F377484

General Info

Members Datasets Scaffolds Average Seq Length
271 164 259 209

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10012003|Ga0070710_100120032
Length 236
Sequence MSYLAEESSGRNSYPRREQRLCGFRTQEGNRLMLAIHDLWLFIISGLILNITPGPDTAYIVGRSAQFGWRGGAAAALGIATGCLVHVLACAIGLSALLAASATAFTLVKWAGAAYLCYIGIRMLLRDQARDRTPPLSKVFWQGALTNVLNPKVALFFLAFLPQFVDAGAPGKALAFLVLGLIFVFNGTLWCLAVAAFSARAARRFSGSGRAMRWINRALGGMFVYLGARIAMIQAR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
5 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
6 2818991452 Burkholderia cepacia 561 Isolate Unclassified
7 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
8 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
9 2928170801 Burkholderia sp. 572 Isolate Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
41 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
75 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
76 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
160 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
163 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
164 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0.37
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 2.95
Rhizoplane 1.11
Rhizosphere 87.82
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10047033 3300003323 Bacteria 4460
2 JGI25404J52841_10004890 3300003659 Bacteria 2750
3 Ga0070658_10102571 3300005327 Bacteria 2366
4 Ga0070683_100084653 3300005329 Bacteria 2971
5 Ga0070683_100090488 3300005329 Bacteria 2873
6 Ga0070683_100132939 3300005329 Bacteria 2355
7 Ga0070680_100021762 3300005336 Bacteria 5099
8 Ga0070691_10103776 3300005341 Bacteria 1415
9 Ga0070691_10353270 3300005341 Bacteria 817
10 Ga0070661_100016975 3300005344 Bacteria 5156
11 Ga0070709_10001261 3300005434 Bacteria 13852
12 Ga0070709_10042951 3300005434 Bacteria 2794
13 Ga0070709_10438003 3300005434 Bacteria 982
14 Ga0070714_100015382 3300005435 Bacteria 6157
15 Ga0070714_100055503 3300005435 Bacteria 3386
16 Ga0070713_100006456 3300005436 Bacteria 8131
17 Ga0070713_100009070 3300005436 Bacteria 7093
18 Ga0070713_100114913 3300005436 Bacteria 2352
19 Ga0070710_10012003 3300005437 Bacteria 4294
20 Ga0070710_10026864 3300005437 Bacteria 3064
21 Ga0070711_100035551 3300005439 Bacteria 3332
22 Ga0070681_10034508 3300005458 Bacteria 5079
23 Ga0070681_10057172 3300005458 Bacteria 3881
24 Ga0070681_10155769 3300005458 Bacteria 2210
25 Ga0070681_10321866 3300005458 Bacteria 1456
26 Ga0070706_100034743 3300005467 Bacteria 4656
27 Ga0070698_100143051 3300005471 Bacteria 2342
28 Ga0070679_100027890 3300005530 Bacteria 5563
29 Ga0070679_100041624 3300005530 Bacteria 4572
30 Ga0070679_100178419 3300005530 Bacteria 2097
31 Ga0070684_100017185 3300005535 Bacteria 5930
32 Ga0070684_100045566 3300005535 Bacteria 3797
33 Ga0070684_100046847 3300005535 Bacteria 3746
34 Ga0068853_100138268 3300005539 Bacteria 2185
35 Ga0068853_100213484 3300005539 Bacteria 1760
36 Ga0068853_100333177 3300005539 Bacteria 1409
37 Ga0068853_100502263 3300005539 Bacteria 1145
38 Ga0070696_100640076 3300005546 Bacteria 861
39 Ga0070693_100208188 3300005547 Bacteria 1275
40 Ga0068855_100071617 3300005563 Bacteria 4031
41 Ga0068855_100164008 3300005563 Bacteria 2520
42 Ga0068855_100258741 3300005563 Bacteria 1940
43 Ga0070664_100010720 3300005564 Bacteria 7433
44 Ga0068857_100002234 3300005577 Bacteria 15761
45 Ga0068857_100043708 3300005577 Bacteria 3973
46 Ga0068857_100104655 3300005577 Bacteria 2541
47 Ga0068857_100239943 3300005577 Bacteria 1659
48 Ga0068856_100077613 3300005614 Bacteria 3291
49 Ga0068852_100000512 3300005616 Bacteria 25561
50 Ga0081540_1061072 3300005983 Bacteria 1799
51 Ga0081540_1087805 3300005983 Bacteria 1377
52 Ga0081540_1088124 3300005983 Bacteria 1373
53 Ga0070717_10010384 3300006028 Bacteria 7029
54 Ga0070717_10399764 3300006028 Bacteria 1234
55 Ga0075364_10419158 3300006051 Bacteria 914
56 Ga0070716_100131746 3300006173 Bacteria 1581
57 Ga0070712_100003826 3300006175 Bacteria 9267
58 Ga0070712_100555755 3300006175 Bacteria 967
59 Ga0099824_1005278 3300006942 Bacteria 18259
60 Ga0099822_1013722 3300006943 Bacteria 9448
61 Ga0105240_10001155 3300009093 Bacteria 46229
62 Ga0105240_10033109 3300009093 Bacteria 6682
63 Ga0105240_10076367 3300009093 Bacteria 4130
64 Ga0105240_10447611 3300009093 Bacteria 1446
65 Ga0114129_11536674 3300009147 Bacteria 817
66 Ga0105241_10111346 3300009174 Bacteria 2192
67 Ga0105241_10162764 3300009174 Bacteria 1836
68 Ga0105237_10029341 3300009545 Bacteria 5593
69 Ga0105237_10082162 3300009545 Bacteria 3213
70 Ga0105237_10096966 3300009545 Bacteria 2939
71 Ga0105237_10230052 3300009545 Bacteria 1855
72 Ga0105238_10050622 3300009551 Bacteria 4181
73 Ga0105238_10087448 3300009551 Bacteria 3104
74 Ga0105246_10170766 3300011119 Bacteria 1665
75 Ga0157373_10068121 3300013100 Bacteria 2516
76 Ga0157370_10205448 3300013104 Bacteria 1826
77 Ga0157369_10011069 3300013105 Bacteria 10263
78 Ga0157369_10018027 3300013105 Bacteria 7921
79 Ga0157369_10022494 3300013105 Bacteria 7032
80 Ga0157369_10056348 3300013105 Bacteria 4241
81 Ga0157369_10265362 3300013105 Bacteria 1790
82 Ga0157372_10416897 3300013307 Bacteria 1565
83 Ga0157372_10892342 3300013307 Bacteria 1032
84 Ga0157379_10341733 3300014968 Bacteria 1369
85 Ga0183361_10001 3300016635 Bacteria 908583
86 Ga0206356_10231740 3300020070 Bacteria 1493
87 Ga0207692_10401751 3300025898 Bacteria 854
88 Ga0207699_10021452 3300025906 Bacteria 3482
89 Ga0207705_10078039 3300025909 Bacteria 2410
90 Ga0207707_10000582 3300025912 Bacteria 37091
91 Ga0207707_10045748 3300025912 Bacteria 3813
92 Ga0207707_10211297 3300025912 Bacteria 1690
93 Ga0207707_10529619 3300025912 Bacteria 1003
94 Ga0207695_10024109 3300025913 Bacteria 6854
95 Ga0207695_10059884 3300025913 Bacteria 3946
96 Ga0207671_10028966 3300025914 Bacteria 4136
97 Ga0207671_10383241 3300025914 Bacteria 1117
98 Ga0207693_10008213 3300025915 Bacteria 8550
99 Ga0207693_10015849 3300025915 Bacteria 6037
100 Ga0207693_10455549 3300025915 Bacteria 999
101 Ga0207663_10035123 3300025916 Bacteria 3004
102 Ga0207663_10039955 3300025916 Bacteria 2847
103 Ga0207652_10025370 3300025921 Bacteria 4927
104 Ga0207652_10049707 3300025921 Bacteria 3591
105 Ga0207652_10066178 3300025921 Bacteria 3131
106 Ga0207694_10049921 3300025924 Bacteria 3239
107 Ga0207694_10050640 3300025924 Bacteria 3217
108 Ga0207700_10021493 3300025928 Bacteria 4407
109 Ga0207700_10038115 3300025928 Bacteria 3487
110 Ga0207700_10095006 3300025928 Bacteria 2364
111 Ga0207700_10107315 3300025928 Bacteria 2240
112 Ga0207664_10068373 3300025929 Bacteria 2853
113 Ga0207664_10084195 3300025929 Bacteria 2594
114 Ga0207665_10042744 3300025939 Bacteria 3029
115 Ga0207665_10306276 3300025939 Bacteria 1189
116 Ga0207661_10000109 3300025944 Bacteria 52179
117 Ga0207661_10032320 3300025944 Bacteria 4053
118 Ga0207661_10297069 3300025944 Bacteria 1447
119 Ga0207667_10024603 3300025949 Bacteria 6607
120 Ga0207667_10057371 3300025949 Bacteria 4087
121 Ga0207667_10108298 3300025949 Bacteria 2867
122 Ga0207639_10123945 3300026041 Bacteria 2128
123 Ga0207639_10205289 3300026041 Bacteria 1693
124 Ga0207639_10392532 3300026041 Bacteria 1248
125 Ga0207639_10424891 3300026041 Bacteria 1202
126 Ga0207702_10055378 3300026078 Bacteria 3363
127 Ga0207674_10000140 3300026116 Bacteria 84173
128 Ga0207674_10033286 3300026116 Bacteria 5397
129 Ga0207674_10057207 3300026116 Bacteria 3953
130 Ga0207674_10250793 3300026116 Bacteria 1717
131 Ga0207698_10741283 3300026142 Bacteria 980
132 Ga0209589_1000005 3300027357 Bacteria 530958
133 Ga0209489_100005 3300027361 Bacteria 530958
134 Ga0209700_100006 3300027363 Bacteria 530958
135 Ga0307511_10051177 3300030521 Bacteria 3315
136 Ga0307508_10000029 3300031616 Bacteria 168411
137 Ga0307405_10172340 3300031731 Bacteria 1545
138 Ga0307415_100092554 3300032126 Bacteria 2193
139 Ga0307507_10018699 3300033179 Bacteria 7861
140 Ga0307510_10119731 3300033180 Bacteria 2342
141 Ga0373926_0007645 3300035083 Bacteria 3599
142 Ga0373936_0005526 3300035113 Bacteria 4771
143 Ga0373936_0012437 3300035113 Bacteria 3238
144 Ga0373936_0040401 3300035113 Bacteria 1868
145 Ga0373936_0090694 3300035113 Bacteria 1281
146 Ga0373945_0013564 3300035116 Bacteria 2721
147 Ga0373945_0039915 3300035116 Bacteria 1693
148 Ga0373954_0033188 3300035118 Bacteria 2388
149 Ga0373954_0119769 3300035118 Bacteria 1277
150 Ga0373956_0130482 3300035119 Bacteria 1176
151 Ga0373957_0037232 3300035120 Bacteria 1817
152 Ga0373943_0189012 3300035170 Bacteria 1135
153 Ga0373946_0085673 3300035171 Bacteria 1387
154 Ga0373955_0029554 3300035172 Bacteria 2851
155 Ga0373955_0076756 3300035172 Bacteria 1880
156 Ga0373924_0013913 3300035410 Bacteria 3031
157 Ga0373935_0004219 3300035692 Bacteria 8427
158 Ga0373935_0130931 3300035692 Bacteria 1685
159 Ga0373927_0002702 3300035695 Bacteria 12926
160 Ga0373927_0025898 3300035695 Bacteria 3834
161 Ga0373927_0034846 3300035695 Bacteria 3273
162 Ga0373927_0403522 3300035695 Bacteria 902
163 Ga0373933_0081404 3300035724 Bacteria 1986
164 Ga0373937_0393086 3300036401 Bacteria 1315
165 Ga0373925_0009475 3300037068 Bacteria 7089
166 Ga0373925_0027154 3300037068 Bacteria 4192
167 Ga0373925_0132578 3300037068 Bacteria 1944
168 Ga0395899_0087469 3300037312 Bacteria 2262
169 Ga0395900_0065657 3300037418 Bacteria 3728
170 Ga0395900_0512133 3300037418 Bacteria 1149
171 Ga0395898_0017601 3300037466 Bacteria 7294
172 Ga0395898_0028587 3300037466 Bacteria 5587
173 Ga0395898_0168478 3300037466 Bacteria 2094
174 Ga0395901_0000017 3300038443 Bacteria 345003
175 Ga0395901_0108383 3300038443 Bacteria 2916
176 Ga0436365_0768658 3300039437 Bacteria 1149
177 Ga0436363_0507825 3300039450 Bacteria 1934
178 Ga0436363_1529048 3300039450 Bacteria 1301
179 Ga0439436_0082390 3300041404 Bacteria 895
180 Ga0451577_0286761 3300042876 Bacteria 1492
181 Ga0466969_0285521 3300044656 Bacteria 747
182 Ga0466963_0047921 3300044694 Bacteria 2822
183 Ga0466970_0374564 3300044765 Bacteria 810
184 Ga0466957_0038377 3300044842 Bacteria 2886
185 Ga0466957_0070450 3300044842 Bacteria 2161
186 Ga0466957_0336004 3300044842 Bacteria 1022
187 Ga0466959_0055807 3300045049 Bacteria 2883
188 Ga0466959_0521419 3300045049 Bacteria 802
189 Ga0466958_0174846 3300045836 Bacteria 1361
190 Ga0466967_0076730 3300045976 Bacteria 3006
191 Ga0466967_0562064 3300045976 Bacteria 1123
192 Ga0495592_0014358 3300046454 Bacteria 6013
193 Ga0495603_0000521 3300046455 Bacteria 21337
194 Ga0495629_0000416 3300046459 Bacteria 35794
195 Ga0495629_0462358 3300046459 Bacteria 858
196 Ga0495641_0002593 3300046461 Bacteria 14172
197 Ga0495580_0016728 3300046472 Bacteria 5504
198 Ga0495580_0093424 3300046472 Bacteria 2093
199 Ga0495582_0002376 3300046473 Bacteria 10534
200 Ga0495639_0001046 3300046475 Bacteria 12485
201 Ga0495639_0051104 3300046475 Bacteria 1879
202 Ga0495662_0003282 3300046476 Bacteria 8189
203 Ga0495664_0009023 3300046477 Bacteria 5574
204 Ga0495664_0009265 3300046477 Bacteria 5505
205 Ga0495594_0000194 3300046499 Bacteria 29650
206 Ga0495628_0058442 3300046516 Bacteria 3030
207 Ga0495630_0006451 3300046517 Bacteria 8344
208 Ga0495630_0013707 3300046517 Bacteria 5894
209 Ga0495643_0241538 3300046522 Bacteria 847
210 Ga0495648_0118074 3300046524 Bacteria 1431
211 Ga0495666_0029054 3300046526 Bacteria 2720
212 Ga0495666_0059569 3300046526 Bacteria 1826
213 Ga0495652_0030338 3300046529 Bacteria 4743
214 Ga0495652_0088477 3300046529 Bacteria 2538
215 Ga0495665_0003441 3300046531 Bacteria 8598
216 Ga0495640_0006591 3300046533 Bacteria 9166
217 Ga0495640_0062062 3300046533 Bacteria 2536
218 Ga0495586_0046310 3300046535 Bacteria 2345
219 Ga0495645_0096868 3300046543 Bacteria 2102
220 Ga0495622_0002024 3300046557 Bacteria 9908
221 Ga0495622_0036646 3300046557 Bacteria 2286
222 Ga0495634_0000602 3300046642 Bacteria 34812
223 Ga0495634_0071334 3300046642 Bacteria 2287
224 Ga0495635_0216177 3300046663 Bacteria 1297
225 Ga0495599_0126644 3300046678 Bacteria 1587
226 Ga0495647_0000414 3300046681 Bacteria 12222
227 Ga0495647_0048841 3300046681 Bacteria 1638
228 Ga0495658_0002719 3300046683 Bacteria 8895
229 Ga0495658_0070830 3300046683 Bacteria 2024
230 Ga0495613_0028530 3300046689 Bacteria 4151
231 Ga0495613_0234439 3300046689 Bacteria 1285
232 Ga0495624_0003072 3300046690 Bacteria 12498
233 Ga0495581_0000133 3300047315 Bacteria 32384
234 Ga0495674_0000874 3300047319 Bacteria 28828
235 Ga0495674_0111111 3300047319 Bacteria 2323
236 Ga0495676_0015692 3300047321 Bacteria 6736
237 Ga0495684_0018475 3300047471 Bacteria 5371
238 Ga0495684_0025060 3300047471 Bacteria 4588
239 Ga0495593_0000022 3300047673 Bacteria 69741
240 Ga0495593_0009120 3300047673 Bacteria 5754
241 Ga0496101_0617069 3300048904 Bacteria 857
242 Ga0496114_0048968 3300048917 Bacteria 3516
243 Ga0496121_0101135 3300048924 Bacteria 2224
244 Ga0496126_0115011 3300048929 Bacteria 2340
245 Ga0496126_0228130 3300048929 Bacteria 1561
246 Ga0501047_0074414 3300049581 Bacteria 3270
247 Ga0501070_0057445 3300049586 Bacteria 3225
248 Ga0501073_0215417 3300049589 Bacteria 1327
249 Ga0501044_0037782 3300049823 Bacteria 5046
250 nmdc:mga05p37_1242562_c1 3300050507 Bacteria 765
251 Ga0495601_0121553 3300053077 Bacteria 1696
252 Ga0495612_0013597 3300053078 Bacteria 3279
253 Ga0495612_0077769 3300053078 Bacteria 1391
254 Ga0500647_0126797 3300053091 Bacteria 1205
255 Ga0500559_0047056 3300053136 Bacteria 1893
256 Ga0500639_001074 3300053163 Bacteria 13945
257 Ga0500639_223401 3300053163 Bacteria 783
258 Ga0500636_0135094 3300053177 Bacteria 1370
259 Ga0500637_0055566 3300053178 Bacteria 2261

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0101135 Ga0496121_0101135_28_510 146
2 3300005434 Ga0070709_10438003 Ga0070709_104380032 158
3 3300053136 Ga0500559_0047056 Ga0500559_0047056_1343_1879 164
4 3300014968 Ga0157379_10341733 Ga0157379_103417332 175
5 3300041404 Ga0439436_0082390 Ga0439436_0082390_61_693 180
6 3300016635 Ga0183361_10001 Ga0183361_10001535 181
7 3300046524 Ga0495648_0118074 Ga0495648_0118074_749_1390 181
8 3300048929 Ga0496126_0115011 Ga0496126_0115011_1323_1961 181
9 3300009147 Ga0114129_11536674 Ga0114129_115366741 182
10 3300050507 nmdc:mga05p37_1242562_c1 nmdc:mga05p37_1242562_c1_144_734 182
11 3300048904 Ga0496101_0617069 Ga0496101_0617069_14_607 183
12 3300048917 Ga0496114_0048968 Ga0496114_0048968_15_608 183
13 3300005329 Ga0070683_100132939 Ga0070683_1001329392 186
14 3300009545 Ga0105237_10096966 Ga0105237_100969662 186
15 3300025914 Ga0207671_10383241 Ga0207671_103832412 186
16 3300025944 Ga0207661_10032320 Ga0207661_100323203 186
17 3300030521 Ga0307511_10051177 Ga0307511_100511771 186
18 3300033179 Ga0307507_10018699 Ga0307507_100186993 186
19 3300033180 Ga0307510_10119731 Ga0307510_101197312 186
20 3300035695 Ga0373927_0025898 Ga0373927_0025898_1658_2299 186
21 3300037068 Ga0373925_0027154 Ga0373925_0027154_1645_2286 186
22 3300046557 Ga0495622_0036646 Ga0495622_0036646_55_696 186
23 3300053091 Ga0500647_0126797 Ga0500647_0126797_241_882 186
24 3300053163 Ga0500639_223401 Ga0500639_223401_86_727 186
25 3300053177 Ga0500636_0135094 Ga0500636_0135094_295_936 186
26 3300053178 Ga0500637_0055566 Ga0500637_0055566_199_840 186
27 3300005458 Ga0070681_10057172 Ga0070681_100571724 187
28 3300005530 Ga0070679_100041624 Ga0070679_1000416246 187
29 3300031616 Ga0307508_10000029 Ga0307508_10000029109 187
30 iso_pu_bacteria 2513237166 2514046783 191
31 iso_pu_bacteria 2721755763 2723875829 191
32 iso_pu_bacteria 2599185239 2599740127 192
33 iso_pu_bacteria 2818991452 2819635908 192
34 iso_pu_bacteria 2870068957 2870069782 192
35 iso_pu_bacteria 2928170801 2928176729 192
36 iso_pu_bacteria 8018845410 8018847123 192
37 iso_pu_bacteria 8020945358 8020949016 192
38 iso_pu_bacteria 8021120328 8021128117 192
39 3300005436 Ga0070713_100009070 Ga0070713_1000090702 194
40 3300005437 Ga0070710_10012003 Ga0070710_100120032 194
41 3300005458 Ga0070681_10321866 Ga0070681_103218661 194
42 3300005530 Ga0070679_100178419 Ga0070679_1001784192 194
43 3300009093 Ga0105240_10076367 Ga0105240_100763674 194
44 3300013105 Ga0157369_10265362 Ga0157369_102653622 194
45 3300025912 Ga0207707_10529619 Ga0207707_105296192 194
46 3300025921 Ga0207652_10049707 Ga0207652_100497075 194
47 3300025928 Ga0207700_10021493 Ga0207700_100214933 194
48 3300038443 Ga0395901_0000017 Ga0395901_0000017_181448_182104 194
49 3300042876 Ga0451577_0286761 Ga0451577_0286761_321_956 194
50 iso_pu_bacteria 2508501128 2509151300 194
51 iso_pu_bacteria 2513237141 2513892377 194
52 3300044765 Ga0466970_0374564 Ga0466970_0374564_119_760 195
53 3300045049 Ga0466959_0521419 Ga0466959_0521419_126_767 195
54 3300045836 Ga0466958_0174846 Ga0466958_0174846_583_1233 195
55 3300005341 Ga0070691_10103776 Ga0070691_101037762 196
56 3300005434 Ga0070709_10042951 Ga0070709_100429512 196
57 3300005435 Ga0070714_100055503 Ga0070714_1000555034 196
58 3300005436 Ga0070713_100114913 Ga0070713_1001149132 196
59 3300005535 Ga0070684_100045566 Ga0070684_1000455662 196
60 3300005539 Ga0068853_100502263 Ga0068853_1005022631 196
61 3300005577 Ga0068857_100043708 Ga0068857_1000437083 196
62 3300009545 Ga0105237_10029341 Ga0105237_100293415 196
63 3300025916 Ga0207663_10035123 Ga0207663_100351232 196
64 3300025924 Ga0207694_10049921 Ga0207694_100499213 196
65 3300025928 Ga0207700_10095006 Ga0207700_100950062 196
66 3300025929 Ga0207664_10084195 Ga0207664_100841952 196
67 3300026116 Ga0207674_10033286 Ga0207674_100332863 196
68 3300035695 Ga0373927_0403522 Ga0373927_0403522_153_782 196
69 3300039450 Ga0436363_1529048 Ga0436363_1529048_54_692 196
70 iso_pu_bacteria 2881412998 2881415479 196
71 3300003659 JGI25404J52841_10004890 JGI25404J52841_100048902 197
72 3300005329 Ga0070683_100090488 Ga0070683_1000904882 197
73 3300005535 Ga0070684_100017185 Ga0070684_1000171853 197
74 3300005539 Ga0068853_100213484 Ga0068853_1002134842 197
75 3300005539 Ga0068853_100333177 Ga0068853_1003331772 197
76 3300005563 Ga0068855_100071617 Ga0068855_1000716173 197
77 3300005577 Ga0068857_100239943 Ga0068857_1002399432 197
78 3300005983 Ga0081540_1061072 Ga0081540_10610722 197
79 3300005983 Ga0081540_1087805 Ga0081540_10878052 197
80 3300006051 Ga0075364_10419158 Ga0075364_104191582 197
81 3300006942 Ga0099824_1005278 Ga0099824_10052787 197
82 3300006943 Ga0099822_1013722 Ga0099822_10137226 197
83 3300009093 Ga0105240_10033109 Ga0105240_100331097 197
84 3300009545 Ga0105237_10082162 Ga0105237_100821624 197
85 3300009545 Ga0105237_10230052 Ga0105237_102300523 197
86 3300011119 Ga0105246_10170766 Ga0105246_101707662 197
87 3300013104 Ga0157370_10205448 Ga0157370_102054482 197
88 3300013105 Ga0157369_10011069 Ga0157369_100110695 197
89 3300013105 Ga0157369_10018027 Ga0157369_100180274 197
90 3300020070 Ga0206356_10231740 Ga0206356_102317402 197
91 3300025913 Ga0207695_10024109 Ga0207695_100241092 197
92 3300025914 Ga0207671_10028966 Ga0207671_100289664 197
93 3300025915 Ga0207693_10015849 Ga0207693_100158494 197
94 3300025928 Ga0207700_10038115 Ga0207700_100381153 197
95 3300025944 Ga0207661_10000109 Ga0207661_1000010914 197
96 3300025944 Ga0207661_10297069 Ga0207661_102970692 197
97 3300025949 Ga0207667_10057371 Ga0207667_100573713 197
98 3300026041 Ga0207639_10123945 Ga0207639_101239452 197
99 3300026041 Ga0207639_10205289 Ga0207639_102052892 197
100 3300026116 Ga0207674_10250793 Ga0207674_102507932 197
101 3300027357 Ga0209589_1000005 Ga0209589_1000005337 197
102 3300027361 Ga0209489_100005 Ga0209489_100005337 197
103 3300027363 Ga0209700_100006 Ga0209700_100006337 197
104 3300031731 Ga0307405_10172340 Ga0307405_101723402 197
105 3300032126 Ga0307415_100092554 Ga0307415_1000925542 197
106 3300035083 Ga0373926_0007645 Ga0373926_0007645_1591_2229 197
107 3300035113 Ga0373936_0012437 Ga0373936_0012437_1887_2525 197
108 3300035116 Ga0373945_0039915 Ga0373945_0039915_473_1111 197
109 3300035120 Ga0373957_0037232 Ga0373957_0037232_604_1242 197
110 3300035170 Ga0373943_0189012 Ga0373943_0189012_158_796 197
111 3300035171 Ga0373946_0085673 Ga0373946_0085673_307_945 197
112 3300035172 Ga0373955_0029554 Ga0373955_0029554_1332_1970 197
113 3300035692 Ga0373935_0130931 Ga0373935_0130931_712_1350 197
114 3300035695 Ga0373927_0034846 Ga0373927_0034846_874_1512 197
115 3300036401 Ga0373937_0393086 Ga0373937_0393086_266_904 197
116 3300037312 Ga0395899_0087469 Ga0395899_0087469_1521_2156 197
117 3300037418 Ga0395900_0065657 Ga0395900_0065657_1199_1834 197
118 3300037466 Ga0395898_0017601 Ga0395898_0017601_4745_5380 197
119 3300038443 Ga0395901_0108383 Ga0395901_0108383_2023_2658 197
120 3300039437 Ga0436365_0768658 Ga0436365_0768658_42_677 197
121 3300039450 Ga0436363_0507825 Ga0436363_0507825_599_1234 197
122 3300044842 Ga0466957_0038377 Ga0466957_0038377_529_1179 197
123 3300045976 Ga0466967_0076730 Ga0466967_0076730_445_1143 197
124 3300046459 Ga0495629_0462358 Ga0495629_0462358_53_691 197
125 3300046472 Ga0495580_0093424 Ga0495580_0093424_505_1143 197
126 3300046475 Ga0495639_0051104 Ga0495639_0051104_634_1272 197
127 3300046477 Ga0495664_0009023 Ga0495664_0009023_4807_5445 197
128 3300046517 Ga0495630_0013707 Ga0495630_0013707_3221_3859 197
129 3300046522 Ga0495643_0241538 Ga0495643_0241538_94_732 197
130 3300046526 Ga0495666_0059569 Ga0495666_0059569_798_1436 197
131 3300046529 Ga0495652_0088477 Ga0495652_0088477_827_1465 197
132 3300046533 Ga0495640_0062062 Ga0495640_0062062_1631_2269 197
133 3300046535 Ga0495586_0046310 Ga0495586_0046310_626_1264 197
134 3300046543 Ga0495645_0096868 Ga0495645_0096868_848_1486 197
135 3300046642 Ga0495634_0071334 Ga0495634_0071334_258_896 197
136 3300046663 Ga0495635_0216177 Ga0495635_0216177_340_978 197
137 3300046678 Ga0495599_0126644 Ga0495599_0126644_598_1236 197
138 3300046681 Ga0495647_0048841 Ga0495647_0048841_270_908 197
139 3300046683 Ga0495658_0070830 Ga0495658_0070830_907_1545 197
140 3300046689 Ga0495613_0234439 Ga0495613_0234439_37_675 197
141 3300047319 Ga0495674_0111111 Ga0495674_0111111_181_819 197
142 3300047471 Ga0495684_0018475 Ga0495684_0018475_4407_5045 197
143 3300047673 Ga0495593_0009120 Ga0495593_0009120_4784_5422 197
144 3300053077 Ga0495601_0121553 Ga0495601_0121553_987_1625 197
145 3300053078 Ga0495612_0013597 Ga0495612_0013597_543_1181 197
146 3300003323 rootH1_10047033 rootH1_100470333 198
147 3300005327 Ga0070658_10102571 Ga0070658_101025713 198
148 3300005329 Ga0070683_100084653 Ga0070683_1000846533 198
149 3300005336 Ga0070680_100021762 Ga0070680_1000217625 198
150 3300005341 Ga0070691_10353270 Ga0070691_103532701 198
151 3300005344 Ga0070661_100016975 Ga0070661_1000169752 198
152 3300005434 Ga0070709_10001261 Ga0070709_1000126111 198
153 3300005435 Ga0070714_100015382 Ga0070714_1000153828 198
154 3300005436 Ga0070713_100006456 Ga0070713_1000064564 198
155 3300005437 Ga0070710_10026864 Ga0070710_100268643 198
156 3300005439 Ga0070711_100035551 Ga0070711_1000355512 198
157 3300005458 Ga0070681_10034508 Ga0070681_100345083 198
158 3300005458 Ga0070681_10155769 Ga0070681_101557692 198
159 3300005467 Ga0070706_100034743 Ga0070706_1000347434 198
160 3300005471 Ga0070698_100143051 Ga0070698_1001430513 198
161 3300005530 Ga0070679_100027890 Ga0070679_1000278906 198
162 3300005535 Ga0070684_100046847 Ga0070684_1000468473 198
163 3300005539 Ga0068853_100138268 Ga0068853_1001382683 198
164 3300005546 Ga0070696_100640076 Ga0070696_1006400761 198
165 3300005547 Ga0070693_100208188 Ga0070693_1002081882 198
166 3300005563 Ga0068855_100164008 Ga0068855_1001640082 198
167 3300005563 Ga0068855_100258741 Ga0068855_1002587412 198
168 3300005564 Ga0070664_100010720 Ga0070664_1000107206 198
169 3300005577 Ga0068857_100002234 Ga0068857_1000022346 198
170 3300005577 Ga0068857_100104655 Ga0068857_1001046552 198
171 3300005614 Ga0068856_100077613 Ga0068856_1000776133 198
172 3300005616 Ga0068852_100000512 Ga0068852_10000051211 198
173 3300005983 Ga0081540_1088124 Ga0081540_10881242 198
174 3300006028 Ga0070717_10010384 Ga0070717_100103842 198
175 3300006028 Ga0070717_10399764 Ga0070717_103997642 198
176 3300006173 Ga0070716_100131746 Ga0070716_1001317462 198
177 3300006175 Ga0070712_100003826 Ga0070712_1000038264 198
178 3300006175 Ga0070712_100555755 Ga0070712_1005557552 198
179 3300009093 Ga0105240_10001155 Ga0105240_1000115524 198
180 3300009093 Ga0105240_10447611 Ga0105240_104476111 198
181 3300009174 Ga0105241_10111346 Ga0105241_101113462 198
182 3300009174 Ga0105241_10162764 Ga0105241_101627642 198
183 3300009551 Ga0105238_10050622 Ga0105238_100506223 198
184 3300009551 Ga0105238_10087448 Ga0105238_100874482 198
185 3300013100 Ga0157373_10068121 Ga0157373_100681212 198
186 3300013105 Ga0157369_10022494 Ga0157369_100224946 198
187 3300013105 Ga0157369_10056348 Ga0157369_100563482 198
188 3300013307 Ga0157372_10416897 Ga0157372_104168972 198
189 3300013307 Ga0157372_10892342 Ga0157372_108923422 198
190 3300025898 Ga0207692_10401751 Ga0207692_104017512 198
191 3300025906 Ga0207699_10021452 Ga0207699_100214522 198
192 3300025909 Ga0207705_10078039 Ga0207705_100780392 198
193 3300025912 Ga0207707_10000582 Ga0207707_1000058237 198
194 3300025912 Ga0207707_10045748 Ga0207707_100457484 198
195 3300025912 Ga0207707_10211297 Ga0207707_102112971 198
196 3300025913 Ga0207695_10059884 Ga0207695_100598843 198
197 3300025915 Ga0207693_10008213 Ga0207693_100082134 198
198 3300025915 Ga0207693_10455549 Ga0207693_104555492 198
199 3300025916 Ga0207663_10039955 Ga0207663_100399552 198
200 3300025921 Ga0207652_10025370 Ga0207652_100253703 198
201 3300025921 Ga0207652_10066178 Ga0207652_100661783 198
202 3300025924 Ga0207694_10050640 Ga0207694_100506403 198
203 3300025928 Ga0207700_10107315 Ga0207700_101073152 198
204 3300025929 Ga0207664_10068373 Ga0207664_100683734 198
205 3300025939 Ga0207665_10042744 Ga0207665_100427442 198
206 3300025939 Ga0207665_10306276 Ga0207665_103062762 198
207 3300025949 Ga0207667_10024603 Ga0207667_100246033 198
208 3300025949 Ga0207667_10108298 Ga0207667_101082982 198
209 3300026041 Ga0207639_10392532 Ga0207639_103925321 198
210 3300026041 Ga0207639_10424891 Ga0207639_104248912 198
211 3300026078 Ga0207702_10055378 Ga0207702_100553783 198
212 3300026116 Ga0207674_10000140 Ga0207674_1000014011 198
213 3300026116 Ga0207674_10057207 Ga0207674_100572072 198
214 3300026142 Ga0207698_10741283 Ga0207698_107412831 198
215 3300035113 Ga0373936_0005526 Ga0373936_0005526_4018_4665 198
216 3300035113 Ga0373936_0040401 Ga0373936_0040401_282_920 198
217 3300035113 Ga0373936_0090694 Ga0373936_0090694_84_722 198
218 3300035116 Ga0373945_0013564 Ga0373945_0013564_1932_2579 198
219 3300035118 Ga0373954_0033188 Ga0373954_0033188_195_842 198
220 3300035118 Ga0373954_0119769 Ga0373954_0119769_59_697 198
221 3300035119 Ga0373956_0130482 Ga0373956_0130482_52_690 198
222 3300035172 Ga0373955_0076756 Ga0373955_0076756_1160_1807 198
223 3300035410 Ga0373924_0013913 Ga0373924_0013913_922_1569 198
224 3300035692 Ga0373935_0004219 Ga0373935_0004219_7416_8063 198
225 3300035695 Ga0373927_0002702 Ga0373927_0002702_7235_7882 198
226 3300035724 Ga0373933_0081404 Ga0373933_0081404_21_668 198
227 3300037068 Ga0373925_0009475 Ga0373925_0009475_4571_5218 198
228 3300037068 Ga0373925_0132578 Ga0373925_0132578_1089_1727 198
229 3300037418 Ga0395900_0512133 Ga0395900_0512133_156_800 198
230 3300037466 Ga0395898_0028587 Ga0395898_0028587_3993_4637 198
231 3300037466 Ga0395898_0168478 Ga0395898_0168478_1146_1805 198
232 3300044656 Ga0466969_0285521 Ga0466969_0285521_85_729 198
233 3300044694 Ga0466963_0047921 Ga0466963_0047921_675_1322 198
234 3300044842 Ga0466957_0070450 Ga0466957_0070450_718_1368 198
235 3300044842 Ga0466957_0336004 Ga0466957_0336004_69_713 198
236 3300045049 Ga0466959_0055807 Ga0466959_0055807_175_819 198
237 3300045976 Ga0466967_0562064 Ga0466967_0562064_201_854 198
238 3300046454 Ga0495592_0014358 Ga0495592_0014358_1123_1770 198
239 3300046455 Ga0495603_0000521 Ga0495603_0000521_16199_16846 198
240 3300046459 Ga0495629_0000416 Ga0495629_0000416_26690_27337 198
241 3300046461 Ga0495641_0002593 Ga0495641_0002593_6260_6907 198
242 3300046472 Ga0495580_0016728 Ga0495580_0016728_2152_2799 198
243 3300046473 Ga0495582_0002376 Ga0495582_0002376_4619_5266 198
244 3300046475 Ga0495639_0001046 Ga0495639_0001046_3879_4526 198
245 3300046476 Ga0495662_0003282 Ga0495662_0003282_7390_8037 198
246 3300046477 Ga0495664_0009265 Ga0495664_0009265_1640_2287 198
247 3300046499 Ga0495594_0000194 Ga0495594_0000194_23613_24260 198
248 3300046516 Ga0495628_0058442 Ga0495628_0058442_934_1581 198
249 3300046517 Ga0495630_0006451 Ga0495630_0006451_7337_7984 198
250 3300046526 Ga0495666_0029054 Ga0495666_0029054_1069_1716 198
251 3300046529 Ga0495652_0030338 Ga0495652_0030338_1750_2397 198
252 3300046531 Ga0495665_0003441 Ga0495665_0003441_607_1254 198
253 3300046533 Ga0495640_0006591 Ga0495640_0006591_5214_5861 198
254 3300046557 Ga0495622_0002024 Ga0495622_0002024_4620_5267 198
255 3300046642 Ga0495634_0000602 Ga0495634_0000602_7516_8163 198
256 3300046681 Ga0495647_0000414 Ga0495647_0000414_7701_8348 198
257 3300046683 Ga0495658_0002719 Ga0495658_0002719_4315_4962 198
258 3300046689 Ga0495613_0028530 Ga0495613_0028530_184_831 198
259 3300046690 Ga0495624_0003072 Ga0495624_0003072_3620_4267 198
260 3300047315 Ga0495581_0000133 Ga0495581_0000133_4620_5267 198
261 3300047319 Ga0495674_0000874 Ga0495674_0000874_26647_27294 198
262 3300047321 Ga0495676_0015692 Ga0495676_0015692_313_960 198
263 3300047471 Ga0495684_0025060 Ga0495684_0025060_1164_1811 198
264 3300047673 Ga0495593_0000022 Ga0495593_0000022_7268_7915 198
265 3300048929 Ga0496126_0228130 Ga0496126_0228130_874_1512 198
266 3300049581 Ga0501047_0074414 Ga0501047_0074414_1832_2470 198
267 3300049586 Ga0501070_0057445 Ga0501070_0057445_2275_2913 198
268 3300049589 Ga0501073_0215417 Ga0501073_0215417_611_1249 198
269 3300049823 Ga0501044_0037782 Ga0501044_0037782_3528_4166 198
270 3300053078 Ga0495612_0077769 Ga0495612_0077769_687_1334 198
271 3300053163 Ga0500639_001074 Ga0500639_001074_5616_6254 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

47

234

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.5008 9 180
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4549 9 180
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4442 9 180
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.401 9 180
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.318 7 161
ID Description Score Start End Superfamily
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4791 9 188 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4619 9 164 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4446 9 188 1.20.1250.20
af_Q4DN15_2_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4399 8 159 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3965 9 164 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A839XMX5-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9263 10 183 GO:0005886
GO:0015171
AF-A0A4R5TMY3-F1-model_v4 LysE family translocator 0.9222 9 166 GO:0005886
GO:0015171
AF-A0A2N0JN51-F1-model_v4 deleted 0.9012 7 166
AF-A0A2A4CU03-F1-model_v4 Lysine transporter LysE 0.901 7 188 GO:0005886
GO:0015171
AF-A0A2S9L2B7-F1-model_v4 deleted 0.897 7 192

Feature Viewer

pLDDT pTM Quality
80.8 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map