
184 Ga0495605_0101726 3300046474 Bacteria 1320
185 Ga0495584_0482153 3300046491 Unclassified 631
186 Ga0495585_0000198 3300046492 Bacteria 62640
187 Ga0495585_0002275 3300046492 Bacteria 13869
188 Ga0495607_0111942 3300046501 Bacteria 1446
189 Ga0495583_0014766 3300046506 Bacteria 4286
190 Ga0495606_0000213 3300046507 Bacteria 103305
191 Ga0495606_0004695 3300046507 Bacteria 13491
192 Ga0495606_0007936 3300046507 Bacteria 9353
193 Ga0495606_0042024 3300046507 Bacteria 3061
194 Ga0495606_0048892 3300046507 Bacteria 2778
195 Ga0495606_0100576 3300046507 Bacteria 1761
196 Ga0495606_0108693 3300046507 Unclassified 1676
197 Ga0495610_0007660 3300046512 Bacteria 7135
198 Ga0495616_0001462 3300046513 Bacteria 16406
199 Ga0495616_0011068 3300046513 Bacteria 5183
200 Ga0495616_0222570 3300046513 Bacteria 821
201 Ga0495631_0004004 3300046518 Bacteria 7941
202 Ga0495631_0224100 3300046518 Bacteria 802
203 Ga0495632_0226637 3300046519 Bacteria 844
204 Ga0495632_0260936 3300046519 Bacteria 775
205 Ga0495637_0195843 3300046520 Bacteria 744
206 Ga0495644_0143428 3300046523 Bacteria 912
207 Ga0495648_0018887 3300046524 Bacteria 4863
208 Ga0495648_0038135 3300046524 Bacteria 3078
209 Ga0495652_0170873 3300046529 Bacteria 1678
210 Ga0495652_0220410 3300046529 Bacteria 1426
211 Ga0495654_0242767 3300046530 Bacteria 753
212 Ga0495609_0002293 3300046538 Bacteria 11896
213 Ga0495609_0399568 3300046538 Bacteria 550
214 Ga0495633_0000083 3300046558 Bacteria 125035
215 Ga0495633_0010488 3300046558 Bacteria 5052
216 Ga0495668_0000055 3300046616 Bacteria 199412
217 Ga0495668_0053821 3300046616 Bacteria 2225
218 Ga0495611_0129542 3300046648 Bacteria 1177
219 Ga0495625_0000105 3300046660 Bacteria 126078
220 Ga0495625_0001180 3300046660 Bacteria 33548
221 Ga0495625_0008307 3300046660 Bacteria 8873
222 Ga0495625_0102956 3300046660 Bacteria 1958
223 Ga0495625_0147147 3300046660 Bacteria 1585
224 Ga0495625_0194197 3300046660 Bacteria 1343
225 Ga0495625_0251957 3300046660 Bacteria 1146
226 Ga0495661_0001544 3300046665 Bacteria 19037
227 Ga0495661_0004327 3300046665 Bacteria 10280
228 Ga0495658_0079387 3300046683 Bacteria 1923
229 Ga0495670_0612601 3300046691 Bacteria 593
230 Ga0495649_0000011 3300046694 Bacteria 416695
231 Ga0495660_0029909 3300046810 Bacteria 3070
232 Ga0495660_0046317 3300046810 Bacteria 2385
233 Ga0495683_0056166 3300047323 Bacteria 1959
234 Ga0495687_000354 3300047443 Bacteria 58314
235 Ga0495687_002058 3300047443 Bacteria 16916
236 Ga0495687_056398 3300047443 Bacteria 1639
237 Ga0495686_0000306 3300047472 Bacteria 83341
238 Ga0495686_0010892 3300047472 Bacteria 6440
239 Ga0495686_0199206 3300047472 Bacteria 1150
240 Ga0495686_0275913 3300047472 Bacteria 936
241 Ga0495686_0612023 3300047472 Bacteria 563
242 Ga0495602_0355764 3300048088 Bacteria 1056
243 Ga0495614_0005778 3300048089 Bacteria 5570
244 Ga0495678_052352 3300049459 Bacteria 1572
245 Ga0495682_0012210 3300049460 Bacteria 3296
246 nmdc:mga0k408_1109_c1 3300050493 Bacteria 14749
247 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
248 nmdc:mga07m45_54634_c1 3300050496 Bacteria 2256
249 Ga0500635_0000273 3300053080 Bacteria 19606
250 Ga0500635_0002982 3300053080 Bacteria 4215
251 Ga0500647_0200119 3300053091 Bacteria 906
252 Ga0500608_000819 3300053122 Bacteria 11262
253 Ga0500618_000021 3300053125 Bacteria 160813
254 Ga0500642_0350776 3300053130 Bacteria 655
255 Ga0500564_018974 3300053138 Bacteria 3141
256 Ga0500579_114974 3300053143 Bacteria 1334
257 Ga0500616_0057998 3300053153 Bacteria 2016
258 Ga0500622_0001513 3300053156 Bacteria 18450
259 Ga0500634_0239421 3300053161 Bacteria 763
260 Ga0587077_056888 3300059493 Bacteria 836
261 Ga0587083_0061565 3300059505 Bacteria 847
262 Ga0587067_039016 3300059640 Bacteria 914
263 2599480488 2599185184 Bacteria 6430550
264 2852626189 2852623160 Bacteria 4376875
265 2884935271 2884933994 Bacteria 4535041
266 2919439460 2919437846 Bacteria 6199444
267 2928081236 2928078545 Bacteria 6534839
268 2928150587 2928147474 Bacteria 6512076
269 2932085410 2932082852 Bacteria 6563563
270 2977234402 2977232053 Bacteria 5485925
271 Ga0500624_000135
272 JGI24740J21852_10018607
273 JGI24739J22299_10036423
274 JGI24739J22299_10105861
275 JGI24739J22299_10214418
276 JGI24737J22298_10000211
277 JGI24743J22301_10015820
278 JGI24735J21928_10000011
279 JGI24744J21845_10009357
280 JGI25162J39368_1000086
281 rootH1_10128277
282 rootH2_10000579
283 rootH2_10156055
284 rootH1_10033794
285 Ga0055529_1012391
286 Ga0058863_11009948
287 Ga0065714_10019082
288 Ga0065714_10066431
289 Ga0065714_10091796
290 Ga0065714_10156303
291 Ga0070658_10000069
292 Ga0070658_10043109
293 Ga0070658_10083928
294 Ga0070676_10000138
295 Ga0068869_100158390
296 Ga0070680_100063704
297 Ga0068868_100027027
298 Ga0070660_100186998
299 Ga0070660_101336808
300 Ga0070671_100726840
301 Ga0070673_100007603
302 Ga0070681_10002600
303 Ga0068867_100003760
304 Ga0070684_100224742
305 Ga0068853_100018241
306 Ga0068853_100034736
307 Ga0068853_100119832
308 Ga0068853_100393034
309 Ga0070665_100000017
310 Ga0068855_100000141
311 Ga0068855_100000489
312 Ga0068855_100012432
313 Ga0068855_100024915
314 Ga0068855_100058452
315 Ga0068855_100801779
316 Ga0068855_101307080
317 Ga0068854_100049531
318 Ga0068856_100026783
319 Ga0068856_100104893
320 Ga0068856_100390018
321 Ga0068856_100422826
322 Ga0068856_101671656
323 Ga0068852_100002521
324 Ga0068852_100508957
325 Ga0068866_10295470
326 Ga0068870_10227317
327 Ga0075366_10000026
328 Ga0075366_10000682
329 Ga0097621_100004042
330 Ga0075370_10231549
331 Ga0068871_100001920
332 Ga0068865_100000223
333 Ga0105240_10007283
334 Ga0105240_10021014
335 Ga0105240_10064747
336 Ga0105240_10200697
337 Ga0105240_10373561
338 Ga0105240_10410158
339 Ga0105240_10558999
340 Ga0105240_10585914
341 Ga0105240_11107456
342 Ga0105241_10003752
343 Ga0105241_10059718
344 Ga0105241_10066239
345 Ga0105241_10136616
346 Ga0105242_10014530
347 Ga0105237_10000782
348 Ga0105237_10001513
349 Ga0105237_10019875
350 Ga0105237_10020293
351 Ga0105237_10034771
352 Ga0105237_10111105
353 Ga0105237_10138522
354 Ga0105237_10385459
355 Ga0105238_10005009
356 Ga0105238_10106396
357 Ga0105239_10001541
358 Ga0105239_10001835
359 Ga0105239_10011111
360 Ga0105239_10101425
361 Ga0105239_10204786
362 Ga0105239_10213232
363 Ga0105239_10825054
364 Ga0157370_10280585
365 Ga0157369_10031646
366 Ga0157374_10002377
367 Ga0157374_10004748
368 Ga0157374_10487183
369 Ga0157378_10078042
370 Ga0163162_10000071
371 Ga0163162_12061106
372 Ga0157372_10021745
373 Ga0157372_10239394
374 Ga0157375_10005697
375 Ga0157376_10229057
376 Ga0157376_11082027
377 Ga0163161_10021220
378 Ga0206350_11095099
379 Ga0209437_100144
380 Ga0209455_1002982
381 Ga0207642_10137956
382 Ga0207647_10004699
383 Ga0207645_10000956
384 Ga0207643_10271409
385 Ga0207705_10000032
386 Ga0207705_10452171
387 Ga0207705_10840690
388 Ga0207654_10006889
389 Ga0207654_10103356
390 Ga0207707_10020724
391 Ga0207695_10020575
392 Ga0207695_10101543
393 Ga0207695_10176899
394 Ga0207695_10365328
395 Ga0207671_10001617
396 Ga0207671_10003176
397 Ga0207671_10044807
398 Ga0207671_10081518
399 Ga0207671_10250452
400 Ga0207671_10274991
401 Ga0207660_10023487
402 Ga0207657_10051073
403 Ga0207649_11041735
404 Ga0207652_10001318
405 Ga0207694_10057536
406 Ga0207686_10102926
407 Ga0207704_10000138
408 Ga0207667_10000030
409 Ga0207667_10000408
410 Ga0207667_10054795
411 Ga0207667_10701756
412 Ga0207667_10781020
413 Ga0207667_10786694
414 Ga0207651_10007781
415 Ga0207640_10043527
416 Ga0207677_10100700
417 Ga0207639_10011518
418 Ga0207639_10029246
419 Ga0207639_10136870
420 Ga0207639_10335681
421 Ga0207639_11523441
422 Ga0207702_10008393
423 Ga0207702_10046459
424 Ga0207702_10228224
425 Ga0207702_10799109
426 Ga0207648_10000495
427 Ga0207683_10152679
428 Ga0207698_10003110
429 Ga0268266_10000195
430 Ga0307517_10000212
431 Ga0307515_10001565
432 Ga0307515_10006038
433 Ga0307515_10292698
434 Ga0265338_10026555
435 Ga0307507_10000111
436 Ga0307510_10009321
437 Ga0373941_0044221
438 Ga0395899_0002293
439 Ga0395899_0676155
440 Ga0395900_0001731
441 Ga0395900_1181397
442 Ga0395898_0004986
443 Ga0395905_0000987
444 Ga0395905_0326835
445 Ga0395901_0000822
446 Ga0439445_0091195
447 Ga0439448_0000331
448 Ga0466967_1428526
449 Ga0495629_0167714
450 Ga0495638_0059069
451 Ga0495638_0180129
452 Ga0495651_0028091
453 Ga0495650_0000050
454 Ga0495605_0101726
455 Ga0495584_0482153
456 Ga0495585_0000198
457 Ga0495585_0002275
458 Ga0495607_0111942
459 Ga0495583_0014766
460 Ga0495606_0000213
461 Ga0495606_0004695
462 Ga0495606_0007936
463 Ga0495606_0042024
464 Ga0495606_0048892
465 Ga0495606_0100576
466 Ga0495606_0108693
467 Ga0495610_0007660
468 Ga0495616_0001462
469 Ga0495616_0011068
470 Ga0495616_0222570
471 Ga0495631_0004004
472 Ga0495631_0224100
473 Ga0495632_0226637
474 Ga0495632_0260936
475 Ga0495637_0195843
476 Ga0495644_0143428
477 Ga0495648_0018887
478 Ga0495648_0038135
479 Ga0495652_0170873
480 Ga0495652_0220410
481 Ga0495654_0242767
482 Ga0495609_0002293
483 Ga0495609_0399568
484 Ga0495633_0000083
485 Ga0495633_0010488
486 Ga0495668_0000055
487 Ga0495668_0053821
488 Ga0495611_0129542
489 Ga0495625_0000105
490 Ga0495625_0001180
491 Ga0495625_0008307
492 Ga0495625_0102956
493 Ga0495625_0147147
494 Ga0495625_0194197
495 Ga0495625_0251957
496 Ga0495661_0001544
497 Ga0495661_0004327
498 Ga0495658_0079387
499 Ga0495670_0612601
500 Ga0495649_0000011
501 Ga0495660_0029909
502 Ga0495660_0046317
503 Ga0495683_0056166
504 Ga0495687_000354
505 Ga0495687_002058
506 Ga0495687_056398
507 Ga0495686_0000306
508 Ga0495686_0010892
509 Ga0495686_0199206
510 Ga0495686_0275913
511 Ga0495686_0612023
512 Ga0495602_0355764
513 Ga0495614_0005778
514 Ga0495678_052352
515 Ga0495682_0012210
516 nmdc:mga0k408_1109_c1
517 nmdc:mga0k408_26_c4
518 nmdc:mga07m45_54634_c1
519 Ga0500635_0000273
520 Ga0500635_0002982
521 Ga0500647_0200119
522 Ga0500608_000819
523 Ga0500618_000021
524 Ga0500642_0350776
525 Ga0500564_018974
526 Ga0500579_114974
527 Ga0500616_0057998
528 Ga0500622_0001513
529 Ga0500634_0239421
530 Ga0587077_056888
531 Ga0587083_0061565
532 Ga0587067_039016
533 2599480488
534 2852626189
535 2884935271
536 2919439460
537 2928081236
538 2928150587
539 2932085410
540 2977234402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

52

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2roe-assembly1.cif.gz_A solution structure of thermus thermophilus hb8 ttha1718 protein in vitro 0.901 25 90
6ff2-assembly1.cif.gz_B copz metallochaperone 0.8958 23 89
1fvq-assembly1.cif.gz_A solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states 0.893 23 87
4a4j-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.8919 24 90
4a48-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.8872 24 90
ID Description Score Start End Superfamily
af_Q5JLS9_1_60_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9012 28 87 3.30.70.100
af_Q557B5_356_428_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8987 26 90 3.30.70.100
af_Q59385_102_164_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8987 27 90 3.30.70.100
af_A0A1D6NFU6_1_73_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.898 24 89 3.30.70.100
6ff2B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8958 23 89 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3C1UR53-F1-model_v4 Heavy metal translocating P-type ATPase 0.9556 23 92 GO:0005507
GO:0005524
GO:0012505
GO:0016020
GO:0016887
GO:0043682
GO:0055070
AF-A0A651F001-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9499 23 92 GO:0046872
AF-A0A849DWG8-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9477 23 92 GO:0046872
AF-A0A3D3XDU8-F1-model_v4 Heavy metal translocating P-type ATPase 0.9475 23 87 GO:0005507
GO:0005524
GO:0012505
GO:0016020
GO:0016887
GO:0043682
GO:0055070
AF-A0A3M2BL11-F1-model_v4 Copper chaperone 0.9455 23 94 GO:0046872

Map