F377449

General Info

Members Datasets Scaffolds Average Seq Length
271 161 542 303

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100013134|Ga0070682_1000131341
Length 347
Sequence VPPLFFEDEEQKSKSTPGQSIFLFTNKRTCIYYLIFKIYXXXXMNKHFRKLTALLFFIYTYNTYAQTSPVQNIFPQGTITYSNIPYANDTLKKHLLDIYLPQNAKSNTPLVIWIHGGAWMLNDKYADMGYMKNTVKGFIDNGYALASINYRYSTEAAFPAQIQDCNEALEFLYQHAAQYKIDKDRVALIGFSAGGHLASLMGLSNNNDIKEFYPNGNKPHFKIKCVLDFYGPSDFIMLASNPDTSVNNMRNPVSILLGAMAVDRPDLAKRASPVTYIDKNDPPFFIVQGEKDESVPNTQSRILSSWLTLAGVKNKLTVVPNAPHYGEMFDAESIRKDLFQFLAENLK

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
157 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
158 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
159 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
160 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
161 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 0
Rhizoplane 0.74
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 8.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100013134 3300005337 Bacteria 4757
2 JGI24739J22299_10000277 3300001989 Bacteria 17174
3 JGI24739J22299_10003846 3300001989 Bacteria 5730
4 JGI24739J22299_10012057 3300001989 Bacteria 3176
5 JGI24737J22298_10000218 3300001990 Bacteria 18823
6 JGI24743J22301_10012060 3300001991 Bacteria 1566
7 JGI24735J21928_10000001 3300002067 Bacteria 650042
8 JGI24744J21845_10001323 3300002077 Bacteria 4893
9 JGI25162J39368_1000427 3300002737 Bacteria 33903
10 JGI25164J39214_1003221 3300002772 Bacteria 2141
11 JGI25165J46597_1000548 3300003214 Bacteria 34311
12 rootH1_10040535 3300003316 Bacteria 1942
13 rootH1_10056014 3300003316 Bacteria 5781
14 rootH2_10105467 3300003320 Unclassified 2468
15 rootL2_10040009 3300003322 Bacteria 11488
16 rootH1_10029634 3300003323 Bacteria 17261
17 rootH1_10039695 3300003323 Bacteria 4005
18 JGI25160J50197_1005161 3300003354 Bacteria 5483
19 Ga0055526_1007839 3300003771 Bacteria 5461
20 Ga0055528_1000180 3300003790 Bacteria 53597
21 Ga0055530_10005213 3300003791 Bacteria 6300
22 Ga0055530_10037242 3300003791 Bacteria 1218
23 Ga0065165_1000019 3300005262 Bacteria 271815
24 Ga0070658_10005770 3300005327 Bacteria 10042
25 Ga0070658_10220277 3300005327 Bacteria 1604
26 Ga0070676_10000502 3300005328 Bacteria 18694
27 Ga0070683_100031413 3300005329 Bacteria 4828
28 Ga0070683_100068628 3300005329 Bacteria 3303
29 Ga0070670_100284605 3300005331 Bacteria 1444
30 Ga0068869_100155453 3300005334 Bacteria 1777
31 Ga0070666_10019170 3300005335 Unclassified 4413
32 Ga0070680_100014280 3300005336 Bacteria 6203
33 Ga0070680_100056145 3300005336 Bacteria 3218
34 Ga0068868_100051054 3300005338 Bacteria 3250
35 Ga0068868_100359154 3300005338 Bacteria 1249
36 Ga0070660_100069201 3300005339 Unclassified 2752
37 Ga0070660_100230010 3300005339 Bacteria 1509
38 Ga0070671_100022711 3300005355 Bacteria 5126
39 Ga0070673_100028690 3300005364 Bacteria 4141
40 Ga0070678_100003211 3300005456 Bacteria 9073
41 Ga0070678_100009089 3300005456 Bacteria 5994
42 Ga0070678_100027983 3300005456 Bacteria 3836
43 Ga0070662_100000103 3300005457 Bacteria 46838
44 Ga0070662_100047078 3300005457 Bacteria 3100
45 Ga0070681_10003760 3300005458 Bacteria 14247
46 Ga0068867_100003777 3300005459 Bacteria 10659
47 Ga0068867_100066140 3300005459 Unclassified 2692
48 Ga0068867_100235279 3300005459 Unclassified 1483
49 Ga0070679_100162606 3300005530 Bacteria 2206
50 Ga0070684_100647895 3300005535 Bacteria 983
51 Ga0068853_100031627 3300005539 Bacteria 4477
52 Ga0068853_100076126 3300005539 Bacteria 2930
53 Ga0068853_100134122 3300005539 Bacteria 2218
54 Ga0070672_100268264 3300005543 Unclassified 1441
55 Ga0070665_100000083 3300005548 Bacteria 181044
56 Ga0068855_100021807 3300005563 Bacteria 7683
57 Ga0068855_100040583 3300005563 Bacteria 5524
58 Ga0070664_100130770 3300005564 Bacteria 2205
59 Ga0068857_100071157 3300005577 Bacteria 3099
60 Ga0068856_100066515 3300005614 Bacteria 3561
61 Ga0068852_100005449 3300005616 Bacteria 9100
62 Ga0068864_100238527 3300005618 Bacteria 1684
63 Ga0068870_10032246 3300005840 Bacteria 2661
64 Ga0068863_100046687 3300005841 Bacteria 4111
65 Ga0068858_100259589 3300005842 Bacteria 1651
66 Ga0068860_100006989 3300005843 Bacteria 11309
67 Ga0068860_100039186 3300005843 Bacteria 4533
68 Ga0068860_100042069 3300005843 Bacteria 4366
69 Ga0068860_100063866 3300005843 Unclassified 3497
70 Ga0075366_10002823 3300006195 Bacteria 8994
71 Ga0097621_100000041 3300006237 Bacteria 66329
72 Ga0097621_100000278 3300006237 Bacteria 34561
73 Ga0097621_100008188 3300006237 Bacteria 7519
74 Ga0097621_100016252 3300006237 Bacteria 5620
75 Ga0068871_100000825 3300006358 Bacteria 20742
76 Ga0068871_100003606 3300006358 Bacteria 10633
77 Ga0068871_100020660 3300006358 Bacteria 5049
78 Ga0068871_100023990 3300006358 Bacteria 4727
79 Ga0068871_100352908 3300006358 Bacteria 1301
80 Ga0075428_100039278 3300006844 Bacteria 5208
81 Ga0068865_100030425 3300006881 Bacteria 3591
82 Ga0097620_100263828 3300006931 Bacteria 1814
83 Ga0105240_10003660 3300009093 Bacteria 23789
84 Ga0105240_10005530 3300009093 Bacteria 18821
85 Ga0105240_10012588 3300009093 Bacteria 11667
86 Ga0105240_10095743 3300009093 Bacteria 3619
87 Ga0105240_10102814 3300009093 Bacteria 3472
88 Ga0105240_10154766 3300009093 Bacteria 2728
89 Ga0105241_10000775 3300009174 Bacteria 24313
90 Ga0105242_10057161 3300009176 Unclassified 3193
91 Ga0105242_10153543 3300009176 Bacteria 2009
92 Ga0105242_10199204 3300009176 Unclassified 1778
93 Ga0105237_10001839 3300009545 Bacteria 27294
94 Ga0105237_10004837 3300009545 Bacteria 15473
95 Ga0105237_10005970 3300009545 Bacteria 13644
96 Ga0105238_10083451 3300009551 Bacteria 3184
97 Ga0105239_10003720 3300010375 Bacteria 18575
98 Ga0105239_10030957 3300010375 Bacteria 5887
99 Ga0105239_10056980 3300010375 Bacteria 4286
100 Ga0157373_10004673 3300013100 Bacteria 10295
101 Ga0157373_10073893 3300013100 Bacteria 2405
102 Ga0157373_10213975 3300013100 Bacteria 1359
103 Ga0157371_10001841 3300013102 Bacteria 21386
104 Ga0157371_10003210 3300013102 Bacteria 15011
105 Ga0157371_10008924 3300013102 Bacteria 7938
106 Ga0157371_10011875 3300013102 Bacteria 6685
107 Ga0157371_10034349 3300013102 Bacteria 3638
108 Ga0157371_10101938 3300013102 Unclassified 2036
109 Ga0157371_10118802 3300013102 Bacteria 1879
110 Ga0157371_10153353 3300013102 Bacteria 1643
111 Ga0157370_10090837 3300013104 Bacteria 2867
112 Ga0157370_10132356 3300013104 Bacteria 2326
113 Ga0157369_10204379 3300013105 Unclassified 2072
114 Ga0157374_10000129 3300013296 Bacteria 69468
115 Ga0157374_10003215 3300013296 Bacteria 13719
116 Ga0157374_10074921 3300013296 Bacteria 3197
117 Ga0157378_10005613 3300013297 Bacteria 10990
118 Ga0157378_10016153 3300013297 Bacteria 6537
119 Ga0157378_10020697 3300013297 Bacteria 5786
120 Ga0157378_10084353 3300013297 Bacteria 2876
121 Ga0157378_10090839 3300013297 Bacteria 2775
122 Ga0163162_10007649 3300013306 Bacteria 10525
123 Ga0163162_10136508 3300013306 Unclassified 2564
124 Ga0157372_10010840 3300013307 Bacteria 9704
125 Ga0157372_10011467 3300013307 Bacteria 9425
126 Ga0157372_10028706 3300013307 Bacteria 6074
127 Ga0157372_10062223 3300013307 Unclassified 4181
128 Ga0157372_10179638 3300013307 Unclassified 2449
129 Ga0157372_10232679 3300013307 Bacteria 2137
130 Ga0157372_10307232 3300013307 Bacteria 1845
131 Ga0157375_10000857 3300013308 Bacteria 26479
132 Ga0157375_10114797 3300013308 Bacteria 2795
133 Ga0157375_10119385 3300013308 Bacteria 2744
134 Ga0157375_10259471 3300013308 Bacteria 1899
135 Ga0157375_10283095 3300013308 Bacteria 1821
136 Ga0163163_10002460 3300014325 Bacteria 15651
137 Ga0157379_10002909 3300014968 Bacteria 14457
138 Ga0157379_10390211 3300014968 Bacteria 1278
139 Ga0157376_10018227 3300014969 Bacteria 5376
140 Ga0157376_10246210 3300014969 Bacteria 1668
141 Ga0163161_10003589 3300017792 Bacteria 10873
142 Ga0207427_100090 3300025231 Bacteria 133759
143 Ga0209437_100034 3300025233 Bacteria 494007
144 Ga0209233_1000038 3300025261 Bacteria 548972
145 Ga0209455_1001458 3300025272 Bacteria 10640
146 Ga0209673_1000042 3300025273 Bacteria 300704
147 Ga0209564_1000840 3300025295 Bacteria 41373
148 Ga0209564_1003122 3300025295 Bacteria 11698
149 Ga0209564_1004207 3300025295 Bacteria 8973
150 Ga0209758_1001003 3300025297 Bacteria 37543
151 Ga0209758_1005063 3300025297 Bacteria 10452
152 Ga0209050_1000308 3300025298 Bacteria 99516
153 Ga0209050_1004552 3300025298 Bacteria 9310
154 Ga0209050_1040256 3300025298 Bacteria 1304
155 Ga0207426_1000442 3300025302 Bacteria 66642
156 Ga0207426_1000934 3300025302 Bacteria 29145
157 Ga0207426_1002510 3300025302 Bacteria 11539
158 Ga0209257_1001059 3300025304 Bacteria 36382
159 Ga0209257_1033383 3300025304 Bacteria 1619
160 Ga0207680_10200553 3300025903 Unclassified 1359
161 Ga0207680_10305067 3300025903 Unclassified 1110
162 Ga0207647_10000062 3300025904 Bacteria 83809
163 Ga0207645_10000224 3300025907 Bacteria 46998
164 Ga0207705_10007695 3300025909 Bacteria 7919
165 Ga0207654_10002243 3300025911 Bacteria 9913
166 Ga0207707_10071395 3300025912 Bacteria 3026
167 Ga0207695_10003717 3300025913 Bacteria 21241
168 Ga0207695_10120982 3300025913 Bacteria 2586
169 Ga0207695_10181896 3300025913 Bacteria 2023
170 Ga0207671_10000961 3300025914 Bacteria 35766
171 Ga0207671_10005876 3300025914 Bacteria 11140
172 Ga0207671_10075589 3300025914 Bacteria 2520
173 Ga0207660_10008783 3300025917 Bacteria 6531
174 Ga0207657_10010543 3300025919 Bacteria 9215
175 Ga0207657_10097182 3300025919 Bacteria 2449
176 Ga0207657_10202134 3300025919 Bacteria 1598
177 Ga0207652_10000180 3300025921 Bacteria 66974
178 Ga0207652_10013779 3300025921 Bacteria 6539
179 Ga0207652_10139550 3300025921 Bacteria 2167
180 Ga0207694_10050519 3300025924 Bacteria 3221
181 Ga0207659_10013529 3300025926 Bacteria 5231
182 Ga0207644_10014794 3300025931 Bacteria 5229
183 Ga0207706_10000851 3300025933 Bacteria 31416
184 Ga0207686_10181069 3300025934 Bacteria 1494
185 Ga0207704_10000037 3300025938 Bacteria 93990
186 Ga0207691_10223148 3300025940 Unclassified 1633
187 Ga0207689_10003933 3300025942 Bacteria 13528
188 Ga0207689_10004503 3300025942 Bacteria 12609
189 Ga0207689_10180492 3300025942 Bacteria 1741
190 Ga0207661_10050434 3300025944 Bacteria 3316
191 Ga0207667_10017568 3300025949 Bacteria 8045
192 Ga0207667_10032715 3300025949 Bacteria 5599
193 Ga0207667_10137265 3300025949 Bacteria 2518
194 Ga0207712_10083923 3300025961 Bacteria 2326
195 Ga0207640_10321378 3300025981 Bacteria 1232
196 Ga0207677_10079381 3300026023 Bacteria 2347
197 Ga0207703_10225365 3300026035 Unclassified 1678
198 Ga0207703_10401445 3300026035 Bacteria 1272
199 Ga0207639_10019750 3300026041 Bacteria 4811
200 Ga0207639_10092274 3300026041 Bacteria 2427
201 Ga0207678_10067428 3300026067 Unclassified 3072
202 Ga0207641_10041194 3300026088 Bacteria 3870
203 Ga0207648_10000241 3300026089 Bacteria 58974
204 Ga0207648_10081251 3300026089 Unclassified 2827
205 Ga0207648_10282598 3300026089 Unclassified 1484
206 Ga0207674_10400500 3300026116 Bacteria 1326
207 Ga0207675_100042377 3300026118 Bacteria 4250
208 Ga0207683_10006368 3300026121 Bacteria 10109
209 Ga0207683_10025601 3300026121 Bacteria 5091
210 Ga0207683_10144098 3300026121 Bacteria 2147
211 Ga0207698_10004698 3300026142 Bacteria 8353
212 Ga0268266_10000095 3300028379 Bacteria 186169
213 Ga0268264_10004919 3300028381 Bacteria 11321
214 Ga0268264_10016575 3300028381 Bacteria 6034
215 Ga0268264_10221081 3300028381 Bacteria 1743
216 Ga0307517_10000719 3300028786 Bacteria 56987
217 Ga0307515_10004038 3300028794 Bacteria 30636
218 Ga0307515_10006107 3300028794 Bacteria 24219
219 Ga0307513_10111269 3300031456 Bacteria 2732
220 Ga0307510_10006060 3300033180 Bacteria 14412
221 Ga0395899_0078159 3300037312 Bacteria 2412
222 Ga0395900_0001938 3300037418 Bacteria 23442
223 Ga0395900_0028047 3300037418 Bacteria 5764
224 Ga0395905_0019529 3300037471 Bacteria 6424
225 Ga0395905_0086521 3300037471 Bacteria 2938
226 Ga0395901_0105192 3300038443 Unclassified 2962
227 Ga0436365_0298838 3300039437 Bacteria 7530
228 Ga0451577_0052118 3300042876 Unclassified 3654
229 Ga0466970_0000119 3300044765 Bacteria 35288
230 Ga0495638_0000005 3300046460 Bacteria 680627
231 Ga0495650_0000014 3300046471 Bacteria 581606
232 Ga0495585_0001451 3300046492 Bacteria 18615
233 Ga0495585_0002526 3300046492 Bacteria 13003
234 Ga0495606_0000241 3300046507 Bacteria 96663
235 Ga0495610_0001644 3300046512 Bacteria 19645
236 Ga0495610_0064205 3300046512 Bacteria 1736
237 Ga0495616_0001895 3300046513 Bacteria 14129
238 Ga0495628_0190621 3300046516 Bacteria 1548
239 Ga0495648_0005339 3300046524 Bacteria 10707
240 Ga0495648_0167026 3300046524 Bacteria 1131
241 Ga0495654_0013201 3300046530 Bacteria 4424
242 Ga0495609_0001800 3300046538 Bacteria 13764
243 Ga0495633_0011124 3300046558 Bacteria 4877
244 Ga0495668_0002237 3300046616 Bacteria 16368
245 Ga0495625_0000003 3300046660 Bacteria 686847
246 Ga0495625_0000381 3300046660 Bacteria 67732
247 Ga0495625_0003720 3300046660 Bacteria 14873
248 Ga0495625_0019500 3300046660 Bacteria 5260
249 Ga0495669_0058147 3300046684 Bacteria 1745
250 Ga0495649_0000002 3300046694 Bacteria 1093458
251 Ga0495649_0080274 3300046694 Unclassified 1745
252 Ga0495683_0035898 3300047323 Bacteria 2519
253 Ga0495687_002135 3300047443 Bacteria 16518
254 Ga0495687_003277 3300047443 Bacteria 11922
255 Ga0495686_0004577 3300047472 Bacteria 11288
256 Ga0496114_0047361 3300048917 Bacteria 3577
257 Ga0495678_012200 3300049459 Bacteria 4081
258 nmdc:mga0k408_1219_c1 3300050493 Bacteria 14084
259 nmdc:mga07m45_93620_c1 3300050496 Bacteria 1722
260 Ga0500635_0033940 3300053080 Bacteria 1668
261 Ga0500608_009310 3300053122 Bacteria 4166
262 Ga0500618_000150 3300053125 Bacteria 57266
263 Ga0500618_016638 3300053125 Bacteria 1838
264 Ga0500616_0000003 3300053153 Bacteria 1220687
265 Ga0500637_0063637 3300053178 Bacteria 2115
266 2599477289 2599185184 Bacteria 6430550
267 2919439256 2919437846 Bacteria 6199444
268 2919442319 2919437846 Bacteria 6199444
269 2928079205 2928078545 Bacteria 6534839
270 2928148423 2928147474 Bacteria 6512076
271 2932085720 2932082852 Bacteria 6563563
272 Ga0070682_100013134
273 JGI24739J22299_10000277
274 JGI24739J22299_10003846
275 JGI24739J22299_10012057
276 JGI24737J22298_10000218
277 JGI24743J22301_10012060
278 JGI24735J21928_10000001
279 JGI24744J21845_10001323
280 JGI25162J39368_1000427
281 JGI25164J39214_1003221
282 JGI25165J46597_1000548
283 rootH1_10040535
284 rootH1_10056014
285 rootH2_10105467
286 rootL2_10040009
287 rootH1_10029634
288 rootH1_10039695
289 JGI25160J50197_1005161
290 Ga0055526_1007839
291 Ga0055528_1000180
292 Ga0055530_10005213
293 Ga0055530_10037242
294 Ga0065165_1000019
295 Ga0070658_10005770
296 Ga0070658_10220277
297 Ga0070676_10000502
298 Ga0070683_100031413
299 Ga0070683_100068628
300 Ga0070670_100284605
301 Ga0068869_100155453
302 Ga0070666_10019170
303 Ga0070680_100014280
304 Ga0070680_100056145
305 Ga0068868_100051054
306 Ga0068868_100359154
307 Ga0070660_100069201
308 Ga0070660_100230010
309 Ga0070671_100022711
310 Ga0070673_100028690
311 Ga0070678_100003211
312 Ga0070678_100009089
313 Ga0070678_100027983
314 Ga0070662_100000103
315 Ga0070662_100047078
316 Ga0070681_10003760
317 Ga0068867_100003777
318 Ga0068867_100066140
319 Ga0068867_100235279
320 Ga0070679_100162606
321 Ga0070684_100647895
322 Ga0068853_100031627
323 Ga0068853_100076126
324 Ga0068853_100134122
325 Ga0070672_100268264
326 Ga0070665_100000083
327 Ga0068855_100021807
328 Ga0068855_100040583
329 Ga0070664_100130770
330 Ga0068857_100071157
331 Ga0068856_100066515
332 Ga0068852_100005449
333 Ga0068864_100238527
334 Ga0068870_10032246
335 Ga0068863_100046687
336 Ga0068858_100259589
337 Ga0068860_100006989
338 Ga0068860_100039186
339 Ga0068860_100042069
340 Ga0068860_100063866
341 Ga0075366_10002823
342 Ga0097621_100000041
343 Ga0097621_100000278
344 Ga0097621_100008188
345 Ga0097621_100016252
346 Ga0068871_100000825
347 Ga0068871_100003606
348 Ga0068871_100020660
349 Ga0068871_100023990
350 Ga0068871_100352908
351 Ga0075428_100039278
352 Ga0068865_100030425
353 Ga0097620_100263828
354 Ga0105240_10003660
355 Ga0105240_10005530
356 Ga0105240_10012588
357 Ga0105240_10095743
358 Ga0105240_10102814
359 Ga0105240_10154766
360 Ga0105241_10000775
361 Ga0105242_10057161
362 Ga0105242_10153543
363 Ga0105242_10199204
364 Ga0105237_10001839
365 Ga0105237_10004837
366 Ga0105237_10005970
367 Ga0105238_10083451
368 Ga0105239_10003720
369 Ga0105239_10030957
370 Ga0105239_10056980
371 Ga0157373_10004673
372 Ga0157373_10073893
373 Ga0157373_10213975
374 Ga0157371_10001841
375 Ga0157371_10003210
376 Ga0157371_10008924
377 Ga0157371_10011875
378 Ga0157371_10034349
379 Ga0157371_10101938
380 Ga0157371_10118802
381 Ga0157371_10153353
382 Ga0157370_10090837
383 Ga0157370_10132356
384 Ga0157369_10204379
385 Ga0157374_10000129
386 Ga0157374_10003215
387 Ga0157374_10074921
388 Ga0157378_10005613
389 Ga0157378_10016153
390 Ga0157378_10020697
391 Ga0157378_10084353
392 Ga0157378_10090839
393 Ga0163162_10007649
394 Ga0163162_10136508
395 Ga0157372_10010840
396 Ga0157372_10011467
397 Ga0157372_10028706
398 Ga0157372_10062223
399 Ga0157372_10179638
400 Ga0157372_10232679
401 Ga0157372_10307232
402 Ga0157375_10000857
403 Ga0157375_10114797
404 Ga0157375_10119385
405 Ga0157375_10259471
406 Ga0157375_10283095
407 Ga0163163_10002460
408 Ga0157379_10002909
409 Ga0157379_10390211
410 Ga0157376_10018227
411 Ga0157376_10246210
412 Ga0163161_10003589
413 Ga0207427_100090
414 Ga0209437_100034
415 Ga0209233_1000038
416 Ga0209455_1001458
417 Ga0209673_1000042
418 Ga0209564_1000840
419 Ga0209564_1003122
420 Ga0209564_1004207
421 Ga0209758_1001003
422 Ga0209758_1005063
423 Ga0209050_1000308
424 Ga0209050_1004552
425 Ga0209050_1040256
426 Ga0207426_1000442
427 Ga0207426_1000934
428 Ga0207426_1002510
429 Ga0209257_1001059
430 Ga0209257_1033383
431 Ga0207680_10200553
432 Ga0207680_10305067
433 Ga0207647_10000062
434 Ga0207645_10000224
435 Ga0207705_10007695
436 Ga0207654_10002243
437 Ga0207707_10071395
438 Ga0207695_10003717
439 Ga0207695_10120982
440 Ga0207695_10181896
441 Ga0207671_10000961
442 Ga0207671_10005876
443 Ga0207671_10075589
444 Ga0207660_10008783
445 Ga0207657_10010543
446 Ga0207657_10097182
447 Ga0207657_10202134
448 Ga0207652_10000180
449 Ga0207652_10013779
450 Ga0207652_10139550
451 Ga0207694_10050519
452 Ga0207659_10013529
453 Ga0207644_10014794
454 Ga0207706_10000851
455 Ga0207686_10181069
456 Ga0207704_10000037
457 Ga0207691_10223148
458 Ga0207689_10003933
459 Ga0207689_10004503
460 Ga0207689_10180492
461 Ga0207661_10050434
462 Ga0207667_10017568
463 Ga0207667_10032715
464 Ga0207667_10137265
465 Ga0207712_10083923
466 Ga0207640_10321378
467 Ga0207677_10079381
468 Ga0207703_10225365
469 Ga0207703_10401445
470 Ga0207639_10019750
471 Ga0207639_10092274
472 Ga0207678_10067428
473 Ga0207641_10041194
474 Ga0207648_10000241
475 Ga0207648_10081251
476 Ga0207648_10282598
477 Ga0207674_10400500
478 Ga0207675_100042377
479 Ga0207683_10006368
480 Ga0207683_10025601
481 Ga0207683_10144098
482 Ga0207698_10004698
483 Ga0268266_10000095
484 Ga0268264_10004919
485 Ga0268264_10016575
486 Ga0268264_10221081
487 Ga0307517_10000719
488 Ga0307515_10004038
489 Ga0307515_10006107
490 Ga0307513_10111269
491 Ga0307510_10006060
492 Ga0395899_0078159
493 Ga0395900_0001938
494 Ga0395900_0028047
495 Ga0395905_0019529
496 Ga0395905_0086521
497 Ga0395901_0105192
498 Ga0436365_0298838
499 Ga0451577_0052118
500 Ga0466970_0000119
501 Ga0495638_0000005
502 Ga0495650_0000014
503 Ga0495585_0001451
504 Ga0495585_0002526
505 Ga0495606_0000241
506 Ga0495610_0001644
507 Ga0495610_0064205
508 Ga0495616_0001895
509 Ga0495628_0190621
510 Ga0495648_0005339
511 Ga0495648_0167026
512 Ga0495654_0013201
513 Ga0495609_0001800
514 Ga0495633_0011124
515 Ga0495668_0002237
516 Ga0495625_0000003
517 Ga0495625_0000381
518 Ga0495625_0003720
519 Ga0495625_0019500
520 Ga0495669_0058147
521 Ga0495649_0000002
522 Ga0495649_0080274
523 Ga0495683_0035898
524 Ga0495687_002135
525 Ga0495687_003277
526 Ga0495686_0004577
527 Ga0496114_0047361
528 Ga0495678_012200
529 nmdc:mga0k408_1219_c1
530 nmdc:mga07m45_93620_c1
531 Ga0500635_0033940
532 Ga0500608_009310
533 Ga0500618_000150
534 Ga0500618_016638
535 Ga0500616_0000003
536 Ga0500637_0063637
537 2599477289
538 2919439256
539 2919442319
540 2928079205
541 2928148423
542 2932085720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

96

307

0.99

PF00326

Peptidase_S9

Prolyl oligopeptidase family

224

347

0.86

PF00135

COesterase

Carboxylesterase family

62

213

0.77

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

111

327

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nkf-assembly2.cif.gz_B crystal structure of the lipase lip_vut4 from goat rumen metagenome. 0.8825 38 306
6mly-assembly1.cif.gz_A bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8733 40 303
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.873 40 307
6xyc-assembly1.cif.gz_A truncated form of carbohydrate esterase from gut microbiota 0.861 34 303
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.8289 56 303
ID Description Score Start End Superfamily
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8787 42 304 3.40.50.1820
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8445 42 304 3.40.50.1820
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8342 41 294 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8013 56 305 3.40.50.1820
af_Q63HM1_47_299_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7997 39 299 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5C5XHP7-F1-model_v4 Carboxylesterase NlhH (EC 3.1.1.1) 0.9245 37 306 GO:0005509
GO:0106435
AF-A0A3L7N8H4-F1-model_v4 Alpha/beta hydrolase 0.9222 37 306 GO:0016787
AF-A0A3L7SQX0-F1-model_v4 Alpha/beta hydrolase 0.9206 39 307 GO:0016020
GO:0016787
AF-A0A349VGJ5-F1-model_v4 BD-FAE-like domain-containing protein 0.9199 205 307
AF-A0A5M6DE47-F1-model_v4 Alpha/beta hydrolase 0.9182 35 306 GO:0016787

Map