F377372

General Info

Members Datasets Scaffolds Average Seq Length
271 179 542 253

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10064899|rootH2_100648997
Length 292
Sequence LFGLQKTLSHQNTPLAHFSYNISDFGYRPGTAFTELCHMENKTIKRLALVTGANQGVGLEVVKKLVAANHTVLLGSRDLAKGEAAAKQAGDGAIAIQIDVTDPNSIDAAAARIAGEYGYLDLLVNNAAISNTRKGDLSLGEYAKISKASNISMDEVRSIWETNVFGVLAVYQAMLPLLSKSQDARIVNVSSGIGSLTLNTDPNYPYRAMYSPGYAASKTALNGITVAMMVELEKTTIKVNLVSPGFTSTALNGFEGTESIEDGSREVVRVALFAPEEPSGTFTRWENENIPW

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
156 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2512875024
159 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
160 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
161 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
162 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
163 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
164 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
165 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
166 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
167 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
168 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
169 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
170 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
171 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
172 2928153084 Leifsonia sp. 563 Isolate Unclassified
173 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
174 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
175 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
176 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
177 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
178 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
179 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.3
Metatranscriptomes 1.48
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 4.06
Rhizoplane 0.74
Rhizosphere 65.68
Stem 0
Stem Tuber 0.37
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10064899 3300003320 Bacteria 12073
2 LJNas_1000604 3300000546 Bacteria 6130
3 JGI24740J21852_10041344 3300001979 Bacteria 1390
4 JGI24739J22299_10062825 3300001989 Bacteria 1170
5 JGI24737J22298_10000785 3300001990 Bacteria 11230
6 JGI24735J21928_10039189 3300002067 Bacteria 1385
7 JGI25162J39368_1000012 3300002737 Bacteria 373191
8 JGI25162J39368_1008418 3300002737 Bacteria 1482
9 JGI25164J39214_1001049 3300002772 Bacteria 8283
10 JGI25165J46597_1000014 3300003214 Bacteria 390383
11 rootH2_10030191 3300003320 Bacteria 2311
12 rootL2_10049714 3300003322 Bacteria 8205
13 rootH1_10083261 3300003323 Bacteria 4720
14 Ga0006562J51391_1093377 3300003578 Bacteria 1396
15 Ga0055539_1000027 3300003752 Bacteria 258020
16 Ga0055533_1000020 3300003756 Bacteria 353998
17 Ga0055525_1000151 3300003759 Bacteria 94158
18 Ga0070658_10219478 3300005327 Bacteria 1607
19 Ga0070660_100047806 3300005339 Bacteria 3284
20 Ga0070661_100071730 3300005344 Bacteria 2549
21 Ga0070661_100094856 3300005344 Bacteria 2212
22 Ga0070673_100709555 3300005364 Bacteria 924
23 Ga0070711_100182843 3300005439 Bacteria 1606
24 Ga0070711_100365889 3300005439 Bacteria 1162
25 Ga0070707_100278535 3300005468 Bacteria 1626
26 Ga0068853_100001100 3300005539 Bacteria 19147
27 Ga0068853_100037286 3300005539 Bacteria 4136
28 Ga0068853_100098969 3300005539 Bacteria 2576
29 Ga0070696_100545903 3300005546 Bacteria 928
30 Ga0070665_100000221 3300005548 Bacteria 95402
31 Ga0070665_100367862 3300005548 Bacteria 1444
32 Ga0068855_100279805 3300005563 Bacteria 1853
33 Ga0068857_100045662 3300005577 Bacteria 3887
34 Ga0068856_100154789 3300005614 Bacteria 2302
35 Ga0068856_100211028 3300005614 Bacteria 1957
36 Ga0068852_100010276 3300005616 Bacteria 6983
37 Ga0068852_100023028 3300005616 Bacteria 5006
38 Ga0068851_10066267 3300005834 Bacteria 1860
39 Ga0070715_10109396 3300006163 Bacteria 1301
40 Ga0097621_100863439 3300006237 Bacteria 841
41 Ga0068871_100044931 3300006358 Bacteria 3553
42 Ga0068871_100333564 3300006358 Bacteria 1338
43 Ga0075433_10281286 3300006852 Bacteria 1474
44 Ga0075436_100312118 3300006914 Bacteria 1129
45 Ga0105244_10045167 3300009036 Bacteria 2267
46 Ga0105240_10000015 3300009093 Bacteria 457886
47 Ga0105240_10084061 3300009093 Bacteria 3903
48 Ga0105240_10437080 3300009093 Bacteria 1467
49 Ga0105241_10029194 3300009174 Bacteria 4112
50 Ga0105241_10304654 3300009174 Bacteria 1368
51 Ga0105242_10156971 3300009176 Bacteria 1988
52 Ga0105248_10039849 3300009177 Bacteria 5265
53 Ga0105248_10554677 3300009177 Bacteria 1296
54 Ga0105237_10000459 3300009545 Bacteria 57762
55 Ga0105237_10029519 3300009545 Bacteria 5574
56 Ga0105237_10172248 3300009545 Bacteria 2165
57 Ga0105237_10283954 3300009545 Bacteria 1658
58 Ga0105237_10796829 3300009545 Bacteria 952
59 Ga0105238_10091384 3300009551 Bacteria 3031
60 Ga0105238_10106977 3300009551 Bacteria 2778
61 Ga0105238_10548349 3300009551 Bacteria 1160
62 Ga0105239_10002667 3300010375 Bacteria 22492
63 Ga0105239_10092598 3300010375 Bacteria 3337
64 Ga0105239_10513840 3300010375 Bacteria 1362
65 Ga0105239_10644198 3300010375 Bacteria 1210
66 Ga0157373_10032563 3300013100 Bacteria 3752
67 Ga0157373_10280488 3300013100 Bacteria 1181
68 Ga0157371_10022122 3300013102 Bacteria 4664
69 Ga0157370_10159218 3300013104 Bacteria 2101
70 Ga0157370_10587766 3300013104 Bacteria 1020
71 Ga0157369_10168471 3300013105 Bacteria 2309
72 Ga0157374_10082494 3300013296 Bacteria 3053
73 Ga0157374_10316795 3300013296 Bacteria 1545
74 Ga0157378_10000968 3300013297 Bacteria 26320
75 Ga0157372_10135969 3300013307 Bacteria 2830
76 Ga0157372_10742825 3300013307 Bacteria 1141
77 Ga0157372_10785289 3300013307 Bacteria 1107
78 Ga0157372_10895288 3300013307 Bacteria 1030
79 Ga0163163_10009719 3300014325 Bacteria 8609
80 Ga0157376_10245835 3300014969 Bacteria 1669
81 Ga0182005_1000316 3300015265 Bacteria 29083
82 Ga0213876_10025038 3300021384 Bacteria 3150
83 Ga0213876_10140668 3300021384 Bacteria 1284
84 Ga0213875_10000008 3300021388 Bacteria 533344
85 Ga0213875_10006897 3300021388 Bacteria 5920
86 Ga0213875_10045710 3300021388 Bacteria 2055
87 Ga0213875_10129821 3300021388 Bacteria 1178
88 Ga0213875_10139206 3300021388 Bacteria 1135
89 Ga0224572_1025898 3300024225 Bacteria 1125
90 Ga0228598_1004398 3300024227 Bacteria 2983
91 Ga0209436_104226 3300025208 Bacteria 3591
92 Ga0209566_100043 3300025225 Bacteria 266609
93 Ga0209674_100001 3300025226 Bacteria 4013750
94 Ga0209563_100001 3300025230 Bacteria 4013775
95 Ga0209563_100210 3300025230 Bacteria 30709
96 Ga0207427_100039 3300025231 Bacteria 291576
97 Ga0209437_100041 3300025233 Bacteria 444465
98 Ga0209437_100441 3300025233 Bacteria 34752
99 Ga0209646_1002268 3300025246 Bacteria 4400
100 Ga0209677_100001 3300025253 Bacteria 4013787
101 Ga0209677_100519 3300025253 Bacteria 21478
102 Ga0209129_1016761 3300025258 Bacteria 1459
103 Ga0209233_1000014 3300025261 Bacteria 996641
104 Ga0207426_1006142 3300025302 Bacteria 5289
105 Ga0207426_1017760 3300025302 Bacteria 2522
106 Ga0207647_10157452 3300025904 Bacteria 1326
107 Ga0207705_10076210 3300025909 Bacteria 2438
108 Ga0207705_10308616 3300025909 Bacteria 1214
109 Ga0207705_10400287 3300025909 Bacteria 1062
110 Ga0207684_10139385 3300025910 Bacteria 2084
111 Ga0207654_10022045 3300025911 Bacteria 3393
112 Ga0207695_10025099 3300025913 Bacteria 6685
113 Ga0207671_10000855 3300025914 Bacteria 38600
114 Ga0207671_10001225 3300025914 Bacteria 30382
115 Ga0207671_10024027 3300025914 Bacteria 4588
116 Ga0207657_10004198 3300025919 Bacteria 15258
117 Ga0207649_10050403 3300025920 Bacteria 2575
118 Ga0207694_10016941 3300025924 Bacteria 5505
119 Ga0207694_10023650 3300025924 Bacteria 4665
120 Ga0207694_10507214 3300025924 Bacteria 1010
121 Ga0207694_10547202 3300025924 Bacteria 971
122 Ga0207706_10289289 3300025933 Bacteria 1429
123 Ga0207686_10038422 3300025934 Bacteria 2896
124 Ga0207704_10419898 3300025938 Bacteria 1060
125 Ga0207665_10082877 3300025939 Bacteria 2211
126 Ga0207689_10097381 3300025942 Bacteria 2416
127 Ga0207679_10050456 3300025945 Bacteria 3041
128 Ga0207667_10075756 3300025949 Bacteria 3493
129 Ga0207640_10037032 3300025981 Bacteria 3067
130 Ga0207678_10083326 3300026067 Bacteria 2735
131 Ga0207702_10284509 3300026078 Bacteria 1564
132 Ga0207641_10460955 3300026088 Bacteria 1230
133 Ga0207648_10185134 3300026089 Bacteria 1844
134 Ga0207674_10051152 3300026116 Bacteria 4217
135 Ga0207674_10461485 3300026116 Bacteria 1228
136 Ga0207675_100175627 3300026118 Bacteria 2049
137 Ga0207698_10024307 3300026142 Bacteria 4250
138 Ga0207698_10391524 3300026142 Bacteria 1325
139 Ga0268266_10000005 3300028379 Bacteria 1448194
140 Ga0268266_10000167 3300028379 Bacteria 120012
141 Ga0265334_10045963 3300028573 Bacteria 1689
142 Ga0265338_10004783 3300028800 Bacteria 18097
143 Ga0265762_1004057 3300030760 Bacteria 2623
144 Ga0265762_1004707 3300030760 Bacteria 2441
145 Ga0265770_1010271 3300030878 Bacteria 1356
146 Ga0265328_10034389 3300031239 Bacteria 1877
147 Ga0265325_10000268 3300031241 Bacteria 37034
148 Ga0265325_10006796 3300031241 Bacteria 6915
149 Ga0265340_10007182 3300031247 Bacteria 6068
150 Ga0265340_10140648 3300031247 Bacteria 1104
151 Ga0265339_10022892 3300031249 Bacteria 3614
152 Ga0265339_10043781 3300031249 Bacteria 2472
153 Ga0265331_10031170 3300031250 Bacteria 2651
154 Ga0265331_10039302 3300031250 Bacteria 2308
155 Ga0265331_10132585 3300031250 Bacteria 1136
156 Ga0265327_10033313 3300031251 Bacteria 2872
157 Ga0265316_10015582 3300031344 Bacteria 6637
158 Ga0265316_10061158 3300031344 Bacteria 2925
159 Ga0265313_10001117 3300031595 Bacteria 25638
160 Ga0265313_10021075 3300031595 Bacteria 3574
161 Ga0265313_10063696 3300031595 Bacteria 1718
162 Ga0307508_10036783 3300031616 Bacteria 4407
163 Ga0265314_10102925 3300031711 Bacteria 1831
164 Ga0265342_10028628 3300031712 Bacteria 3467
165 Ga0307516_10058413 3300031730 Bacteria 3755
166 Ga0307413_10003703 3300031824 Bacteria 6499
167 Ga0307414_10002617 3300032004 Bacteria 9467
168 Ga0307414_10187302 3300032004 Unclassified 1671
169 Ga0373949_0055633 3300035090 Bacteria 1007
170 Ga0395899_0001928 3300037312 Bacteria 17090
171 Ga0395899_0017387 3300037312 Bacteria 5477
172 Ga0395900_0040969 3300037418 Bacteria 4775
173 Ga0395900_0048603 3300037418 Bacteria 4370
174 Ga0395898_0388323 3300037466 Bacteria 1331
175 Ga0395898_0816366 3300037466 Bacteria 872
176 Ga0436364_0035432 3300037853 Bacteria 2276
177 Ga0436364_0097893 3300037853 Bacteria 2616
178 Ga0436364_0189076 3300037853 Bacteria 2350
179 Ga0436364_0231560 3300037853 Bacteria 1341
180 Ga0436364_0392948 3300037853 Bacteria 5997
181 Ga0436364_0548200 3300037853 Bacteria 2140
182 Ga0436364_0687495 3300037853 Bacteria 9049
183 Ga0436364_1273799 3300037853 Bacteria 3578
184 Ga0436364_1415525 3300037853 Bacteria 425173
185 Ga0436364_1484144 3300037853 Bacteria 2663
186 Ga0395901_0377053 3300038443 Bacteria 1460
187 Ga0436365_1028915 3300039437 Bacteria 6900
188 Ga0436365_1850524 3300039437 Bacteria 2155
189 Ga0451577_0394311 3300042876 Bacteria 1256
190 Ga0466972_0000199 3300044658 Bacteria 43983
191 Ga0453684_0078912 3300044712 Bacteria 4117
192 Ga0466957_0015034 3300044842 Bacteria 4515
193 Ga0495592_0140481 3300046454 Bacteria 1680
194 Ga0495637_0023134 3300046520 Bacteria 2828
195 Ga0495609_0013791 3300046538 Plasmid 3810
196 Ga0495624_0296333 3300046690 Bacteria 975
197 Ga0495686_0000040 3300047472 Bacteria 301210
198 Ga0495686_0000593 3300047472 Bacteria 50448
199 Ga0495686_0018087 3300047472 Bacteria 4736
200 Ga0496106_0000591 3300048909 Bacteria 25938
201 Ga0496114_0486527 3300048917 Bacteria 1092
202 Ga0496117_0015237 3300048920 Bacteria 6571
203 Ga0496117_0088075 3300048920 Bacteria 2010
204 Ga0496118_0002064 3300048921 Bacteria 28295
205 Ga0496118_0066580 3300048921 Bacteria 2629
206 Ga0496119_0003296 3300048922 Bacteria 16865
207 Ga0496119_0003928 3300048922 Bacteria 15074
208 Ga0496119_0105625 3300048922 Bacteria 1573
209 Ga0496120_0000503 3300048923 Bacteria 61033
210 Ga0496120_0000893 3300048923 Bacteria 41950
211 Ga0496120_0008407 3300048923 Bacteria 7493
212 Ga0496121_0008898 3300048924 Bacteria 11662
213 Ga0496121_0052051 3300048924 Bacteria 3443
214 Ga0496124_0000190 3300048927 Bacteria 121581
215 Ga0496126_0000164 3300048929 Bacteria 152791
216 Ga0496126_0001497 3300048929 Bacteria 36200
217 Ga0501033_0060365 3300049570 Bacteria 2798
218 Ga0501034_0006561 3300049571 Bacteria 12496
219 Ga0501034_0052331 3300049571 Bacteria 4114
220 Ga0501034_0073207 3300049571 Bacteria 3435
221 Ga0501038_0178622 3300049574 Bacteria 1714
222 Ga0501043_0284851 3300049579 Bacteria 1266
223 Ga0501047_0379837 3300049581 Bacteria 1247
224 Ga0501048_0285908 3300049582 Bacteria 1173
225 Ga0501069_0267679 3300049585 Bacteria 998
226 Ga0501070_0000090 3300049586 Bacteria 77327
227 Ga0501070_0004968 3300049586 Bacteria 11347
228 Ga0501070_0369108 3300049586 Bacteria 1163
229 Ga0501071_0260330 3300049587 Bacteria 1310
230 Ga0501073_0001442 3300049589 Bacteria 17577
231 Ga0501073_0212993 3300049589 Bacteria 1335
232 Ga0501074_0000095 3300049590 Bacteria 42376
233 Ga0501074_0028271 3300049590 Bacteria 4064
234 Ga0501080_0000250 3300049742 Bacteria 40604
235 Ga0501035_0030407 3300049822 Bacteria 4923
236 Ga0501044_0004767 3300049823 Bacteria 15173
237 Ga0501044_0019840 3300049823 Bacteria 7180
238 Ga0501044_0163313 3300049823 Bacteria 2202
239 Ga0500635_0000006 3300053080 Bacteria 187108
240 Ga0500572_000624 3300053111 Bacteria 11834
241 Ga0500595_005727 3300053119 Bacteria 5380
242 Ga0500618_008034 3300053125 Bacteria 2972
243 Ga0500559_0000007 3300053136 Bacteria 226236
244 Ga0500590_000296 3300053148 Bacteria 15848
245 Ga0500596_002385 3300053735 Bacteria 3704
246 Ga0466962_0134340 3300061719 Bacteria 1197
247 2512961160 2512875024 Bacteria 7195110
248 2524189813 2524023129 Bacteria 6762600
249 2774393240 2773857762 Bacteria 5971770
250 2819575987 2818991442 Bacteria 8318214
251 2821139533 2821136567 Bacteria 8080116
252 2821142945 2821136567 Bacteria 8080116
253 2867349957 2867346516 Bacteria 7608576
254 2868089132 2868088558 Bacteria 7609351
255 2884764067 2884763398 Bacteria 4091164
256 2888354247 2888350351 Bacteria 7372807
257 2889015959 2889010040 Bacteria 6749192
258 2889018988 2889016732 Bacteria 6700763
259 2904470674 2904467357 Bacteria 8057758
260 2904471834 2904467357 Bacteria 8057758
261 2919696858 2919692658 Bacteria 5943958
262 2922132854 2922130491 Bacteria 7173936
263 2928155483 2928153084 Bacteria 4020257
264 2958106536 2958100919 Bacteria 6800575
265 2958177406 2958172287 Bacteria 6716688
266 2965125648 2965119406 Bacteria 6956431
267 2979713399 2979710463 Bacteria 6785254
268 2979751272 2979742915 Bacteria 7301278
269 2987657566 2987652177 Bacteria 6969023
270 8056582586 8056579771 Bacteria 5840325
271 8056583457 8056579771 Bacteria 5840325
272 rootH2_10064899
273 LJNas_1000604
274 JGI24740J21852_10041344
275 JGI24739J22299_10062825
276 JGI24737J22298_10000785
277 JGI24735J21928_10039189
278 JGI25162J39368_1000012
279 JGI25162J39368_1008418
280 JGI25164J39214_1001049
281 JGI25165J46597_1000014
282 rootH2_10030191
283 rootL2_10049714
284 rootH1_10083261
285 Ga0006562J51391_1093377
286 Ga0055539_1000027
287 Ga0055533_1000020
288 Ga0055525_1000151
289 Ga0070658_10219478
290 Ga0070660_100047806
291 Ga0070661_100071730
292 Ga0070661_100094856
293 Ga0070673_100709555
294 Ga0070711_100182843
295 Ga0070711_100365889
296 Ga0070707_100278535
297 Ga0068853_100001100
298 Ga0068853_100037286
299 Ga0068853_100098969
300 Ga0070696_100545903
301 Ga0070665_100000221
302 Ga0070665_100367862
303 Ga0068855_100279805
304 Ga0068857_100045662
305 Ga0068856_100154789
306 Ga0068856_100211028
307 Ga0068852_100010276
308 Ga0068852_100023028
309 Ga0068851_10066267
310 Ga0070715_10109396
311 Ga0097621_100863439
312 Ga0068871_100044931
313 Ga0068871_100333564
314 Ga0075433_10281286
315 Ga0075436_100312118
316 Ga0105244_10045167
317 Ga0105240_10000015
318 Ga0105240_10084061
319 Ga0105240_10437080
320 Ga0105241_10029194
321 Ga0105241_10304654
322 Ga0105242_10156971
323 Ga0105248_10039849
324 Ga0105248_10554677
325 Ga0105237_10000459
326 Ga0105237_10029519
327 Ga0105237_10172248
328 Ga0105237_10283954
329 Ga0105237_10796829
330 Ga0105238_10091384
331 Ga0105238_10106977
332 Ga0105238_10548349
333 Ga0105239_10002667
334 Ga0105239_10092598
335 Ga0105239_10513840
336 Ga0105239_10644198
337 Ga0157373_10032563
338 Ga0157373_10280488
339 Ga0157371_10022122
340 Ga0157370_10159218
341 Ga0157370_10587766
342 Ga0157369_10168471
343 Ga0157374_10082494
344 Ga0157374_10316795
345 Ga0157378_10000968
346 Ga0157372_10135969
347 Ga0157372_10742825
348 Ga0157372_10785289
349 Ga0157372_10895288
350 Ga0163163_10009719
351 Ga0157376_10245835
352 Ga0182005_1000316
353 Ga0213876_10025038
354 Ga0213876_10140668
355 Ga0213875_10000008
356 Ga0213875_10006897
357 Ga0213875_10045710
358 Ga0213875_10129821
359 Ga0213875_10139206
360 Ga0224572_1025898
361 Ga0228598_1004398
362 Ga0209436_104226
363 Ga0209566_100043
364 Ga0209674_100001
365 Ga0209563_100001
366 Ga0209563_100210
367 Ga0207427_100039
368 Ga0209437_100041
369 Ga0209437_100441
370 Ga0209646_1002268
371 Ga0209677_100001
372 Ga0209677_100519
373 Ga0209129_1016761
374 Ga0209233_1000014
375 Ga0207426_1006142
376 Ga0207426_1017760
377 Ga0207647_10157452
378 Ga0207705_10076210
379 Ga0207705_10308616
380 Ga0207705_10400287
381 Ga0207684_10139385
382 Ga0207654_10022045
383 Ga0207695_10025099
384 Ga0207671_10000855
385 Ga0207671_10001225
386 Ga0207671_10024027
387 Ga0207657_10004198
388 Ga0207649_10050403
389 Ga0207694_10016941
390 Ga0207694_10023650
391 Ga0207694_10507214
392 Ga0207694_10547202
393 Ga0207706_10289289
394 Ga0207686_10038422
395 Ga0207704_10419898
396 Ga0207665_10082877
397 Ga0207689_10097381
398 Ga0207679_10050456
399 Ga0207667_10075756
400 Ga0207640_10037032
401 Ga0207678_10083326
402 Ga0207702_10284509
403 Ga0207641_10460955
404 Ga0207648_10185134
405 Ga0207674_10051152
406 Ga0207674_10461485
407 Ga0207675_100175627
408 Ga0207698_10024307
409 Ga0207698_10391524
410 Ga0268266_10000005
411 Ga0268266_10000167
412 Ga0265334_10045963
413 Ga0265338_10004783
414 Ga0265762_1004057
415 Ga0265762_1004707
416 Ga0265770_1010271
417 Ga0265328_10034389
418 Ga0265325_10000268
419 Ga0265325_10006796
420 Ga0265340_10007182
421 Ga0265340_10140648
422 Ga0265339_10022892
423 Ga0265339_10043781
424 Ga0265331_10031170
425 Ga0265331_10039302
426 Ga0265331_10132585
427 Ga0265327_10033313
428 Ga0265316_10015582
429 Ga0265316_10061158
430 Ga0265313_10001117
431 Ga0265313_10021075
432 Ga0265313_10063696
433 Ga0307508_10036783
434 Ga0265314_10102925
435 Ga0265342_10028628
436 Ga0307516_10058413
437 Ga0307413_10003703
438 Ga0307414_10002617
439 Ga0307414_10187302
440 Ga0373949_0055633
441 Ga0395899_0001928
442 Ga0395899_0017387
443 Ga0395900_0040969
444 Ga0395900_0048603
445 Ga0395898_0388323
446 Ga0395898_0816366
447 Ga0436364_0035432
448 Ga0436364_0097893
449 Ga0436364_0189076
450 Ga0436364_0231560
451 Ga0436364_0392948
452 Ga0436364_0548200
453 Ga0436364_0687495
454 Ga0436364_1273799
455 Ga0436364_1415525
456 Ga0436364_1484144
457 Ga0395901_0377053
458 Ga0436365_1028915
459 Ga0436365_1850524
460 Ga0451577_0394311
461 Ga0466972_0000199
462 Ga0453684_0078912
463 Ga0466957_0015034
464 Ga0495592_0140481
465 Ga0495637_0023134
466 Ga0495609_0013791
467 Ga0495624_0296333
468 Ga0495686_0000040
469 Ga0495686_0000593
470 Ga0495686_0018087
471 Ga0496106_0000591
472 Ga0496114_0486527
473 Ga0496117_0015237
474 Ga0496117_0088075
475 Ga0496118_0002064
476 Ga0496118_0066580
477 Ga0496119_0003296
478 Ga0496119_0003928
479 Ga0496119_0105625
480 Ga0496120_0000503
481 Ga0496120_0000893
482 Ga0496120_0008407
483 Ga0496121_0008898
484 Ga0496121_0052051
485 Ga0496124_0000190
486 Ga0496126_0000164
487 Ga0496126_0001497
488 Ga0501033_0060365
489 Ga0501034_0006561
490 Ga0501034_0052331
491 Ga0501034_0073207
492 Ga0501038_0178622
493 Ga0501043_0284851
494 Ga0501047_0379837
495 Ga0501048_0285908
496 Ga0501069_0267679
497 Ga0501070_0000090
498 Ga0501070_0004968
499 Ga0501070_0369108
500 Ga0501071_0260330
501 Ga0501073_0001442
502 Ga0501073_0212993
503 Ga0501074_0000095
504 Ga0501074_0028271
505 Ga0501080_0000250
506 Ga0501035_0030407
507 Ga0501044_0004767
508 Ga0501044_0019840
509 Ga0501044_0163313
510 Ga0500635_0000006
511 Ga0500572_000624
512 Ga0500595_005727
513 Ga0500618_008034
514 Ga0500559_0000007
515 Ga0500590_000296
516 Ga0500596_002385
517 Ga0466962_0134340
518 2512961160
519 2524189813
520 2774393240
521 2819575987
522 2821139533
523 2821142945
524 2867349957
525 2868089132
526 2884764067
527 2888354247
528 2889015959
529 2889018988
530 2904470674
531 2904471834
532 2919696858
533 2922132854
534 2928155483
535 2958106536
536 2958177406
537 2965125648
538 2979713399
539 2979751272
540 2987657566
541 8056582586
542 8056583457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

259

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

277

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9013 24 264
5cdy-assembly1.cif.gz_D the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.889 24 267
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.885 25 258
7xwl-assembly2.cif.gz_B structure of patulin-detoxifying enzyme y155f/v187f with nadph 0.8843 23 271
7xwi-assembly1.cif.gz_D structure of patulin-detoxifying enzyme with nadph 0.8822 23 271
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.984 24 101 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 24 104 3.40.50.720
af_Q2FV41_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9534 23 270 3.40.50.720
af_Q2FV41_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 23 270 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 24 94 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5R2N5I4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9993 146 271 GO:0016491
AF-A0A2M8ZIK4-F1-model_v4 deleted 0.9945 21 271
AF-A0A2M8ZIK4-F1-model_v4 deleted 0.9866 21 271
AF-A0A5R2N5I4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9837 146 271 GO:0016491
AF-A0A0N0UHI0-F1-model_v4 Dehydrogenase 0.9762 21 158 GO:0016491

Map