F377436

General Info

Members Datasets Scaffolds Average Seq Length
271 183 267 135

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100469984|Ga0070670_1004699841
Length 132
Sequence MKHVDHIGIAVKSLATALPIFEKLLNTKCYKTEVVDAEDVTTAFLKTGETKIELLENGSETGPIAKFIDKRGEGLHHIAFEVDDITAEIQRLESEGFIAINKPKPGADNKLICFLHPKNTHGVLIELCQSIK

Samples

Sample ID Description Type Environment
1 2739367656 Pedobacter sp. CF523 Isolate Unclassified
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 0
Rhizoplane 0.74
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016199 3300003320 Bacteria 99895
2 rootH2_10279877 3300003320 Bacteria 2437
3 rootL2_10071475 3300003322 Bacteria 3252
4 rootH1_10383042 3300003323 Bacteria 1100
5 Ga0065165_1046865 3300005262 Bacteria 1251
6 Ga0065707_10008308 3300005295 Bacteria 2422
7 Ga0065707_10333395 3300005295 Bacteria 946
8 Ga0070658_10131120 3300005327 Bacteria 2089
9 Ga0070658_11378941 3300005327 Bacteria 612
10 Ga0070670_100017990 3300005331 Bacteria 6066
11 Ga0070670_100138592 3300005331 Bacteria 2103
12 Ga0070670_100370289 3300005331 Bacteria 1261
13 Ga0070670_100469984 3300005331 Bacteria 1116
14 Ga0070680_101984242 3300005336 Unclassified 504
15 Ga0070660_100204940 3300005339 Unclassified 1600
16 Ga0070660_100276599 3300005339 Unclassified 1373
17 Ga0070689_100475372 3300005340 Bacteria 1067
18 Ga0070687_100821612 3300005343 Unclassified 660
19 Ga0070661_100918438 3300005344 Unclassified 723
20 Ga0070661_101186356 3300005344 Bacteria 638
21 Ga0070668_100162607 3300005347 Bacteria 1812
22 Ga0070675_100251705 3300005354 Bacteria 1546
23 Ga0070675_100297763 3300005354 Unclassified 1421
24 Ga0070671_100935556 3300005355 Bacteria 758
25 Ga0070659_100009518 3300005366 Bacteria 7139
26 Ga0070659_100085850 3300005366 Bacteria 2518
27 Ga0070667_101610865 3300005367 Unclassified 610
28 Ga0070681_10811036 3300005458 Bacteria 853
29 Ga0068867_100920863 3300005459 Unclassified 788
30 Ga0068867_100952750 3300005459 Unclassified 775
31 Ga0068867_101322796 3300005459 Bacteria 666
32 Ga0070698_100011419 3300005471 Bacteria 9422
33 Ga0070679_100046564 3300005530 Bacteria 4323
34 Ga0070684_100674030 3300005535 Bacteria 963
35 Ga0070684_100967154 3300005535 Bacteria 799
36 Ga0068853_100010663 3300005539 Bacteria 7437
37 Ga0068853_100022485 3300005539 Bacteria 5267
38 Ga0068853_100052784 3300005539 Bacteria 3501
39 Ga0068853_100322506 3300005539 Bacteria 1432
40 Ga0070672_100617362 3300005543 Bacteria 945
41 Ga0070665_100000003 3300005548 Bacteria 811857
42 Ga0068855_100002796 3300005563 Bacteria 21475
43 Ga0068855_100029930 3300005563 Bacteria 6511
44 Ga0068855_100046588 3300005563 Bacteria 5125
45 Ga0068855_100698044 3300005563 Bacteria 1086
46 Ga0068857_100003733 3300005577 Bacteria 12786
47 Ga0068854_100497125 3300005578 Bacteria 1026
48 Ga0068854_102136195 3300005578 Unclassified 517
49 Ga0068856_100007833 3300005614 Bacteria 10431
50 Ga0068852_100000721 3300005616 Bacteria 21702
51 Ga0068852_100008334 3300005616 Bacteria 7632
52 Ga0068852_100220305 3300005616 Bacteria 1804
53 Ga0068852_100500317 3300005616 Bacteria 1210
54 Ga0068863_101293064 3300005841 Bacteria 736
55 Ga0068862_101507580 3300005844 Unclassified 678
56 Ga0081539_10000337 3300005985 Bacteria 103868
57 Ga0070715_10210727 3300006163 Bacteria 993
58 Ga0075366_10108627 3300006195 Bacteria 1668
59 Ga0097621_100025409 3300006237 Bacteria 4634
60 Ga0097621_100732694 3300006237 Bacteria 912
61 Ga0075370_10802160 3300006353 Bacteria 574
62 Ga0068871_100015821 3300006358 Bacteria 5661
63 Ga0068871_100212777 3300006358 Unclassified 1672
64 Ga0075428_100003670 3300006844 Bacteria 16837
65 Ga0075428_100126399 3300006844 Bacteria 2782
66 Ga0075433_10763905 3300006852 Unclassified 845
67 Ga0075429_100002957 3300006880 Bacteria 14416
68 Ga0105240_10033651 3300009093 Bacteria 6617
69 Ga0105240_10076593 3300009093 Unclassified 4123
70 Ga0105240_10939493 3300009093 Bacteria 928
71 Ga0111539_10622863 3300009094 Unclassified 1256
72 Ga0114129_10027575 3300009147 Bacteria 8042
73 Ga0105241_10006050 3300009174 Bacteria 8922
74 Ga0105242_10659816 3300009176 Bacteria 1018
75 Ga0105237_10006020 3300009545 Bacteria 13572
76 Ga0105237_10070483 3300009545 Bacteria 3492
77 Ga0105237_10247239 3300009545 Bacteria 1785
78 Ga0105238_10010778 3300009551 Bacteria 9183
79 Ga0105238_11070049 3300009551 Bacteria 829
80 Ga0105249_10018068 3300009553 Bacteria 6268
81 Ga0105249_10069244 3300009553 Bacteria 3257
82 Ga0105249_11193945 3300009553 Bacteria 832
83 Ga0105239_10006051 3300010375 Bacteria 14085
84 Ga0105239_13513242 3300010375 Bacteria 509
85 Ga0157373_10024488 3300013100 Bacteria 4371
86 Ga0157371_10006615 3300013102 Bacteria 9506
87 Ga0157370_10000530 3300013104 Bacteria 47795
88 Ga0157370_10004932 3300013104 Bacteria 15102
89 Ga0157370_10035808 3300013104 Bacteria 4821
90 Ga0157370_11026311 3300013104 Unclassified 746
91 Ga0157369_10022350 3300013105 Bacteria 7059
92 Ga0157374_10000013 3300013296 Bacteria 461240
93 Ga0157378_10014637 3300013297 Bacteria 6868
94 Ga0163162_10000024 3300013306 Bacteria 188515
95 Ga0163162_10009475 3300013306 Bacteria 9468
96 Ga0163162_10167141 3300013306 Bacteria 2324
97 Ga0163162_11953474 3300013306 Bacteria 672
98 Ga0157372_10068320 3300013307 Bacteria 3995
99 Ga0157372_10950339 3300013307 Bacteria 996
100 Ga0157372_12438760 3300013307 Bacteria 601
101 Ga0157375_12826172 3300013308 Bacteria 580
102 Ga0163163_10002634 3300014325 Bacteria 15189
103 Ga0163163_10768910 3300014325 Bacteria 1026
104 Ga0157380_10082388 3300014326 Bacteria 2633
105 Ga0157380_10115843 3300014326 Unclassified 2261
106 Ga0157380_11622615 3300014326 Bacteria 703
107 Ga0157380_11628112 3300014326 Bacteria 702
108 Ga0157380_12846026 3300014326 Unclassified 550
109 Ga0157379_10107165 3300014968 Bacteria 2509
110 Ga0157379_10275660 3300014968 Bacteria 1530
111 Ga0157376_10012161 3300014969 Bacteria 6378
112 Ga0157376_10046111 3300014969 Bacteria 3593
113 Ga0157376_10068941 3300014969 Bacteria 2997
114 Ga0157376_10110499 3300014969 Bacteria 2418
115 Ga0157376_10263577 3300014969 Bacteria 1615
116 Ga0157376_10485985 3300014969 Bacteria 1211
117 Ga0157376_11282241 3300014969 Bacteria 762
118 Ga0163161_10325779 3300017792 Bacteria 1215
119 Ga0163161_11349407 3300017792 Bacteria 621
120 Ga0209436_103174 3300025208 Bacteria 4493
121 Ga0207426_1049398 3300025302 Bacteria 1259
122 Ga0207647_10000088 3300025904 Bacteria 70267
123 Ga0207705_10077816 3300025909 Bacteria 2413
124 Ga0207705_10198203 3300025909 Unclassified 1521
125 Ga0207654_10024149 3300025911 Bacteria 3265
126 Ga0207707_10749784 3300025912 Bacteria 817
127 Ga0207695_10030834 3300025913 Bacteria 5899
128 Ga0207695_10104729 3300025913 Bacteria 2817
129 Ga0207695_10633195 3300025913 Bacteria 951
130 Ga0207671_10040060 3300025914 Bacteria 3468
131 Ga0207671_10153151 3300025914 Bacteria 1782
132 Ga0207671_10324416 3300025914 Bacteria 1219
133 Ga0207660_11721829 3300025917 Unclassified 504
134 Ga0207662_10426592 3300025918 Unclassified 903
135 Ga0207649_11514437 3300025920 Unclassified 531
136 Ga0207694_10031432 3300025924 Bacteria 4055
137 Ga0207650_10135342 3300025925 Unclassified 1932
138 Ga0207650_10137023 3300025925 Bacteria 1921
139 Ga0207650_10374701 3300025925 Bacteria 1174
140 Ga0207650_11351855 3300025925 Bacteria 606
141 Ga0207659_10637063 3300025926 Unclassified 910
142 Ga0207644_10139270 3300025931 Unclassified 1867
143 Ga0207644_10153353 3300025931 Unclassified 1785
144 Ga0207690_10090301 3300025932 Bacteria 2162
145 Ga0207690_10764846 3300025932 Bacteria 797
146 Ga0207670_10683746 3300025936 Bacteria 848
147 Ga0207704_10868699 3300025938 Bacteria 757
148 Ga0207691_10592060 3300025940 Bacteria 939
149 Ga0207691_10599565 3300025940 Unclassified 932
150 Ga0207667_10001252 3300025949 Bacteria 31847
151 Ga0207667_10008349 3300025949 Bacteria 12309
152 Ga0207667_10014871 3300025949 Bacteria 8851
153 Ga0207667_10312054 3300025949 Unclassified 1606
154 Ga0207712_10002584 3300025961 Bacteria 11627
155 Ga0207640_10751189 3300025981 Unclassified 841
156 Ga0207658_11054468 3300025986 Bacteria 742
157 Ga0207658_11516652 3300025986 Unclassified 613
158 Ga0207639_10013337 3300026041 Bacteria 5751
159 Ga0207639_10059768 3300026041 Bacteria 2938
160 Ga0207639_10170552 3300026041 Bacteria 1842
161 Ga0207639_10871225 3300026041 Bacteria 841
162 Ga0207702_10270206 3300026078 Bacteria 1603
163 Ga0207641_11234342 3300026088 Bacteria 747
164 Ga0207648_10753186 3300026089 Unclassified 905
165 Ga0207674_10018104 3300026116 Bacteria 7665
166 Ga0207675_100787579 3300026118 Bacteria 963
167 Ga0207698_10276967 3300026142 Bacteria 1550
168 Ga0207698_11037939 3300026142 Bacteria 831
169 Ga0209995_1028654 3300027471 Bacteria 930
170 Ga0209999_1054887 3300027543 Bacteria 755
171 Ga0268266_10000137 3300028379 Bacteria 140685
172 Ga0268265_10381463 3300028380 Unclassified 1297
173 Ga0268264_10563392 3300028381 Bacteria 1119
174 Ga0307515_10000001 3300028794 Bacteria 4259510
175 Ga0265327_10000059 3300031251 Bacteria 236935
176 Ga0265327_10127875 3300031251 Bacteria 1198
177 Ga0307408_102123352 3300031548 Unclassified 542
178 Ga0307405_10094410 3300031731 Bacteria 1989
179 Ga0307410_12047671 3300031852 Unclassified 511
180 Ga0307412_10022583 3300031911 Bacteria 3859
181 Ga0307412_10062627 3300031911 Bacteria 2506
182 Ga0307412_10520916 3300031911 Unclassified 993
183 Ga0307414_10956195 3300032004 Unclassified 787
184 Ga0373932_0328478 3300035112 Bacteria 577
185 Ga0373936_0105719 3300035113 Bacteria 1191
186 Ga0373937_0421941 3300036401 Bacteria 1266
187 Ga0395899_0006115 3300037312 Bacteria 9326
188 Ga0395900_0005147 3300037418 Bacteria 13735
189 Ga0395898_0006832 3300037466 Bacteria 12135
190 Ga0395901_0003679 3300038443 Bacteria 15468
191 Ga0436363_1166034 3300039450 Bacteria 510
192 Ga0451837_0677132 3300041494 Bacteria 827
193 Ga0451849_0693361 3300041505 Bacteria 981
194 Ga0439431_0001996 3300041997 Bacteria 4524
195 Ga0439441_035434 3300042001 Bacteria 984
196 Ga0439445_0023756 3300042004 Bacteria 1555
197 Ga0439449_0065149 3300042007 Bacteria 1344
198 Ga0466969_0000220 3300044656 Bacteria 31296
199 Ga0466965_0060645 3300044683 Bacteria 1890
200 Ga0466966_0000215 3300044684 Bacteria 38667
201 Ga0466966_0453339 3300044684 Bacteria 771
202 Ga0466961_0139002 3300044693 Bacteria 1521
203 Ga0466964_0281404 3300044706 Bacteria 831
204 Ga0466968_0585444 3300044735 Bacteria 562
205 Ga0466970_0176089 3300044765 Bacteria 1186
206 Ga0466959_0000004 3300045049 Bacteria 216815
207 Ga0466958_0052081 3300045836 Bacteria 2480
208 Ga0495632_0287360 3300046519 Unclassified 731
209 Ga0495645_0130367 3300046543 Bacteria 1763
210 Ga0495645_0453261 3300046543 Bacteria 809
211 Ga0495633_0123311 3300046558 Unclassified 1200
212 Ga0495668_0001516 3300046616 Bacteria 22085
213 Ga0495625_0381203 3300046660 Unclassified 885
214 Ga0495657_0773372 3300046675 Unclassified 550
215 Ga0495649_0208484 3300046694 Bacteria 1013
216 Ga0495600_0849631 3300046809 Bacteria 541
217 Ga0495636_0000184 3300047318 Bacteria 24852
218 Ga0495672_0017615 3300047320 Bacteria 4775
219 Ga0495686_0015427 3300047472 Bacteria 5216
220 Ga0495602_0279283 3300048088 Bacteria 1231
221 Ga0496104_0656281 3300048907 Bacteria 958
222 Ga0496105_1062915 3300048908 Bacteria 603
223 Ga0496123_0294804 3300048926 Bacteria 777
224 Ga0501296_010964 3300049519 Bacteria 1080
225 Ga0501032_0056259 3300049569 Bacteria 2644
226 Ga0501033_0263697 3300049570 Bacteria 1219
227 Ga0501034_0063339 3300049571 Bacteria 3711
228 Ga0501034_0197271 3300049571 Bacteria 1972
229 Ga0501034_0437755 3300049571 Unclassified 1226
230 Ga0501036_0012620 3300049572 Bacteria 7008
231 Ga0501037_0081838 3300049573 Bacteria 2341
232 Ga0501038_0161984 3300049574 Bacteria 1817
233 Ga0501039_0110373 3300049575 Unclassified 2150
234 Ga0501043_0140885 3300049579 Bacteria 1888
235 Ga0501046_0015843 3300049580 Bacteria 6325
236 Ga0501047_0232082 3300049581 Bacteria 1698
237 Ga0501048_0011105 3300049582 Bacteria 6715
238 Ga0501067_0019967 3300049583 Bacteria 3708
239 Ga0501070_0019668 3300049586 Bacteria 5662
240 Ga0501073_0017381 3300049589 Bacteria 5210
241 Ga0501074_0062415 3300049590 Bacteria 2683
242 Ga0501077_0768129 3300049593 Unclassified 620
243 Ga0501223_000832 3300049663 Bacteria 7325
244 Ga0501259_054182 3300049688 Unclassified 822
245 Ga0501080_0356758 3300049742 Bacteria 1319
246 Ga0501080_0976762 3300049742 Bacteria 735
247 Ga0501280_078994 3300049776 Bacteria 602
248 Ga0501035_0093581 3300049822 Bacteria 2644
249 Ga0501035_0163233 3300049822 Bacteria 1928
250 Ga0501035_0361423 3300049822 Unclassified 1213
251 Ga0501044_0016771 3300049823 Bacteria 7861
252 Ga0501044_0038763 3300049823 Bacteria 4975
253 Ga0501044_0101873 3300049823 Bacteria 2888
254 nmdc:mga0k408_88685_c1 3300050493 Bacteria 1816
255 nmdc:mga05p37_105267_c1 3300050507 Bacteria 3471
256 nmdc:mga09592_1410_c1 3300050508 Bacteria 19253
257 nmdc:mga0qj67_72382_c1 3300050509 Bacteria 2752
258 nmdc:mga0a205_1024710_c1 3300050515 Unclassified 672
259 Ga0500618_149682 3300053125 Bacteria 532
260 Ga0500568_0001401 3300053139 Bacteria 15635
261 Ga0500588_0003130 3300053146 Bacteria 3460
262 Ga0500616_0003892 3300053153 Bacteria 10981
263 Ga0500624_109667 3300053157 Unclassified 573
264 Ga0500636_0201691 3300053177 Bacteria 1052
265 Ga0466962_0025642 3300061719 Bacteria 2830
266 Ga0466962_0316753 3300061719 Bacteria 773
267 Ga0466962_0337070 3300061719 Bacteria 750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10426592 Ga0207662_104265922 122
2 iso_pu_bacteria 2883068021 2883070016 130
3 3300005355 Ga0070671_100935556 Ga0070671_1009355562 131
4 iso_pu_bacteria 2739367656 2739615510 131
5 iso_pu_bacteria 2840677318 2840679207 131
6 iso_pu_bacteria 2896085136 2896087018 131
7 3300005331 Ga0070670_100469984 Ga0070670_1004699841 132
8 3300005340 Ga0070689_100475372 Ga0070689_1004753722 132
9 3300005535 Ga0070684_100967154 Ga0070684_1009671542 132
10 3300006852 Ga0075433_10763905 Ga0075433_107639052 132
11 3300009094 Ga0111539_10622863 Ga0111539_106228632 132
12 3300025925 Ga0207650_11351855 Ga0207650_113518551 132
13 3300025931 Ga0207644_10153353 Ga0207644_101533533 132
14 3300025936 Ga0207670_10683746 Ga0207670_106837461 132
15 3300031548 Ga0307408_102123352 Ga0307408_1021233521 132
16 3300031731 Ga0307405_10094410 Ga0307405_100944102 132
17 3300031852 Ga0307410_12047671 Ga0307410_120476711 132
18 3300031911 Ga0307412_10022583 Ga0307412_100225835 132
19 3300032004 Ga0307414_10956195 Ga0307414_109561951 132
20 3300035112 Ga0373932_0328478 Ga0373932_0328478_97_495 132
21 3300041997 Ga0439431_0001996 Ga0439431_0001996_1065_1478 132
22 3300042004 Ga0439445_0023756 Ga0439445_0023756_509_922 132
23 3300042007 Ga0439449_0065149 Ga0439449_0065149_251_664 132
24 3300049519 Ga0501296_010964 Ga0501296_010964_71_469 132
25 3300049570 Ga0501033_0263697 Ga0501033_0263697_181_579 132
26 3300049571 Ga0501034_0197271 Ga0501034_0197271_870_1268 132
27 3300049663 Ga0501223_000832 Ga0501223_000832_539_937 132
28 3300049688 Ga0501259_054182 Ga0501259_054182_314_712 132
29 3300049742 Ga0501080_0976762 Ga0501080_0976762_48_446 132
30 3300049822 Ga0501035_0163233 Ga0501035_0163233_1476_1874 132
31 3300049823 Ga0501044_0038763 Ga0501044_0038763_1864_2262 132
32 3300050515 nmdc:mga0a205_1024710_c1 nmdc:mga0a205_1024710_c1_96_494 132
33 3300003320 rootH2_10279877 rootH2_102798772 133
34 3300003322 rootL2_10071475 rootL2_100714753 133
35 3300003323 rootH1_10383042 rootH1_103830422 133
36 3300005262 Ga0065165_1046865 Ga0065165_10468652 133
37 3300005295 Ga0065707_10333395 Ga0065707_103333952 133
38 3300005331 Ga0070670_100138592 Ga0070670_1001385922 133
39 3300005339 Ga0070660_100276599 Ga0070660_1002765992 133
40 3300005343 Ga0070687_100821612 Ga0070687_1008216121 133
41 3300005344 Ga0070661_101186356 Ga0070661_1011863561 133
42 3300005347 Ga0070668_100162607 Ga0070668_1001626072 133
43 3300005354 Ga0070675_100251705 Ga0070675_1002517052 133
44 3300005354 Ga0070675_100297763 Ga0070675_1002977632 133
45 3300005366 Ga0070659_100009518 Ga0070659_1000095183 133
46 3300005458 Ga0070681_10811036 Ga0070681_108110361 133
47 3300005459 Ga0068867_100920863 Ga0068867_1009208631 133
48 3300005459 Ga0068867_101322796 Ga0068867_1013227961 133
49 3300005539 Ga0068853_100010663 Ga0068853_1000106634 133
50 3300005539 Ga0068853_100022485 Ga0068853_1000224852 133
51 3300005539 Ga0068853_100322506 Ga0068853_1003225062 133
52 3300005543 Ga0070672_100617362 Ga0070672_1006173621 133
53 3300005548 Ga0070665_100000003 Ga0070665_100000003119 133
54 3300005563 Ga0068855_100698044 Ga0068855_1006980442 133
55 3300005578 Ga0068854_100497125 Ga0068854_1004971252 133
56 3300005616 Ga0068852_100000721 Ga0068852_10000072112 133
57 3300005616 Ga0068852_100500317 Ga0068852_1005003172 133
58 3300005841 Ga0068863_101293064 Ga0068863_1012930642 133
59 3300006195 Ga0075366_10108627 Ga0075366_101086272 133
60 3300006237 Ga0097621_100732694 Ga0097621_1007326943 133
61 3300006353 Ga0075370_10802160 Ga0075370_108021601 133
62 3300006844 Ga0075428_100003670 Ga0075428_10000367013 133
63 3300006880 Ga0075429_100002957 Ga0075429_1000029578 133
64 3300009147 Ga0114129_10027575 Ga0114129_100275755 133
65 3300009545 Ga0105237_10006020 Ga0105237_100060204 133
66 3300009553 Ga0105249_10069244 Ga0105249_100692442 133
67 3300010375 Ga0105239_10006051 Ga0105239_1000605111 133
68 3300010375 Ga0105239_13513242 Ga0105239_135132421 133
69 3300013100 Ga0157373_10024488 Ga0157373_100244885 133
70 3300013105 Ga0157369_10022350 Ga0157369_100223509 133
71 3300013296 Ga0157374_10000013 Ga0157374_1000001377 133
72 3300013306 Ga0163162_10000024 Ga0163162_1000002491 133
73 3300013306 Ga0163162_11953474 Ga0163162_119534742 133
74 3300013307 Ga0157372_10950339 Ga0157372_109503392 133
75 3300013308 Ga0157375_12826172 Ga0157375_128261721 133
76 3300014325 Ga0163163_10002634 Ga0163163_100026347 133
77 3300014326 Ga0157380_10082388 Ga0157380_100823882 133
78 3300014326 Ga0157380_11622615 Ga0157380_116226152 133
79 3300014326 Ga0157380_11628112 Ga0157380_116281121 133
80 3300014326 Ga0157380_12846026 Ga0157380_128460261 133
81 3300014969 Ga0157376_10012161 Ga0157376_100121612 133
82 3300014969 Ga0157376_10110499 Ga0157376_101104991 133
83 3300014969 Ga0157376_10263577 Ga0157376_102635772 133
84 3300017792 Ga0163161_11349407 Ga0163161_113494071 133
85 3300025208 Ga0209436_103174 Ga0209436_1031742 133
86 3300025302 Ga0207426_1049398 Ga0207426_10493981 133
87 3300025904 Ga0207647_10000088 Ga0207647_1000008850 133
88 3300025912 Ga0207707_10749784 Ga0207707_107497842 133
89 3300025914 Ga0207671_10040060 Ga0207671_100400604 133
90 3300025925 Ga0207650_10135342 Ga0207650_101353422 133
91 3300025925 Ga0207650_10374701 Ga0207650_103747012 133
92 3300025926 Ga0207659_10637063 Ga0207659_106370632 133
93 3300025931 Ga0207644_10139270 Ga0207644_101392702 133
94 3300025932 Ga0207690_10090301 Ga0207690_100903013 133
95 3300025940 Ga0207691_10592060 Ga0207691_105920601 133
96 3300025940 Ga0207691_10599565 Ga0207691_105995652 133
97 3300025981 Ga0207640_10751189 Ga0207640_107511891 133
98 3300026041 Ga0207639_10013337 Ga0207639_100133378 133
99 3300026041 Ga0207639_10059768 Ga0207639_100597682 133
100 3300026088 Ga0207641_11234342 Ga0207641_112343421 133
101 3300026142 Ga0207698_11037939 Ga0207698_110379392 133
102 3300027471 Ga0209995_1028654 Ga0209995_10286542 133
103 3300027543 Ga0209999_1054887 Ga0209999_10548871 133
104 3300028379 Ga0268266_10000137 Ga0268266_10000137116 133
105 3300031251 Ga0265327_10000059 Ga0265327_1000005951 133
106 3300031911 Ga0307412_10062627 Ga0307412_100626272 133
107 3300039450 Ga0436363_1166034 Ga0436363_1166034_36_437 133
108 3300041494 Ga0451837_0677132 Ga0451837_0677132_275_676 133
109 3300042001 Ga0439441_035434 Ga0439441_035434_456_857 133
110 3300044684 Ga0466966_0453339 Ga0466966_0453339_219_620 133
111 3300044693 Ga0466961_0139002 Ga0466961_0139002_680_1081 133
112 3300045836 Ga0466958_0052081 Ga0466958_0052081_916_1317 133
113 3300046543 Ga0495645_0130367 Ga0495645_0130367_125_526 133
114 3300046558 Ga0495633_0123311 Ga0495633_0123311_351_752 133
115 3300046675 Ga0495657_0773372 Ga0495657_0773372_136_537 133
116 3300046809 Ga0495600_0849631 Ga0495600_0849631_83_484 133
117 3300047318 Ga0495636_0000184 Ga0495636_0000184_14376_14777 133
118 3300048908 Ga0496105_1062915 Ga0496105_1062915_97_498 133
119 3300048926 Ga0496123_0294804 Ga0496123_0294804_235_636 133
120 3300049569 Ga0501032_0056259 Ga0501032_0056259_214_615 133
121 3300049571 Ga0501034_0063339 Ga0501034_0063339_2136_2537 133
122 3300049571 Ga0501034_0437755 Ga0501034_0437755_668_1069 133
123 3300049572 Ga0501036_0012620 Ga0501036_0012620_6565_6966 133
124 3300049573 Ga0501037_0081838 Ga0501037_0081838_759_1160 133
125 3300049574 Ga0501038_0161984 Ga0501038_0161984_480_881 133
126 3300049575 Ga0501039_0110373 Ga0501039_0110373_1141_1542 133
127 3300049579 Ga0501043_0140885 Ga0501043_0140885_529_930 133
128 3300049580 Ga0501046_0015843 Ga0501046_0015843_1478_1879 133
129 3300049581 Ga0501047_0232082 Ga0501047_0232082_782_1183 133
130 3300049582 Ga0501048_0011105 Ga0501048_0011105_702_1103 133
131 3300049583 Ga0501067_0019967 Ga0501067_0019967_1436_1837 133
132 3300049586 Ga0501070_0019668 Ga0501070_0019668_349_750 133
133 3300049589 Ga0501073_0017381 Ga0501073_0017381_1997_2398 133
134 3300049590 Ga0501074_0062415 Ga0501074_0062415_1507_1908 133
135 3300049593 Ga0501077_0768129 Ga0501077_0768129_186_587 133
136 3300049742 Ga0501080_0356758 Ga0501080_0356758_776_1177 133
137 3300049822 Ga0501035_0093581 Ga0501035_0093581_1827_2228 133
138 3300049822 Ga0501035_0361423 Ga0501035_0361423_648_1049 133
139 3300049823 Ga0501044_0016771 Ga0501044_0016771_445_846 133
140 3300050493 nmdc:mga0k408_88685_c1 nmdc:mga0k408_88685_c1_981_1382 133
141 3300050507 nmdc:mga05p37_105267_c1 nmdc:mga05p37_105267_c1_2838_3239 133
142 3300050508 nmdc:mga09592_1410_c1 nmdc:mga09592_1410_c1_11859_12260 133
143 3300050509 nmdc:mga0qj67_72382_c1 nmdc:mga0qj67_72382_c1_763_1164 133
144 3300053139 Ga0500568_0001401 Ga0500568_0001401_5020_5421 133
145 3300061719 Ga0466962_0025642 Ga0466962_0025642_1458_1859 133
146 3300005563 Ga0068855_100046588 Ga0068855_1000465888 134
147 3300005614 Ga0068856_100007833 Ga0068856_1000078332 134
148 3300006163 Ga0070715_10210727 Ga0070715_102107271 134
149 3300006237 Ga0097621_100025409 Ga0097621_1000254092 134
150 3300006358 Ga0068871_100015821 Ga0068871_1000158217 134
151 3300009093 Ga0105240_10939493 Ga0105240_109394932 134
152 3300009174 Ga0105241_10006050 Ga0105241_100060508 134
153 3300009545 Ga0105237_10070483 Ga0105237_100704834 134
154 3300013104 Ga0157370_10035808 Ga0157370_100358085 134
155 3300013297 Ga0157378_10014637 Ga0157378_100146374 134
156 3300013306 Ga0163162_10167141 Ga0163162_101671412 134
157 3300013307 Ga0157372_12438760 Ga0157372_124387601 134
158 3300014968 Ga0157379_10275660 Ga0157379_102756603 134
159 3300014969 Ga0157376_10485985 Ga0157376_104859852 134
160 3300017792 Ga0163161_10325779 Ga0163161_103257792 134
161 3300025911 Ga0207654_10024149 Ga0207654_100241494 134
162 3300025913 Ga0207695_10633195 Ga0207695_106331952 134
163 3300025914 Ga0207671_10153151 Ga0207671_101531513 134
164 3300025949 Ga0207667_10008349 Ga0207667_100083493 134
165 3300025986 Ga0207658_11054468 Ga0207658_110544682 134
166 3300026041 Ga0207639_10871225 Ga0207639_108712251 134
167 3300026078 Ga0207702_10270206 Ga0207702_102702061 134
168 3300028381 Ga0268264_10563392 Ga0268264_105633922 134
169 3300031251 Ga0265327_10127875 Ga0265327_101278753 134
170 3300031911 Ga0307412_10520916 Ga0307412_105209162 134
171 3300044656 Ga0466969_0000220 Ga0466969_0000220_28088_28561 134
172 3300044683 Ga0466965_0060645 Ga0466965_0060645_213_617 134
173 3300044684 Ga0466966_0000215 Ga0466966_0000215_11883_12356 134
174 3300044706 Ga0466964_0281404 Ga0466964_0281404_145_549 134
175 3300044735 Ga0466968_0585444 Ga0466968_0585444_69_473 134
176 3300044765 Ga0466970_0176089 Ga0466970_0176089_153_626 134
177 3300045049 Ga0466959_0000004 Ga0466959_0000004_65001_65474 134
178 3300047472 Ga0495686_0015427 Ga0495686_0015427_4105_4509 134
179 3300048907 Ga0496104_0656281 Ga0496104_0656281_368_772 134
180 3300049776 Ga0501280_078994 Ga0501280_078994_49_453 134
181 3300053125 Ga0500618_149682 Ga0500618_149682_21_425 134
182 3300053157 Ga0500624_109667 Ga0500624_109667_42_446 134
183 3300053177 Ga0500636_0201691 Ga0500636_0201691_527_931 134
184 3300061719 Ga0466962_0316753 Ga0466962_0316753_69_542 134
185 3300061719 Ga0466962_0337070 Ga0466962_0337070_331_735 134
186 3300003320 rootH2_10016199 rootH2_1001619982 135
187 3300005295 Ga0065707_10008308 Ga0065707_100083083 135
188 3300005327 Ga0070658_10131120 Ga0070658_101311202 135
189 3300005327 Ga0070658_11378941 Ga0070658_113789411 135
190 3300005331 Ga0070670_100017990 Ga0070670_1000179907 135
191 3300005331 Ga0070670_100370289 Ga0070670_1003702892 135
192 3300005336 Ga0070680_101984242 Ga0070680_1019842421 135
193 3300005339 Ga0070660_100204940 Ga0070660_1002049401 135
194 3300005344 Ga0070661_100918438 Ga0070661_1009184381 135
195 3300005366 Ga0070659_100085850 Ga0070659_1000858502 135
196 3300005367 Ga0070667_101610865 Ga0070667_1016108651 135
197 3300005459 Ga0068867_100952750 Ga0068867_1009527502 135
198 3300005471 Ga0070698_100011419 Ga0070698_1000114199 135
199 3300005530 Ga0070679_100046564 Ga0070679_1000465643 135
200 3300005535 Ga0070684_100674030 Ga0070684_1006740301 135
201 3300005539 Ga0068853_100052784 Ga0068853_1000527843 135
202 3300005563 Ga0068855_100002796 Ga0068855_10000279618 135
203 3300005563 Ga0068855_100029930 Ga0068855_1000299307 135
204 3300005577 Ga0068857_100003733 Ga0068857_1000037338 135
205 3300005578 Ga0068854_102136195 Ga0068854_1021361951 135
206 3300005616 Ga0068852_100008334 Ga0068852_1000083342 135
207 3300005616 Ga0068852_100220305 Ga0068852_1002203052 135
208 3300005844 Ga0068862_101507580 Ga0068862_1015075801 135
209 3300005985 Ga0081539_10000337 Ga0081539_1000033765 135
210 3300006358 Ga0068871_100212777 Ga0068871_1002127771 135
211 3300006844 Ga0075428_100126399 Ga0075428_1001263993 135
212 3300009093 Ga0105240_10033651 Ga0105240_100336516 135
213 3300009093 Ga0105240_10076593 Ga0105240_100765932 135
214 3300009176 Ga0105242_10659816 Ga0105242_106598162 135
215 3300009545 Ga0105237_10247239 Ga0105237_102472392 135
216 3300009551 Ga0105238_10010778 Ga0105238_100107784 135
217 3300009551 Ga0105238_11070049 Ga0105238_110700492 135
218 3300009553 Ga0105249_10018068 Ga0105249_100180687 135
219 3300009553 Ga0105249_11193945 Ga0105249_111939452 135
220 3300013102 Ga0157371_10006615 Ga0157371_100066155 135
221 3300013104 Ga0157370_10000530 Ga0157370_100005304 135
222 3300013104 Ga0157370_10004932 Ga0157370_100049322 135
223 3300013104 Ga0157370_11026311 Ga0157370_110263111 135
224 3300013306 Ga0163162_10009475 Ga0163162_100094752 135
225 3300013307 Ga0157372_10068320 Ga0157372_100683204 135
226 3300014325 Ga0163163_10768910 Ga0163163_107689101 135
227 3300014326 Ga0157380_10115843 Ga0157380_101158432 135
228 3300014968 Ga0157379_10107165 Ga0157379_101071653 135
229 3300014969 Ga0157376_10046111 Ga0157376_100461113 135
230 3300014969 Ga0157376_10068941 Ga0157376_100689413 135
231 3300014969 Ga0157376_11282241 Ga0157376_112822412 135
232 3300025909 Ga0207705_10077816 Ga0207705_100778163 135
233 3300025909 Ga0207705_10198203 Ga0207705_101982032 135
234 3300025913 Ga0207695_10030834 Ga0207695_100308342 135
235 3300025913 Ga0207695_10104729 Ga0207695_101047292 135
236 3300025914 Ga0207671_10324416 Ga0207671_103244162 135
237 3300025917 Ga0207660_11721829 Ga0207660_117218291 135
238 3300025920 Ga0207649_11514437 Ga0207649_115144371 135
239 3300025924 Ga0207694_10031432 Ga0207694_100314322 135
240 3300025925 Ga0207650_10137023 Ga0207650_101370232 135
241 3300025932 Ga0207690_10764846 Ga0207690_107648462 135
242 3300025938 Ga0207704_10868699 Ga0207704_108686992 135
243 3300025949 Ga0207667_10001252 Ga0207667_1000125223 135
244 3300025949 Ga0207667_10014871 Ga0207667_100148715 135
245 3300025949 Ga0207667_10312054 Ga0207667_103120543 135
246 3300025961 Ga0207712_10002584 Ga0207712_100025849 135
247 3300025986 Ga0207658_11516652 Ga0207658_115166521 135
248 3300026041 Ga0207639_10170552 Ga0207639_101705522 135
249 3300026089 Ga0207648_10753186 Ga0207648_107531862 135
250 3300026116 Ga0207674_10018104 Ga0207674_100181043 135
251 3300026118 Ga0207675_100787579 Ga0207675_1007875792 135
252 3300026142 Ga0207698_10276967 Ga0207698_102769672 135
253 3300028380 Ga0268265_10381463 Ga0268265_103814632 135
254 3300028794 Ga0307515_10000001 Ga0307515_100000011957 135
255 3300035113 Ga0373936_0105719 Ga0373936_0105719_610_1026 135
256 3300036401 Ga0373937_0421941 Ga0373937_0421941_323_733 135
257 3300037312 Ga0395899_0006115 Ga0395899_0006115_6913_7335 135
258 3300037418 Ga0395900_0005147 Ga0395900_0005147_11233_11655 135
259 3300037466 Ga0395898_0006832 Ga0395898_0006832_34_456 135
260 3300038443 Ga0395901_0003679 Ga0395901_0003679_2256_2678 135
261 3300041505 Ga0451849_0693361 Ga0451849_0693361_464_880 135
262 3300046519 Ga0495632_0287360 Ga0495632_0287360_102_515 135
263 3300046543 Ga0495645_0453261 Ga0495645_0453261_298_714 135
264 3300046616 Ga0495668_0001516 Ga0495668_0001516_13594_14019 135
265 3300046660 Ga0495625_0381203 Ga0495625_0381203_413_829 135
266 3300046694 Ga0495649_0208484 Ga0495649_0208484_535_951 135
267 3300047320 Ga0495672_0017615 Ga0495672_0017615_2435_2860 135
268 3300048088 Ga0495602_0279283 Ga0495602_0279283_495_905 135
269 3300049823 Ga0501044_0101873 Ga0501044_0101873_955_1362 135
270 3300053146 Ga0500588_0003130 Ga0500588_0003130_1476_1892 135
271 3300053153 Ga0500616_0003892 Ga0500616_0003892_2925_3332 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

127

0.97

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

114

0.93

PF13468

Glyoxalase_3

Glyoxalase-like domain

4

129

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9581 3 135
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.9505 4 133
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9395 1 131
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9388 1 131
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9374 3 135
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9754 3 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9573 4 133 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9468 3 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9165 4 133 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 2 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1J5P6T6-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.998 21 132 GO:0004493
GO:0046491
GO:0046872
GO:0051213
AF-A0A7J5EFK0-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9979 1 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A2H9VTV2-F1-model_v4 Methylmalonyl-CoA/ethylmalonyl-CoA epimerase 0.9972 2 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V3MXE8-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9972 1 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A3C2AIF1-F1-model_v4 Methylmalonyl-CoA epimerase 0.9971 1 112 GO:0004493
GO:0046491
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map