F377484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 164 | 259 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10012003|Ga0070710_100120032 |
| Length | 236 |
| Sequence | MSYLAEESSGRNSYPRREQRLCGFRTQEGNRLMLAIHDLWLFIISGLILNITPGPDTAYIVGRSAQFGWRGGAAAALGIATGCLVHVLACAIGLSALLAASATAFTLVKWAGAAYLCYIGIRMLLRDQARDRTPPLSKVFWQGALTNVLNPKVALFFLAFLPQFVDAGAPGKALAFLVLGLIFVFNGTLWCLAVAAFSARAARRFSGSGRAMRWINRALGGMFVYLGARIAMIQAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 5 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 6 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 7 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 8 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 9 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 41 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 54 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 75 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 76 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 77 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 78 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 79 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 80 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 81 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 82 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 83 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 84 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 85 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 86 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 87 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 88 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 89 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 104 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 105 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 112 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 113 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 148 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 149 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 158 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 159 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 160 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 162 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 163 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 164 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.2 |
| Metatranscriptomes | 0.37 |
| Isolates | 4.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.58 |
| Nodule | 2.95 |
| Rhizoplane | 1.11 |
| Rhizosphere | 87.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10047033 | 3300003323 | Bacteria | 4460 |
| 2 | JGI25404J52841_10004890 | 3300003659 | Bacteria | 2750 |
| 3 | Ga0070658_10102571 | 3300005327 | Bacteria | 2366 |
| 4 | Ga0070683_100084653 | 3300005329 | Bacteria | 2971 |
| 5 | Ga0070683_100090488 | 3300005329 | Bacteria | 2873 |
| 6 | Ga0070683_100132939 | 3300005329 | Bacteria | 2355 |
| 7 | Ga0070680_100021762 | 3300005336 | Bacteria | 5099 |
| 8 | Ga0070691_10103776 | 3300005341 | Bacteria | 1415 |
| 9 | Ga0070691_10353270 | 3300005341 | Bacteria | 817 |
| 10 | Ga0070661_100016975 | 3300005344 | Bacteria | 5156 |
| 11 | Ga0070709_10001261 | 3300005434 | Bacteria | 13852 |
| 12 | Ga0070709_10042951 | 3300005434 | Bacteria | 2794 |
| 13 | Ga0070709_10438003 | 3300005434 | Bacteria | 982 |
| 14 | Ga0070714_100015382 | 3300005435 | Bacteria | 6157 |
| 15 | Ga0070714_100055503 | 3300005435 | Bacteria | 3386 |
| 16 | Ga0070713_100006456 | 3300005436 | Bacteria | 8131 |
| 17 | Ga0070713_100009070 | 3300005436 | Bacteria | 7093 |
| 18 | Ga0070713_100114913 | 3300005436 | Bacteria | 2352 |
| 19 | Ga0070710_10012003 | 3300005437 | Bacteria | 4294 |
| 20 | Ga0070710_10026864 | 3300005437 | Bacteria | 3064 |
| 21 | Ga0070711_100035551 | 3300005439 | Bacteria | 3332 |
| 22 | Ga0070681_10034508 | 3300005458 | Bacteria | 5079 |
| 23 | Ga0070681_10057172 | 3300005458 | Bacteria | 3881 |
| 24 | Ga0070681_10155769 | 3300005458 | Bacteria | 2210 |
| 25 | Ga0070681_10321866 | 3300005458 | Bacteria | 1456 |
| 26 | Ga0070706_100034743 | 3300005467 | Bacteria | 4656 |
| 27 | Ga0070698_100143051 | 3300005471 | Bacteria | 2342 |
| 28 | Ga0070679_100027890 | 3300005530 | Bacteria | 5563 |
| 29 | Ga0070679_100041624 | 3300005530 | Bacteria | 4572 |
| 30 | Ga0070679_100178419 | 3300005530 | Bacteria | 2097 |
| 31 | Ga0070684_100017185 | 3300005535 | Bacteria | 5930 |
| 32 | Ga0070684_100045566 | 3300005535 | Bacteria | 3797 |
| 33 | Ga0070684_100046847 | 3300005535 | Bacteria | 3746 |
| 34 | Ga0068853_100138268 | 3300005539 | Bacteria | 2185 |
| 35 | Ga0068853_100213484 | 3300005539 | Bacteria | 1760 |
| 36 | Ga0068853_100333177 | 3300005539 | Bacteria | 1409 |
| 37 | Ga0068853_100502263 | 3300005539 | Bacteria | 1145 |
| 38 | Ga0070696_100640076 | 3300005546 | Bacteria | 861 |
| 39 | Ga0070693_100208188 | 3300005547 | Bacteria | 1275 |
| 40 | Ga0068855_100071617 | 3300005563 | Bacteria | 4031 |
| 41 | Ga0068855_100164008 | 3300005563 | Bacteria | 2520 |
| 42 | Ga0068855_100258741 | 3300005563 | Bacteria | 1940 |
| 43 | Ga0070664_100010720 | 3300005564 | Bacteria | 7433 |
| 44 | Ga0068857_100002234 | 3300005577 | Bacteria | 15761 |
| 45 | Ga0068857_100043708 | 3300005577 | Bacteria | 3973 |
| 46 | Ga0068857_100104655 | 3300005577 | Bacteria | 2541 |
| 47 | Ga0068857_100239943 | 3300005577 | Bacteria | 1659 |
| 48 | Ga0068856_100077613 | 3300005614 | Bacteria | 3291 |
| 49 | Ga0068852_100000512 | 3300005616 | Bacteria | 25561 |
| 50 | Ga0081540_1061072 | 3300005983 | Bacteria | 1799 |
| 51 | Ga0081540_1087805 | 3300005983 | Bacteria | 1377 |
| 52 | Ga0081540_1088124 | 3300005983 | Bacteria | 1373 |
| 53 | Ga0070717_10010384 | 3300006028 | Bacteria | 7029 |
| 54 | Ga0070717_10399764 | 3300006028 | Bacteria | 1234 |
| 55 | Ga0075364_10419158 | 3300006051 | Bacteria | 914 |
| 56 | Ga0070716_100131746 | 3300006173 | Bacteria | 1581 |
| 57 | Ga0070712_100003826 | 3300006175 | Bacteria | 9267 |
| 58 | Ga0070712_100555755 | 3300006175 | Bacteria | 967 |
| 59 | Ga0099824_1005278 | 3300006942 | Bacteria | 18259 |
| 60 | Ga0099822_1013722 | 3300006943 | Bacteria | 9448 |
| 61 | Ga0105240_10001155 | 3300009093 | Bacteria | 46229 |
| 62 | Ga0105240_10033109 | 3300009093 | Bacteria | 6682 |
| 63 | Ga0105240_10076367 | 3300009093 | Bacteria | 4130 |
| 64 | Ga0105240_10447611 | 3300009093 | Bacteria | 1446 |
| 65 | Ga0114129_11536674 | 3300009147 | Bacteria | 817 |
| 66 | Ga0105241_10111346 | 3300009174 | Bacteria | 2192 |
| 67 | Ga0105241_10162764 | 3300009174 | Bacteria | 1836 |
| 68 | Ga0105237_10029341 | 3300009545 | Bacteria | 5593 |
| 69 | Ga0105237_10082162 | 3300009545 | Bacteria | 3213 |
| 70 | Ga0105237_10096966 | 3300009545 | Bacteria | 2939 |
| 71 | Ga0105237_10230052 | 3300009545 | Bacteria | 1855 |
| 72 | Ga0105238_10050622 | 3300009551 | Bacteria | 4181 |
| 73 | Ga0105238_10087448 | 3300009551 | Bacteria | 3104 |
| 74 | Ga0105246_10170766 | 3300011119 | Bacteria | 1665 |
| 75 | Ga0157373_10068121 | 3300013100 | Bacteria | 2516 |
| 76 | Ga0157370_10205448 | 3300013104 | Bacteria | 1826 |
| 77 | Ga0157369_10011069 | 3300013105 | Bacteria | 10263 |
| 78 | Ga0157369_10018027 | 3300013105 | Bacteria | 7921 |
| 79 | Ga0157369_10022494 | 3300013105 | Bacteria | 7032 |
| 80 | Ga0157369_10056348 | 3300013105 | Bacteria | 4241 |
| 81 | Ga0157369_10265362 | 3300013105 | Bacteria | 1790 |
| 82 | Ga0157372_10416897 | 3300013307 | Bacteria | 1565 |
| 83 | Ga0157372_10892342 | 3300013307 | Bacteria | 1032 |
| 84 | Ga0157379_10341733 | 3300014968 | Bacteria | 1369 |
| 85 | Ga0183361_10001 | 3300016635 | Bacteria | 908583 |
| 86 | Ga0206356_10231740 | 3300020070 | Bacteria | 1493 |
| 87 | Ga0207692_10401751 | 3300025898 | Bacteria | 854 |
| 88 | Ga0207699_10021452 | 3300025906 | Bacteria | 3482 |
| 89 | Ga0207705_10078039 | 3300025909 | Bacteria | 2410 |
| 90 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 91 | Ga0207707_10045748 | 3300025912 | Bacteria | 3813 |
| 92 | Ga0207707_10211297 | 3300025912 | Bacteria | 1690 |
| 93 | Ga0207707_10529619 | 3300025912 | Bacteria | 1003 |
| 94 | Ga0207695_10024109 | 3300025913 | Bacteria | 6854 |
| 95 | Ga0207695_10059884 | 3300025913 | Bacteria | 3946 |
| 96 | Ga0207671_10028966 | 3300025914 | Bacteria | 4136 |
| 97 | Ga0207671_10383241 | 3300025914 | Bacteria | 1117 |
| 98 | Ga0207693_10008213 | 3300025915 | Bacteria | 8550 |
| 99 | Ga0207693_10015849 | 3300025915 | Bacteria | 6037 |
| 100 | Ga0207693_10455549 | 3300025915 | Bacteria | 999 |
| 101 | Ga0207663_10035123 | 3300025916 | Bacteria | 3004 |
| 102 | Ga0207663_10039955 | 3300025916 | Bacteria | 2847 |
| 103 | Ga0207652_10025370 | 3300025921 | Bacteria | 4927 |
| 104 | Ga0207652_10049707 | 3300025921 | Bacteria | 3591 |
| 105 | Ga0207652_10066178 | 3300025921 | Bacteria | 3131 |
| 106 | Ga0207694_10049921 | 3300025924 | Bacteria | 3239 |
| 107 | Ga0207694_10050640 | 3300025924 | Bacteria | 3217 |
| 108 | Ga0207700_10021493 | 3300025928 | Bacteria | 4407 |
| 109 | Ga0207700_10038115 | 3300025928 | Bacteria | 3487 |
| 110 | Ga0207700_10095006 | 3300025928 | Bacteria | 2364 |
| 111 | Ga0207700_10107315 | 3300025928 | Bacteria | 2240 |
| 112 | Ga0207664_10068373 | 3300025929 | Bacteria | 2853 |
| 113 | Ga0207664_10084195 | 3300025929 | Bacteria | 2594 |
| 114 | Ga0207665_10042744 | 3300025939 | Bacteria | 3029 |
| 115 | Ga0207665_10306276 | 3300025939 | Bacteria | 1189 |
| 116 | Ga0207661_10000109 | 3300025944 | Bacteria | 52179 |
| 117 | Ga0207661_10032320 | 3300025944 | Bacteria | 4053 |
| 118 | Ga0207661_10297069 | 3300025944 | Bacteria | 1447 |
| 119 | Ga0207667_10024603 | 3300025949 | Bacteria | 6607 |
| 120 | Ga0207667_10057371 | 3300025949 | Bacteria | 4087 |
| 121 | Ga0207667_10108298 | 3300025949 | Bacteria | 2867 |
| 122 | Ga0207639_10123945 | 3300026041 | Bacteria | 2128 |
| 123 | Ga0207639_10205289 | 3300026041 | Bacteria | 1693 |
| 124 | Ga0207639_10392532 | 3300026041 | Bacteria | 1248 |
| 125 | Ga0207639_10424891 | 3300026041 | Bacteria | 1202 |
| 126 | Ga0207702_10055378 | 3300026078 | Bacteria | 3363 |
| 127 | Ga0207674_10000140 | 3300026116 | Bacteria | 84173 |
| 128 | Ga0207674_10033286 | 3300026116 | Bacteria | 5397 |
| 129 | Ga0207674_10057207 | 3300026116 | Bacteria | 3953 |
| 130 | Ga0207674_10250793 | 3300026116 | Bacteria | 1717 |
| 131 | Ga0207698_10741283 | 3300026142 | Bacteria | 980 |
| 132 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 133 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 134 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 135 | Ga0307511_10051177 | 3300030521 | Bacteria | 3315 |
| 136 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 137 | Ga0307405_10172340 | 3300031731 | Bacteria | 1545 |
| 138 | Ga0307415_100092554 | 3300032126 | Bacteria | 2193 |
| 139 | Ga0307507_10018699 | 3300033179 | Bacteria | 7861 |
| 140 | Ga0307510_10119731 | 3300033180 | Bacteria | 2342 |
| 141 | Ga0373926_0007645 | 3300035083 | Bacteria | 3599 |
| 142 | Ga0373936_0005526 | 3300035113 | Bacteria | 4771 |
| 143 | Ga0373936_0012437 | 3300035113 | Bacteria | 3238 |
| 144 | Ga0373936_0040401 | 3300035113 | Bacteria | 1868 |
| 145 | Ga0373936_0090694 | 3300035113 | Bacteria | 1281 |
| 146 | Ga0373945_0013564 | 3300035116 | Bacteria | 2721 |
| 147 | Ga0373945_0039915 | 3300035116 | Bacteria | 1693 |
| 148 | Ga0373954_0033188 | 3300035118 | Bacteria | 2388 |
| 149 | Ga0373954_0119769 | 3300035118 | Bacteria | 1277 |
| 150 | Ga0373956_0130482 | 3300035119 | Bacteria | 1176 |
| 151 | Ga0373957_0037232 | 3300035120 | Bacteria | 1817 |
| 152 | Ga0373943_0189012 | 3300035170 | Bacteria | 1135 |
| 153 | Ga0373946_0085673 | 3300035171 | Bacteria | 1387 |
| 154 | Ga0373955_0029554 | 3300035172 | Bacteria | 2851 |
| 155 | Ga0373955_0076756 | 3300035172 | Bacteria | 1880 |
| 156 | Ga0373924_0013913 | 3300035410 | Bacteria | 3031 |
| 157 | Ga0373935_0004219 | 3300035692 | Bacteria | 8427 |
| 158 | Ga0373935_0130931 | 3300035692 | Bacteria | 1685 |
| 159 | Ga0373927_0002702 | 3300035695 | Bacteria | 12926 |
| 160 | Ga0373927_0025898 | 3300035695 | Bacteria | 3834 |
| 161 | Ga0373927_0034846 | 3300035695 | Bacteria | 3273 |
| 162 | Ga0373927_0403522 | 3300035695 | Bacteria | 902 |
| 163 | Ga0373933_0081404 | 3300035724 | Bacteria | 1986 |
| 164 | Ga0373937_0393086 | 3300036401 | Bacteria | 1315 |
| 165 | Ga0373925_0009475 | 3300037068 | Bacteria | 7089 |
| 166 | Ga0373925_0027154 | 3300037068 | Bacteria | 4192 |
| 167 | Ga0373925_0132578 | 3300037068 | Bacteria | 1944 |
| 168 | Ga0395899_0087469 | 3300037312 | Bacteria | 2262 |
| 169 | Ga0395900_0065657 | 3300037418 | Bacteria | 3728 |
| 170 | Ga0395900_0512133 | 3300037418 | Bacteria | 1149 |
| 171 | Ga0395898_0017601 | 3300037466 | Bacteria | 7294 |
| 172 | Ga0395898_0028587 | 3300037466 | Bacteria | 5587 |
| 173 | Ga0395898_0168478 | 3300037466 | Bacteria | 2094 |
| 174 | Ga0395901_0000017 | 3300038443 | Bacteria | 345003 |
| 175 | Ga0395901_0108383 | 3300038443 | Bacteria | 2916 |
| 176 | Ga0436365_0768658 | 3300039437 | Bacteria | 1149 |
| 177 | Ga0436363_0507825 | 3300039450 | Bacteria | 1934 |
| 178 | Ga0436363_1529048 | 3300039450 | Bacteria | 1301 |
| 179 | Ga0439436_0082390 | 3300041404 | Bacteria | 895 |
| 180 | Ga0451577_0286761 | 3300042876 | Bacteria | 1492 |
| 181 | Ga0466969_0285521 | 3300044656 | Bacteria | 747 |
| 182 | Ga0466963_0047921 | 3300044694 | Bacteria | 2822 |
| 183 | Ga0466970_0374564 | 3300044765 | Bacteria | 810 |
| 184 | Ga0466957_0038377 | 3300044842 | Bacteria | 2886 |
| 185 | Ga0466957_0070450 | 3300044842 | Bacteria | 2161 |
| 186 | Ga0466957_0336004 | 3300044842 | Bacteria | 1022 |
| 187 | Ga0466959_0055807 | 3300045049 | Bacteria | 2883 |
| 188 | Ga0466959_0521419 | 3300045049 | Bacteria | 802 |
| 189 | Ga0466958_0174846 | 3300045836 | Bacteria | 1361 |
| 190 | Ga0466967_0076730 | 3300045976 | Bacteria | 3006 |
| 191 | Ga0466967_0562064 | 3300045976 | Bacteria | 1123 |
| 192 | Ga0495592_0014358 | 3300046454 | Bacteria | 6013 |
| 193 | Ga0495603_0000521 | 3300046455 | Bacteria | 21337 |
| 194 | Ga0495629_0000416 | 3300046459 | Bacteria | 35794 |
| 195 | Ga0495629_0462358 | 3300046459 | Bacteria | 858 |
| 196 | Ga0495641_0002593 | 3300046461 | Bacteria | 14172 |
| 197 | Ga0495580_0016728 | 3300046472 | Bacteria | 5504 |
| 198 | Ga0495580_0093424 | 3300046472 | Bacteria | 2093 |
| 199 | Ga0495582_0002376 | 3300046473 | Bacteria | 10534 |
| 200 | Ga0495639_0001046 | 3300046475 | Bacteria | 12485 |
| 201 | Ga0495639_0051104 | 3300046475 | Bacteria | 1879 |
| 202 | Ga0495662_0003282 | 3300046476 | Bacteria | 8189 |
| 203 | Ga0495664_0009023 | 3300046477 | Bacteria | 5574 |
| 204 | Ga0495664_0009265 | 3300046477 | Bacteria | 5505 |
| 205 | Ga0495594_0000194 | 3300046499 | Bacteria | 29650 |
| 206 | Ga0495628_0058442 | 3300046516 | Bacteria | 3030 |
| 207 | Ga0495630_0006451 | 3300046517 | Bacteria | 8344 |
| 208 | Ga0495630_0013707 | 3300046517 | Bacteria | 5894 |
| 209 | Ga0495643_0241538 | 3300046522 | Bacteria | 847 |
| 210 | Ga0495648_0118074 | 3300046524 | Bacteria | 1431 |
| 211 | Ga0495666_0029054 | 3300046526 | Bacteria | 2720 |
| 212 | Ga0495666_0059569 | 3300046526 | Bacteria | 1826 |
| 213 | Ga0495652_0030338 | 3300046529 | Bacteria | 4743 |
| 214 | Ga0495652_0088477 | 3300046529 | Bacteria | 2538 |
| 215 | Ga0495665_0003441 | 3300046531 | Bacteria | 8598 |
| 216 | Ga0495640_0006591 | 3300046533 | Bacteria | 9166 |
| 217 | Ga0495640_0062062 | 3300046533 | Bacteria | 2536 |
| 218 | Ga0495586_0046310 | 3300046535 | Bacteria | 2345 |
| 219 | Ga0495645_0096868 | 3300046543 | Bacteria | 2102 |
| 220 | Ga0495622_0002024 | 3300046557 | Bacteria | 9908 |
| 221 | Ga0495622_0036646 | 3300046557 | Bacteria | 2286 |
| 222 | Ga0495634_0000602 | 3300046642 | Bacteria | 34812 |
| 223 | Ga0495634_0071334 | 3300046642 | Bacteria | 2287 |
| 224 | Ga0495635_0216177 | 3300046663 | Bacteria | 1297 |
| 225 | Ga0495599_0126644 | 3300046678 | Bacteria | 1587 |
| 226 | Ga0495647_0000414 | 3300046681 | Bacteria | 12222 |
| 227 | Ga0495647_0048841 | 3300046681 | Bacteria | 1638 |
| 228 | Ga0495658_0002719 | 3300046683 | Bacteria | 8895 |
| 229 | Ga0495658_0070830 | 3300046683 | Bacteria | 2024 |
| 230 | Ga0495613_0028530 | 3300046689 | Bacteria | 4151 |
| 231 | Ga0495613_0234439 | 3300046689 | Bacteria | 1285 |
| 232 | Ga0495624_0003072 | 3300046690 | Bacteria | 12498 |
| 233 | Ga0495581_0000133 | 3300047315 | Bacteria | 32384 |
| 234 | Ga0495674_0000874 | 3300047319 | Bacteria | 28828 |
| 235 | Ga0495674_0111111 | 3300047319 | Bacteria | 2323 |
| 236 | Ga0495676_0015692 | 3300047321 | Bacteria | 6736 |
| 237 | Ga0495684_0018475 | 3300047471 | Bacteria | 5371 |
| 238 | Ga0495684_0025060 | 3300047471 | Bacteria | 4588 |
| 239 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 240 | Ga0495593_0009120 | 3300047673 | Bacteria | 5754 |
| 241 | Ga0496101_0617069 | 3300048904 | Bacteria | 857 |
| 242 | Ga0496114_0048968 | 3300048917 | Bacteria | 3516 |
| 243 | Ga0496121_0101135 | 3300048924 | Bacteria | 2224 |
| 244 | Ga0496126_0115011 | 3300048929 | Bacteria | 2340 |
| 245 | Ga0496126_0228130 | 3300048929 | Bacteria | 1561 |
| 246 | Ga0501047_0074414 | 3300049581 | Bacteria | 3270 |
| 247 | Ga0501070_0057445 | 3300049586 | Bacteria | 3225 |
| 248 | Ga0501073_0215417 | 3300049589 | Bacteria | 1327 |
| 249 | Ga0501044_0037782 | 3300049823 | Bacteria | 5046 |
| 250 | nmdc:mga05p37_1242562_c1 | 3300050507 | Bacteria | 765 |
| 251 | Ga0495601_0121553 | 3300053077 | Bacteria | 1696 |
| 252 | Ga0495612_0013597 | 3300053078 | Bacteria | 3279 |
| 253 | Ga0495612_0077769 | 3300053078 | Bacteria | 1391 |
| 254 | Ga0500647_0126797 | 3300053091 | Bacteria | 1205 |
| 255 | Ga0500559_0047056 | 3300053136 | Bacteria | 1893 |
| 256 | Ga0500639_001074 | 3300053163 | Bacteria | 13945 |
| 257 | Ga0500639_223401 | 3300053163 | Bacteria | 783 |
| 258 | Ga0500636_0135094 | 3300053177 | Bacteria | 1370 |
| 259 | Ga0500637_0055566 | 3300053178 | Bacteria | 2261 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0101135 | Ga0496121_0101135_28_510 | 146 |
| 2 | 3300005434 | Ga0070709_10438003 | Ga0070709_104380032 | 158 |
| 3 | 3300053136 | Ga0500559_0047056 | Ga0500559_0047056_1343_1879 | 164 |
| 4 | 3300014968 | Ga0157379_10341733 | Ga0157379_103417332 | 175 |
| 5 | 3300041404 | Ga0439436_0082390 | Ga0439436_0082390_61_693 | 180 |
| 6 | 3300016635 | Ga0183361_10001 | Ga0183361_10001535 | 181 |
| 7 | 3300046524 | Ga0495648_0118074 | Ga0495648_0118074_749_1390 | 181 |
| 8 | 3300048929 | Ga0496126_0115011 | Ga0496126_0115011_1323_1961 | 181 |
| 9 | 3300009147 | Ga0114129_11536674 | Ga0114129_115366741 | 182 |
| 10 | 3300050507 | nmdc:mga05p37_1242562_c1 | nmdc:mga05p37_1242562_c1_144_734 | 182 |
| 11 | 3300048904 | Ga0496101_0617069 | Ga0496101_0617069_14_607 | 183 |
| 12 | 3300048917 | Ga0496114_0048968 | Ga0496114_0048968_15_608 | 183 |
| 13 | 3300005329 | Ga0070683_100132939 | Ga0070683_1001329392 | 186 |
| 14 | 3300009545 | Ga0105237_10096966 | Ga0105237_100969662 | 186 |
| 15 | 3300025914 | Ga0207671_10383241 | Ga0207671_103832412 | 186 |
| 16 | 3300025944 | Ga0207661_10032320 | Ga0207661_100323203 | 186 |
| 17 | 3300030521 | Ga0307511_10051177 | Ga0307511_100511771 | 186 |
| 18 | 3300033179 | Ga0307507_10018699 | Ga0307507_100186993 | 186 |
| 19 | 3300033180 | Ga0307510_10119731 | Ga0307510_101197312 | 186 |
| 20 | 3300035695 | Ga0373927_0025898 | Ga0373927_0025898_1658_2299 | 186 |
| 21 | 3300037068 | Ga0373925_0027154 | Ga0373925_0027154_1645_2286 | 186 |
| 22 | 3300046557 | Ga0495622_0036646 | Ga0495622_0036646_55_696 | 186 |
| 23 | 3300053091 | Ga0500647_0126797 | Ga0500647_0126797_241_882 | 186 |
| 24 | 3300053163 | Ga0500639_223401 | Ga0500639_223401_86_727 | 186 |
| 25 | 3300053177 | Ga0500636_0135094 | Ga0500636_0135094_295_936 | 186 |
| 26 | 3300053178 | Ga0500637_0055566 | Ga0500637_0055566_199_840 | 186 |
| 27 | 3300005458 | Ga0070681_10057172 | Ga0070681_100571724 | 187 |
| 28 | 3300005530 | Ga0070679_100041624 | Ga0070679_1000416246 | 187 |
| 29 | 3300031616 | Ga0307508_10000029 | Ga0307508_10000029109 | 187 |
| 30 | iso_pu_bacteria | 2513237166 | 2514046783 | 191 |
| 31 | iso_pu_bacteria | 2721755763 | 2723875829 | 191 |
| 32 | iso_pu_bacteria | 2599185239 | 2599740127 | 192 |
| 33 | iso_pu_bacteria | 2818991452 | 2819635908 | 192 |
| 34 | iso_pu_bacteria | 2870068957 | 2870069782 | 192 |
| 35 | iso_pu_bacteria | 2928170801 | 2928176729 | 192 |
| 36 | iso_pu_bacteria | 8018845410 | 8018847123 | 192 |
| 37 | iso_pu_bacteria | 8020945358 | 8020949016 | 192 |
| 38 | iso_pu_bacteria | 8021120328 | 8021128117 | 192 |
| 39 | 3300005436 | Ga0070713_100009070 | Ga0070713_1000090702 | 194 |
| 40 | 3300005437 | Ga0070710_10012003 | Ga0070710_100120032 | 194 |
| 41 | 3300005458 | Ga0070681_10321866 | Ga0070681_103218661 | 194 |
| 42 | 3300005530 | Ga0070679_100178419 | Ga0070679_1001784192 | 194 |
| 43 | 3300009093 | Ga0105240_10076367 | Ga0105240_100763674 | 194 |
| 44 | 3300013105 | Ga0157369_10265362 | Ga0157369_102653622 | 194 |
| 45 | 3300025912 | Ga0207707_10529619 | Ga0207707_105296192 | 194 |
| 46 | 3300025921 | Ga0207652_10049707 | Ga0207652_100497075 | 194 |
| 47 | 3300025928 | Ga0207700_10021493 | Ga0207700_100214933 | 194 |
| 48 | 3300038443 | Ga0395901_0000017 | Ga0395901_0000017_181448_182104 | 194 |
| 49 | 3300042876 | Ga0451577_0286761 | Ga0451577_0286761_321_956 | 194 |
| 50 | iso_pu_bacteria | 2508501128 | 2509151300 | 194 |
| 51 | iso_pu_bacteria | 2513237141 | 2513892377 | 194 |
| 52 | 3300044765 | Ga0466970_0374564 | Ga0466970_0374564_119_760 | 195 |
| 53 | 3300045049 | Ga0466959_0521419 | Ga0466959_0521419_126_767 | 195 |
| 54 | 3300045836 | Ga0466958_0174846 | Ga0466958_0174846_583_1233 | 195 |
| 55 | 3300005341 | Ga0070691_10103776 | Ga0070691_101037762 | 196 |
| 56 | 3300005434 | Ga0070709_10042951 | Ga0070709_100429512 | 196 |
| 57 | 3300005435 | Ga0070714_100055503 | Ga0070714_1000555034 | 196 |
| 58 | 3300005436 | Ga0070713_100114913 | Ga0070713_1001149132 | 196 |
| 59 | 3300005535 | Ga0070684_100045566 | Ga0070684_1000455662 | 196 |
| 60 | 3300005539 | Ga0068853_100502263 | Ga0068853_1005022631 | 196 |
| 61 | 3300005577 | Ga0068857_100043708 | Ga0068857_1000437083 | 196 |
| 62 | 3300009545 | Ga0105237_10029341 | Ga0105237_100293415 | 196 |
| 63 | 3300025916 | Ga0207663_10035123 | Ga0207663_100351232 | 196 |
| 64 | 3300025924 | Ga0207694_10049921 | Ga0207694_100499213 | 196 |
| 65 | 3300025928 | Ga0207700_10095006 | Ga0207700_100950062 | 196 |
| 66 | 3300025929 | Ga0207664_10084195 | Ga0207664_100841952 | 196 |
| 67 | 3300026116 | Ga0207674_10033286 | Ga0207674_100332863 | 196 |
| 68 | 3300035695 | Ga0373927_0403522 | Ga0373927_0403522_153_782 | 196 |
| 69 | 3300039450 | Ga0436363_1529048 | Ga0436363_1529048_54_692 | 196 |
| 70 | iso_pu_bacteria | 2881412998 | 2881415479 | 196 |
| 71 | 3300003659 | JGI25404J52841_10004890 | JGI25404J52841_100048902 | 197 |
| 72 | 3300005329 | Ga0070683_100090488 | Ga0070683_1000904882 | 197 |
| 73 | 3300005535 | Ga0070684_100017185 | Ga0070684_1000171853 | 197 |
| 74 | 3300005539 | Ga0068853_100213484 | Ga0068853_1002134842 | 197 |
| 75 | 3300005539 | Ga0068853_100333177 | Ga0068853_1003331772 | 197 |
| 76 | 3300005563 | Ga0068855_100071617 | Ga0068855_1000716173 | 197 |
| 77 | 3300005577 | Ga0068857_100239943 | Ga0068857_1002399432 | 197 |
| 78 | 3300005983 | Ga0081540_1061072 | Ga0081540_10610722 | 197 |
| 79 | 3300005983 | Ga0081540_1087805 | Ga0081540_10878052 | 197 |
| 80 | 3300006051 | Ga0075364_10419158 | Ga0075364_104191582 | 197 |
| 81 | 3300006942 | Ga0099824_1005278 | Ga0099824_10052787 | 197 |
| 82 | 3300006943 | Ga0099822_1013722 | Ga0099822_10137226 | 197 |
| 83 | 3300009093 | Ga0105240_10033109 | Ga0105240_100331097 | 197 |
| 84 | 3300009545 | Ga0105237_10082162 | Ga0105237_100821624 | 197 |
| 85 | 3300009545 | Ga0105237_10230052 | Ga0105237_102300523 | 197 |
| 86 | 3300011119 | Ga0105246_10170766 | Ga0105246_101707662 | 197 |
| 87 | 3300013104 | Ga0157370_10205448 | Ga0157370_102054482 | 197 |
| 88 | 3300013105 | Ga0157369_10011069 | Ga0157369_100110695 | 197 |
| 89 | 3300013105 | Ga0157369_10018027 | Ga0157369_100180274 | 197 |
| 90 | 3300020070 | Ga0206356_10231740 | Ga0206356_102317402 | 197 |
| 91 | 3300025913 | Ga0207695_10024109 | Ga0207695_100241092 | 197 |
| 92 | 3300025914 | Ga0207671_10028966 | Ga0207671_100289664 | 197 |
| 93 | 3300025915 | Ga0207693_10015849 | Ga0207693_100158494 | 197 |
| 94 | 3300025928 | Ga0207700_10038115 | Ga0207700_100381153 | 197 |
| 95 | 3300025944 | Ga0207661_10000109 | Ga0207661_1000010914 | 197 |
| 96 | 3300025944 | Ga0207661_10297069 | Ga0207661_102970692 | 197 |
| 97 | 3300025949 | Ga0207667_10057371 | Ga0207667_100573713 | 197 |
| 98 | 3300026041 | Ga0207639_10123945 | Ga0207639_101239452 | 197 |
| 99 | 3300026041 | Ga0207639_10205289 | Ga0207639_102052892 | 197 |
| 100 | 3300026116 | Ga0207674_10250793 | Ga0207674_102507932 | 197 |
| 101 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005337 | 197 |
| 102 | 3300027361 | Ga0209489_100005 | Ga0209489_100005337 | 197 |
| 103 | 3300027363 | Ga0209700_100006 | Ga0209700_100006337 | 197 |
| 104 | 3300031731 | Ga0307405_10172340 | Ga0307405_101723402 | 197 |
| 105 | 3300032126 | Ga0307415_100092554 | Ga0307415_1000925542 | 197 |
| 106 | 3300035083 | Ga0373926_0007645 | Ga0373926_0007645_1591_2229 | 197 |
| 107 | 3300035113 | Ga0373936_0012437 | Ga0373936_0012437_1887_2525 | 197 |
| 108 | 3300035116 | Ga0373945_0039915 | Ga0373945_0039915_473_1111 | 197 |
| 109 | 3300035120 | Ga0373957_0037232 | Ga0373957_0037232_604_1242 | 197 |
| 110 | 3300035170 | Ga0373943_0189012 | Ga0373943_0189012_158_796 | 197 |
| 111 | 3300035171 | Ga0373946_0085673 | Ga0373946_0085673_307_945 | 197 |
| 112 | 3300035172 | Ga0373955_0029554 | Ga0373955_0029554_1332_1970 | 197 |
| 113 | 3300035692 | Ga0373935_0130931 | Ga0373935_0130931_712_1350 | 197 |
| 114 | 3300035695 | Ga0373927_0034846 | Ga0373927_0034846_874_1512 | 197 |
| 115 | 3300036401 | Ga0373937_0393086 | Ga0373937_0393086_266_904 | 197 |
| 116 | 3300037312 | Ga0395899_0087469 | Ga0395899_0087469_1521_2156 | 197 |
| 117 | 3300037418 | Ga0395900_0065657 | Ga0395900_0065657_1199_1834 | 197 |
| 118 | 3300037466 | Ga0395898_0017601 | Ga0395898_0017601_4745_5380 | 197 |
| 119 | 3300038443 | Ga0395901_0108383 | Ga0395901_0108383_2023_2658 | 197 |
| 120 | 3300039437 | Ga0436365_0768658 | Ga0436365_0768658_42_677 | 197 |
| 121 | 3300039450 | Ga0436363_0507825 | Ga0436363_0507825_599_1234 | 197 |
| 122 | 3300044842 | Ga0466957_0038377 | Ga0466957_0038377_529_1179 | 197 |
| 123 | 3300045976 | Ga0466967_0076730 | Ga0466967_0076730_445_1143 | 197 |
| 124 | 3300046459 | Ga0495629_0462358 | Ga0495629_0462358_53_691 | 197 |
| 125 | 3300046472 | Ga0495580_0093424 | Ga0495580_0093424_505_1143 | 197 |
| 126 | 3300046475 | Ga0495639_0051104 | Ga0495639_0051104_634_1272 | 197 |
| 127 | 3300046477 | Ga0495664_0009023 | Ga0495664_0009023_4807_5445 | 197 |
| 128 | 3300046517 | Ga0495630_0013707 | Ga0495630_0013707_3221_3859 | 197 |
| 129 | 3300046522 | Ga0495643_0241538 | Ga0495643_0241538_94_732 | 197 |
| 130 | 3300046526 | Ga0495666_0059569 | Ga0495666_0059569_798_1436 | 197 |
| 131 | 3300046529 | Ga0495652_0088477 | Ga0495652_0088477_827_1465 | 197 |
| 132 | 3300046533 | Ga0495640_0062062 | Ga0495640_0062062_1631_2269 | 197 |
| 133 | 3300046535 | Ga0495586_0046310 | Ga0495586_0046310_626_1264 | 197 |
| 134 | 3300046543 | Ga0495645_0096868 | Ga0495645_0096868_848_1486 | 197 |
| 135 | 3300046642 | Ga0495634_0071334 | Ga0495634_0071334_258_896 | 197 |
| 136 | 3300046663 | Ga0495635_0216177 | Ga0495635_0216177_340_978 | 197 |
| 137 | 3300046678 | Ga0495599_0126644 | Ga0495599_0126644_598_1236 | 197 |
| 138 | 3300046681 | Ga0495647_0048841 | Ga0495647_0048841_270_908 | 197 |
| 139 | 3300046683 | Ga0495658_0070830 | Ga0495658_0070830_907_1545 | 197 |
| 140 | 3300046689 | Ga0495613_0234439 | Ga0495613_0234439_37_675 | 197 |
| 141 | 3300047319 | Ga0495674_0111111 | Ga0495674_0111111_181_819 | 197 |
| 142 | 3300047471 | Ga0495684_0018475 | Ga0495684_0018475_4407_5045 | 197 |
| 143 | 3300047673 | Ga0495593_0009120 | Ga0495593_0009120_4784_5422 | 197 |
| 144 | 3300053077 | Ga0495601_0121553 | Ga0495601_0121553_987_1625 | 197 |
| 145 | 3300053078 | Ga0495612_0013597 | Ga0495612_0013597_543_1181 | 197 |
| 146 | 3300003323 | rootH1_10047033 | rootH1_100470333 | 198 |
| 147 | 3300005327 | Ga0070658_10102571 | Ga0070658_101025713 | 198 |
| 148 | 3300005329 | Ga0070683_100084653 | Ga0070683_1000846533 | 198 |
| 149 | 3300005336 | Ga0070680_100021762 | Ga0070680_1000217625 | 198 |
| 150 | 3300005341 | Ga0070691_10353270 | Ga0070691_103532701 | 198 |
| 151 | 3300005344 | Ga0070661_100016975 | Ga0070661_1000169752 | 198 |
| 152 | 3300005434 | Ga0070709_10001261 | Ga0070709_1000126111 | 198 |
| 153 | 3300005435 | Ga0070714_100015382 | Ga0070714_1000153828 | 198 |
| 154 | 3300005436 | Ga0070713_100006456 | Ga0070713_1000064564 | 198 |
| 155 | 3300005437 | Ga0070710_10026864 | Ga0070710_100268643 | 198 |
| 156 | 3300005439 | Ga0070711_100035551 | Ga0070711_1000355512 | 198 |
| 157 | 3300005458 | Ga0070681_10034508 | Ga0070681_100345083 | 198 |
| 158 | 3300005458 | Ga0070681_10155769 | Ga0070681_101557692 | 198 |
| 159 | 3300005467 | Ga0070706_100034743 | Ga0070706_1000347434 | 198 |
| 160 | 3300005471 | Ga0070698_100143051 | Ga0070698_1001430513 | 198 |
| 161 | 3300005530 | Ga0070679_100027890 | Ga0070679_1000278906 | 198 |
| 162 | 3300005535 | Ga0070684_100046847 | Ga0070684_1000468473 | 198 |
| 163 | 3300005539 | Ga0068853_100138268 | Ga0068853_1001382683 | 198 |
| 164 | 3300005546 | Ga0070696_100640076 | Ga0070696_1006400761 | 198 |
| 165 | 3300005547 | Ga0070693_100208188 | Ga0070693_1002081882 | 198 |
| 166 | 3300005563 | Ga0068855_100164008 | Ga0068855_1001640082 | 198 |
| 167 | 3300005563 | Ga0068855_100258741 | Ga0068855_1002587412 | 198 |
| 168 | 3300005564 | Ga0070664_100010720 | Ga0070664_1000107206 | 198 |
| 169 | 3300005577 | Ga0068857_100002234 | Ga0068857_1000022346 | 198 |
| 170 | 3300005577 | Ga0068857_100104655 | Ga0068857_1001046552 | 198 |
| 171 | 3300005614 | Ga0068856_100077613 | Ga0068856_1000776133 | 198 |
| 172 | 3300005616 | Ga0068852_100000512 | Ga0068852_10000051211 | 198 |
| 173 | 3300005983 | Ga0081540_1088124 | Ga0081540_10881242 | 198 |
| 174 | 3300006028 | Ga0070717_10010384 | Ga0070717_100103842 | 198 |
| 175 | 3300006028 | Ga0070717_10399764 | Ga0070717_103997642 | 198 |
| 176 | 3300006173 | Ga0070716_100131746 | Ga0070716_1001317462 | 198 |
| 177 | 3300006175 | Ga0070712_100003826 | Ga0070712_1000038264 | 198 |
| 178 | 3300006175 | Ga0070712_100555755 | Ga0070712_1005557552 | 198 |
| 179 | 3300009093 | Ga0105240_10001155 | Ga0105240_1000115524 | 198 |
| 180 | 3300009093 | Ga0105240_10447611 | Ga0105240_104476111 | 198 |
| 181 | 3300009174 | Ga0105241_10111346 | Ga0105241_101113462 | 198 |
| 182 | 3300009174 | Ga0105241_10162764 | Ga0105241_101627642 | 198 |
| 183 | 3300009551 | Ga0105238_10050622 | Ga0105238_100506223 | 198 |
| 184 | 3300009551 | Ga0105238_10087448 | Ga0105238_100874482 | 198 |
| 185 | 3300013100 | Ga0157373_10068121 | Ga0157373_100681212 | 198 |
| 186 | 3300013105 | Ga0157369_10022494 | Ga0157369_100224946 | 198 |
| 187 | 3300013105 | Ga0157369_10056348 | Ga0157369_100563482 | 198 |
| 188 | 3300013307 | Ga0157372_10416897 | Ga0157372_104168972 | 198 |
| 189 | 3300013307 | Ga0157372_10892342 | Ga0157372_108923422 | 198 |
| 190 | 3300025898 | Ga0207692_10401751 | Ga0207692_104017512 | 198 |
| 191 | 3300025906 | Ga0207699_10021452 | Ga0207699_100214522 | 198 |
| 192 | 3300025909 | Ga0207705_10078039 | Ga0207705_100780392 | 198 |
| 193 | 3300025912 | Ga0207707_10000582 | Ga0207707_1000058237 | 198 |
| 194 | 3300025912 | Ga0207707_10045748 | Ga0207707_100457484 | 198 |
| 195 | 3300025912 | Ga0207707_10211297 | Ga0207707_102112971 | 198 |
| 196 | 3300025913 | Ga0207695_10059884 | Ga0207695_100598843 | 198 |
| 197 | 3300025915 | Ga0207693_10008213 | Ga0207693_100082134 | 198 |
| 198 | 3300025915 | Ga0207693_10455549 | Ga0207693_104555492 | 198 |
| 199 | 3300025916 | Ga0207663_10039955 | Ga0207663_100399552 | 198 |
| 200 | 3300025921 | Ga0207652_10025370 | Ga0207652_100253703 | 198 |
| 201 | 3300025921 | Ga0207652_10066178 | Ga0207652_100661783 | 198 |
| 202 | 3300025924 | Ga0207694_10050640 | Ga0207694_100506403 | 198 |
| 203 | 3300025928 | Ga0207700_10107315 | Ga0207700_101073152 | 198 |
| 204 | 3300025929 | Ga0207664_10068373 | Ga0207664_100683734 | 198 |
| 205 | 3300025939 | Ga0207665_10042744 | Ga0207665_100427442 | 198 |
| 206 | 3300025939 | Ga0207665_10306276 | Ga0207665_103062762 | 198 |
| 207 | 3300025949 | Ga0207667_10024603 | Ga0207667_100246033 | 198 |
| 208 | 3300025949 | Ga0207667_10108298 | Ga0207667_101082982 | 198 |
| 209 | 3300026041 | Ga0207639_10392532 | Ga0207639_103925321 | 198 |
| 210 | 3300026041 | Ga0207639_10424891 | Ga0207639_104248912 | 198 |
| 211 | 3300026078 | Ga0207702_10055378 | Ga0207702_100553783 | 198 |
| 212 | 3300026116 | Ga0207674_10000140 | Ga0207674_1000014011 | 198 |
| 213 | 3300026116 | Ga0207674_10057207 | Ga0207674_100572072 | 198 |
| 214 | 3300026142 | Ga0207698_10741283 | Ga0207698_107412831 | 198 |
| 215 | 3300035113 | Ga0373936_0005526 | Ga0373936_0005526_4018_4665 | 198 |
| 216 | 3300035113 | Ga0373936_0040401 | Ga0373936_0040401_282_920 | 198 |
| 217 | 3300035113 | Ga0373936_0090694 | Ga0373936_0090694_84_722 | 198 |
| 218 | 3300035116 | Ga0373945_0013564 | Ga0373945_0013564_1932_2579 | 198 |
| 219 | 3300035118 | Ga0373954_0033188 | Ga0373954_0033188_195_842 | 198 |
| 220 | 3300035118 | Ga0373954_0119769 | Ga0373954_0119769_59_697 | 198 |
| 221 | 3300035119 | Ga0373956_0130482 | Ga0373956_0130482_52_690 | 198 |
| 222 | 3300035172 | Ga0373955_0076756 | Ga0373955_0076756_1160_1807 | 198 |
| 223 | 3300035410 | Ga0373924_0013913 | Ga0373924_0013913_922_1569 | 198 |
| 224 | 3300035692 | Ga0373935_0004219 | Ga0373935_0004219_7416_8063 | 198 |
| 225 | 3300035695 | Ga0373927_0002702 | Ga0373927_0002702_7235_7882 | 198 |
| 226 | 3300035724 | Ga0373933_0081404 | Ga0373933_0081404_21_668 | 198 |
| 227 | 3300037068 | Ga0373925_0009475 | Ga0373925_0009475_4571_5218 | 198 |
| 228 | 3300037068 | Ga0373925_0132578 | Ga0373925_0132578_1089_1727 | 198 |
| 229 | 3300037418 | Ga0395900_0512133 | Ga0395900_0512133_156_800 | 198 |
| 230 | 3300037466 | Ga0395898_0028587 | Ga0395898_0028587_3993_4637 | 198 |
| 231 | 3300037466 | Ga0395898_0168478 | Ga0395898_0168478_1146_1805 | 198 |
| 232 | 3300044656 | Ga0466969_0285521 | Ga0466969_0285521_85_729 | 198 |
| 233 | 3300044694 | Ga0466963_0047921 | Ga0466963_0047921_675_1322 | 198 |
| 234 | 3300044842 | Ga0466957_0070450 | Ga0466957_0070450_718_1368 | 198 |
| 235 | 3300044842 | Ga0466957_0336004 | Ga0466957_0336004_69_713 | 198 |
| 236 | 3300045049 | Ga0466959_0055807 | Ga0466959_0055807_175_819 | 198 |
| 237 | 3300045976 | Ga0466967_0562064 | Ga0466967_0562064_201_854 | 198 |
| 238 | 3300046454 | Ga0495592_0014358 | Ga0495592_0014358_1123_1770 | 198 |
| 239 | 3300046455 | Ga0495603_0000521 | Ga0495603_0000521_16199_16846 | 198 |
| 240 | 3300046459 | Ga0495629_0000416 | Ga0495629_0000416_26690_27337 | 198 |
| 241 | 3300046461 | Ga0495641_0002593 | Ga0495641_0002593_6260_6907 | 198 |
| 242 | 3300046472 | Ga0495580_0016728 | Ga0495580_0016728_2152_2799 | 198 |
| 243 | 3300046473 | Ga0495582_0002376 | Ga0495582_0002376_4619_5266 | 198 |
| 244 | 3300046475 | Ga0495639_0001046 | Ga0495639_0001046_3879_4526 | 198 |
| 245 | 3300046476 | Ga0495662_0003282 | Ga0495662_0003282_7390_8037 | 198 |
| 246 | 3300046477 | Ga0495664_0009265 | Ga0495664_0009265_1640_2287 | 198 |
| 247 | 3300046499 | Ga0495594_0000194 | Ga0495594_0000194_23613_24260 | 198 |
| 248 | 3300046516 | Ga0495628_0058442 | Ga0495628_0058442_934_1581 | 198 |
| 249 | 3300046517 | Ga0495630_0006451 | Ga0495630_0006451_7337_7984 | 198 |
| 250 | 3300046526 | Ga0495666_0029054 | Ga0495666_0029054_1069_1716 | 198 |
| 251 | 3300046529 | Ga0495652_0030338 | Ga0495652_0030338_1750_2397 | 198 |
| 252 | 3300046531 | Ga0495665_0003441 | Ga0495665_0003441_607_1254 | 198 |
| 253 | 3300046533 | Ga0495640_0006591 | Ga0495640_0006591_5214_5861 | 198 |
| 254 | 3300046557 | Ga0495622_0002024 | Ga0495622_0002024_4620_5267 | 198 |
| 255 | 3300046642 | Ga0495634_0000602 | Ga0495634_0000602_7516_8163 | 198 |
| 256 | 3300046681 | Ga0495647_0000414 | Ga0495647_0000414_7701_8348 | 198 |
| 257 | 3300046683 | Ga0495658_0002719 | Ga0495658_0002719_4315_4962 | 198 |
| 258 | 3300046689 | Ga0495613_0028530 | Ga0495613_0028530_184_831 | 198 |
| 259 | 3300046690 | Ga0495624_0003072 | Ga0495624_0003072_3620_4267 | 198 |
| 260 | 3300047315 | Ga0495581_0000133 | Ga0495581_0000133_4620_5267 | 198 |
| 261 | 3300047319 | Ga0495674_0000874 | Ga0495674_0000874_26647_27294 | 198 |
| 262 | 3300047321 | Ga0495676_0015692 | Ga0495676_0015692_313_960 | 198 |
| 263 | 3300047471 | Ga0495684_0025060 | Ga0495684_0025060_1164_1811 | 198 |
| 264 | 3300047673 | Ga0495593_0000022 | Ga0495593_0000022_7268_7915 | 198 |
| 265 | 3300048929 | Ga0496126_0228130 | Ga0496126_0228130_874_1512 | 198 |
| 266 | 3300049581 | Ga0501047_0074414 | Ga0501047_0074414_1832_2470 | 198 |
| 267 | 3300049586 | Ga0501070_0057445 | Ga0501070_0057445_2275_2913 | 198 |
| 268 | 3300049589 | Ga0501073_0215417 | Ga0501073_0215417_611_1249 | 198 |
| 269 | 3300049823 | Ga0501044_0037782 | Ga0501044_0037782_3528_4166 | 198 |
| 270 | 3300053078 | Ga0495612_0077769 | Ga0495612_0077769_687_1334 | 198 |
| 271 | 3300053163 | Ga0500639_001074 | Ga0500639_001074_5616_6254 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.5008 | 9 | 180 |
| 7vcf-assembly1.cif.gz_A | cryo-em structure of chlamydomonas toc-tic supercomplex | 0.4549 | 9 | 180 |
| 7xzi-assembly1.cif.gz_A | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.4442 | 9 | 180 |
| 7xzi-assembly1.cif.gz_A | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.401 | 9 | 180 |
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.318 | 7 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4791 | 9 | 188 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4619 | 9 | 164 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4446 | 9 | 188 | 1.20.1250.20 |
| af_Q4DN15_2_175_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4399 | 8 | 159 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3965 | 9 | 164 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839XMX5-F1-model_v4 | Threonine/homoserine/homoserine lactone efflux protein | 0.9263 | 10 | 183 |
GO:0005886
GO:0015171 |
| AF-A0A4R5TMY3-F1-model_v4 | LysE family translocator | 0.9222 | 9 | 166 |
GO:0005886
GO:0015171 |
| AF-A0A2N0JN51-F1-model_v4 | deleted | 0.9012 | 7 | 166 |
|
| AF-A0A2A4CU03-F1-model_v4 | Lysine transporter LysE | 0.901 | 7 | 188 |
GO:0005886
GO:0015171 |
| AF-A0A2S9L2B7-F1-model_v4 | deleted | 0.897 | 7 | 192 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar