F377697

General Info

Members Datasets Scaffolds Average Seq Length
271 150 540 475

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10031228|Ga0207687_100312282
Length 516
Sequence MRKTSSNAAIRGGTGVSPNKKHGLVAHATSRRHFLSQLGNGFGTIALTSLFQAENLLAAPPQSQIANQKSHLPHHPPKATRVIQLFMSGAASQCDTFDHKPLLQKYHGQKWDPGEKVELFQSSPGNTLASPWPWRQYGQSGKFINDCVAPLGSVVDEIAFIHNVVSKSNVHGPATFMQATGFVLPGFPSAGAWVSYGLGRLCDNLPTFVVLPDPRGFAPNGPKNWGAGFLPAEHQGTMIRPGAADPIADLFPPKNSFVKPDSEAEMQAALKLINRQHEESRAGDSRLDARIRSYELAAAMQLSAPHVLDITNEPKHIQDMYGLNTPDTKYDGPMNPGEEIRHFGRNCLVARRLLEQGVRFVQIWSGADNGFPRRNWDSHEDLRRDHWPLGLGMATGAAALIKDLKARGMLDDTLILWTTEFGRMPCSQGTTGRDHNPFVFTNWLAGGGIKPGVSFGQSDEWSFKPADPTNPTYCYDIHATLLHLLGLEHTKLTFRHNGIDRRLTDVHGHVIKELIA

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
146 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
147 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
148 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
149 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
150 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.37
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 0.74
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10031228 3300025927 Bacteria 3598
2 Ga0065704_10083987 3300005289 Bacteria 3391
3 Ga0065712_10077811 3300005290 Bacteria 3439
4 Ga0065712_10112404 3300005290 Bacteria 1791
5 Ga0065707_10133730 3300005295 Bacteria 1876
6 Ga0070658_10002039 3300005327 Bacteria 16940
7 Ga0070658_10007248 3300005327 Bacteria 8953
8 Ga0070683_100127662 3300005329 Bacteria 2405
9 Ga0070690_100061468 3300005330 Bacteria 2420
10 Ga0070670_100025279 3300005331 Bacteria 5109
11 Ga0070689_100010030 3300005340 Bacteria 6743
12 Ga0070689_100019826 3300005340 Bacteria 4978
13 Ga0070689_100022970 3300005340 Bacteria 4664
14 Ga0070689_100034460 3300005340 Bacteria 3863
15 Ga0070689_100040283 3300005340 Bacteria 3582
16 Ga0070688_100097580 3300005365 Bacteria 1932
17 Ga0070701_10015190 3300005438 Bacteria 3549
18 Ga0070694_100004055 3300005444 Bacteria 8776
19 Ga0070681_10077648 3300005458 Bacteria 3278
20 Ga0068853_100000001 3300005539 Bacteria 715840
21 Ga0068853_100000007 3300005539 Bacteria 283307
22 Ga0068853_100043914 3300005539 Bacteria 3825
23 Ga0070686_100004872 3300005544 Bacteria 7408
24 Ga0070686_100006402 3300005544 Bacteria 6542
25 Ga0070686_100033159 3300005544 Bacteria 3171
26 Ga0070665_100003235 3300005548 Bacteria 17502
27 Ga0070704_100002198 3300005549 Bacteria 10873
28 Ga0068855_100037010 3300005563 Bacteria 5806
29 Ga0068855_100039210 3300005563 Bacteria 5624
30 Ga0068855_100056465 3300005563 Bacteria 4607
31 Ga0068855_100101577 3300005563 Unclassified 3310
32 Ga0068855_100110250 3300005563 Bacteria 3160
33 Ga0068855_100153513 3300005563 Bacteria 2617
34 Ga0068857_100001967 3300005577 Bacteria 16614
35 Ga0068859_100132347 3300005617 Bacteria 2566
36 Ga0068859_100138430 3300005617 Bacteria 2508
37 Ga0068859_100321953 3300005617 Bacteria 1640
38 Ga0068864_100158028 3300005618 Bacteria 2059
39 Ga0068863_100225991 3300005841 Bacteria 1804
40 Ga0068858_100067505 3300005842 Bacteria 3313
41 Ga0068858_100098420 3300005842 Bacteria 2727
42 Ga0068862_100110689 3300005844 Bacteria 2410
43 Ga0068862_100194591 3300005844 Bacteria 1826
44 Ga0081455_10039993 3300005937 Bacteria 4139
45 Ga0097621_100191563 3300006237 Bacteria 1771
46 Ga0097621_100224183 3300006237 Bacteria 1639
47 Ga0075428_100001355 3300006844 Bacteria 25992
48 Ga0075428_100003043 3300006844 Bacteria 18300
49 Ga0075428_100004859 3300006844 Bacteria 14912
50 Ga0075428_100009369 3300006844 Bacteria 10862
51 Ga0075428_100039346 3300006844 Bacteria 5204
52 Ga0075428_100099019 3300006844 Unclassified 3179
53 Ga0075428_100174977 3300006844 Bacteria 2325
54 Ga0075430_100076846 3300006846 Bacteria 2799
55 Ga0075431_100018874 3300006847 Bacteria 7025
56 Ga0075431_100169246 3300006847 Bacteria 2246
57 Ga0075431_100184633 3300006847 Bacteria 2139
58 Ga0075433_10002140 3300006852 Bacteria 14955
59 Ga0075429_100051376 3300006880 Bacteria 3587
60 Ga0075429_100098292 3300006880 Bacteria 2554
61 Ga0075429_100102383 3300006880 Bacteria 2500
62 Ga0075429_100155259 3300006880 Bacteria 2004
63 Ga0075429_100202229 3300006880 Bacteria 1740
64 Ga0097620_100071988 3300006931 Bacteria 3492
65 Ga0097620_100132348 3300006931 Bacteria 2566
66 Ga0097620_100138432 3300006931 Bacteria 2508
67 Ga0097620_100321916 3300006931 Bacteria 1640
68 Ga0105240_10001961 3300009093 Bacteria 34012
69 Ga0111539_10004665 3300009094 Bacteria 17916
70 Ga0111539_10017660 3300009094 Bacteria 8831
71 Ga0111539_10026272 3300009094 Bacteria 7121
72 Ga0111539_10074869 3300009094 Bacteria 3989
73 Ga0111539_10081303 3300009094 Bacteria 3811
74 Ga0114129_10089555 3300009147 Bacteria 4266
75 Ga0114129_10170019 3300009147 Bacteria 2972
76 Ga0105242_10044042 3300009176 Unclassified 3612
77 Ga0105237_10005872 3300009545 Bacteria 13767
78 Ga0105237_10017333 3300009545 Bacteria 7468
79 Ga0105237_10022345 3300009545 Bacteria 6492
80 Ga0105237_10028317 3300009545 Bacteria 5708
81 Ga0105238_10000059 3300009551 Bacteria 130110
82 Ga0105238_10000667 3300009551 Bacteria 36055
83 Ga0105249_10026081 3300009553 Bacteria 5264
84 Ga0105239_10008991 3300010375 Bacteria 11307
85 Ga0105239_10238727 3300010375 Bacteria 2040
86 Ga0157370_10123777 3300013104 Bacteria 2414
87 Ga0157369_10175101 3300013105 Unclassified 2259
88 Ga0157372_10005446 3300013307 Bacteria 13526
89 Ga0157372_10216715 3300013307 Unclassified 2219
90 Ga0157375_10000111 3300013308 Bacteria 79589
91 Ga0163163_10000133 3300014325 Bacteria 76552
92 Ga0163163_10013269 3300014325 Bacteria 7537
93 Ga0163163_10031103 3300014325 Bacteria 5150
94 Ga0163163_10115020 3300014325 Bacteria 2722
95 Ga0157379_10016060 3300014968 Bacteria 6583
96 Ga0157376_10201614 3300014969 Bacteria 1831
97 Ga0157376_10312386 3300014969 Bacteria 1491
98 Ga0209050_1000964 3300025298 Bacteria 37092
99 Ga0209050_1001986 3300025298 Bacteria 19173
100 Ga0207705_10000408 3300025909 Bacteria 37751
101 Ga0207705_10001028 3300025909 Bacteria 22682
102 Ga0207705_10003757 3300025909 Bacteria 11565
103 Ga0207707_10044230 3300025912 Bacteria 3882
104 Ga0207695_10002359 3300025913 Bacteria 28068
105 Ga0207695_10093031 3300025913 Bacteria 3024
106 Ga0207671_10014379 3300025914 Bacteria 6259
107 Ga0207671_10032609 3300025914 Bacteria 3875
108 Ga0207657_10101265 3300025919 Bacteria 2391
109 Ga0207694_10000483 3300025924 Bacteria 36260
110 Ga0207694_10009336 3300025924 Bacteria 7399
111 Ga0207650_10012395 3300025925 Bacteria 5886
112 Ga0207687_10130124 3300025927 Bacteria 1895
113 Ga0207670_10002138 3300025936 Bacteria 10336
114 Ga0207670_10011351 3300025936 Bacteria 5167
115 Ga0207670_10024216 3300025936 Bacteria 3792
116 Ga0207670_10024352 3300025936 Bacteria 3782
117 Ga0207711_10177524 3300025941 Bacteria 1935
118 Ga0207667_10035503 3300025949 Bacteria 5348
119 Ga0207667_10065045 3300025949 Bacteria 3805
120 Ga0207667_10070923 3300025949 Bacteria 3625
121 Ga0207667_10129233 3300025949 Bacteria 2602
122 Ga0207703_10075464 3300026035 Bacteria 2794
123 Ga0207639_10000001 3300026041 Bacteria 1431562
124 Ga0207641_10016636 3300026088 Bacteria 6022
125 Ga0207641_10273218 3300026088 Bacteria 1586
126 Ga0207674_10003625 3300026116 Bacteria 18829
127 Ga0207674_10133224 3300026116 Bacteria 2448
128 Ga0207428_10004952 3300027907 Bacteria 12540
129 Ga0207428_10118295 3300027907 Bacteria 2033
130 Ga0268266_10002927 3300028379 Bacteria 17658
131 Ga0268264_10264594 3300028381 Bacteria 1604
132 Ga0265338_10002860 3300028800 Bacteria 25206
133 Ga0265338_10010421 3300028800 Bacteria 10905
134 Ga0265338_10107551 3300028800 Bacteria 2255
135 Ga0265760_10008992 3300031090 Bacteria 2853
136 Ga0265328_10019595 3300031239 Unclassified 2596
137 Ga0265325_10001582 3300031241 Bacteria 15864
138 Ga0265329_10010842 3300031242 Bacteria 3333
139 Ga0265339_10001491 3300031249 Bacteria 17295
140 Ga0265331_10000014 3300031250 Bacteria 294002
141 Ga0265327_10003880 3300031251 Bacteria 13772
142 Ga0265327_10006140 3300031251 Bacteria 9719
143 Ga0265313_10000332 3300031595 Bacteria 51521
144 Ga0265314_10000105 3300031711 Bacteria 126697
145 Ga0265314_10000547 3300031711 Bacteria 48148
146 Ga0265314_10014514 3300031711 Bacteria 6296
147 Ga0265314_10017896 3300031711 Bacteria 5548
148 Ga0265342_10010110 3300031712 Bacteria 6577
149 Ga0307414_10040562 3300032004 Unclassified 3146
150 Ga0373937_0033737 3300036401 Bacteria 4652
151 Ga0373937_0076480 3300036401 Unclassified 3092
152 Ga0373937_0163698 3300036401 Bacteria 2086
153 Ga0395900_0258557 3300037418 Bacteria 1740
154 Ga0395905_0014729 3300037471 Bacteria 7456
155 Ga0395905_0114992 3300037471 Bacteria 2528
156 Ga0436364_0907236 3300037853 Bacteria 1442
157 Ga0451577_0002743 3300042876 Bacteria 20409
158 Ga0451576_0140342 3300045051 Bacteria 2520
159 Ga0451576_0197044 3300045051 Bacteria 2104
160 Ga0495651_0080137 3300046462 Bacteria 2467
161 Ga0495653_0109941 3300046463 Bacteria 1983
162 Ga0495580_0001953 3300046472 Bacteria 18098
163 Ga0495580_0008003 3300046472 Bacteria 8448
164 Ga0495580_0051052 3300046472 Bacteria 2924
165 Ga0495639_0004894 3300046475 Bacteria 5747
166 Ga0495664_0020449 3300046477 Bacteria 3818
167 Ga0495664_0070111 3300046477 Bacteria 2093
168 Ga0495608_0001138 3300046511 Bacteria 18833
169 Ga0495628_0070994 3300046516 Bacteria 2715
170 Ga0495630_0002449 3300046517 Bacteria 12840
171 Ga0495643_0000125 3300046522 Bacteria 124041
172 Ga0495643_0000658 3300046522 Bacteria 40804
173 Ga0495666_0064767 3300046526 Bacteria 1744
174 Ga0495652_0066215 3300046529 Bacteria 3033
175 Ga0495665_0011431 3300046531 Bacteria 4804
176 Ga0495640_0109772 3300046533 Bacteria 1803
177 Ga0495667_0013752 3300046559 Bacteria 5467
178 Ga0495667_0055875 3300046559 Bacteria 2596
179 Ga0495635_0064038 3300046663 Bacteria 2525
180 Ga0495599_0075679 3300046678 Bacteria 2102
181 Ga0495623_0014135 3300046679 Bacteria 5170
182 Ga0495658_0007748 3300046683 Bacteria 5322
183 Ga0495658_0036197 3300046683 Bacteria 2721
184 Ga0495624_0024816 3300046690 Bacteria 3943
185 Ga0495600_0003561 3300046809 Bacteria 9163
186 Ga0495581_0002729 3300047315 Bacteria 10057
187 Ga0495604_0003985 3300047317 Bacteria 11744
188 Ga0495604_0012753 3300047317 Bacteria 6690
189 Ga0495674_0001438 3300047319 Bacteria 23327
190 Ga0495674_0004156 3300047319 Bacteria 13975
191 Ga0495674_0005234 3300047319 Bacteria 12454
192 Ga0495680_0079013 3300047322 Bacteria 2489
193 Ga0495675_0000952 3300047444 Bacteria 17600
194 Ga0495684_0000486 3300047471 Bacteria 32499
195 Ga0495684_0001283 3300047471 Bacteria 20177
196 Ga0495684_0006311 3300047471 Bacteria 9215
197 Ga0495684_0010596 3300047471 Bacteria 7126
198 Ga0495602_0001815 3300048088 Bacteria 21324
199 Ga0496104_0145160 3300048907 Bacteria 2279
200 Ga0496113_0090015 3300048916 Bacteria 2363
201 Ga0501031_0002499 3300049568 Bacteria 11713
202 Ga0501032_0000976 3300049569 Bacteria 23145
203 Ga0501033_0001872 3300049570 Bacteria 18302
204 Ga0501034_0002219 3300049571 Bacteria 23991
205 Ga0501034_0012142 3300049571 Bacteria 8904
206 Ga0501034_0014834 3300049571 Bacteria 8017
207 Ga0501034_0026264 3300049571 Bacteria 5931
208 Ga0501034_0041338 3300049571 Bacteria 4664
209 Ga0501034_0084257 3300049571 Bacteria 3181
210 Ga0501037_0027508 3300049573 Bacteria 4201
211 Ga0501038_0002417 3300049574 Bacteria 17397
212 Ga0501039_0005332 3300049575 Bacteria 9725
213 Ga0501043_0000669 3300049579 Bacteria 30237
214 Ga0501046_0007116 3300049580 Bacteria 9843
215 Ga0501046_0056659 3300049580 Bacteria 3075
216 Ga0501047_0029227 3300049581 Bacteria 5316
217 Ga0501047_0066743 3300049581 Bacteria 3468
218 Ga0501047_0072259 3300049581 Bacteria 3321
219 Ga0501047_0088392 3300049581 Bacteria 2976
220 Ga0501047_0092566 3300049581 Bacteria 2901
221 Ga0501067_0000291 3300049583 Bacteria 27391
222 Ga0501068_0003322 3300049584 Bacteria 8629
223 Ga0501069_0000904 3300049585 Bacteria 14142
224 Ga0501070_0001097 3300049586 Bacteria 24297
225 Ga0501070_0152432 3300049586 Bacteria 1907
226 Ga0501072_0000619 3300049588 Bacteria 25512
227 Ga0501073_0086240 3300049589 Bacteria 2183
228 Ga0501073_0126694 3300049589 Bacteria 1770
229 Ga0501074_0019495 3300049590 Bacteria 4925
230 Ga0501080_0000018 3300049742 Bacteria 95463
231 Ga0501080_0051178 3300049742 Bacteria 3843
232 Ga0501080_0141542 3300049742 Bacteria 2224
233 Ga0501083_0005887 3300049744 Bacteria 8675
234 Ga0501035_0162477 3300049822 Bacteria 1932
235 Ga0501044_0037399 3300049823 Bacteria 5074
236 Ga0501044_0049000 3300049823 Bacteria 4360
237 Ga0501044_0078059 3300049823 Bacteria 3356
238 Ga0501044_0124077 3300049823 Bacteria 2581
239 Ga0501044_0198210 3300049823 Bacteria 1967
240 nmdc:mga09592_17066_c1 3300050508 Bacteria 5942
241 nmdc:mga09592_44016_c1 3300050508 Bacteria 3756
242 nmdc:mga09592_91569_c1 3300050508 Bacteria 2598
243 nmdc:mga0qj67_88901_c1 3300050509 Bacteria 2480
244 nmdc:mga06r32_152608_c1 3300050510 Bacteria 2289
245 nmdc:mga06r32_23397_c1 3300050510 Bacteria 5714
246 nmdc:mga06r32_339070_c1 3300050510 Bacteria 1488
247 nmdc:mga08y16_213068_c1 3300050511 Bacteria 2000
248 nmdc:mga08y16_247987_c1 3300050511 Unclassified 1840
249 nmdc:mga08y16_33880_c1 3300050511 Bacteria 5365
250 nmdc:mga08y16_70065_c1 3300050511 Bacteria 3655
251 nmdc:mga08y16_84505_c1 3300050511 Bacteria 3308
252 nmdc:mga08y16_897_c1 3300050511 Bacteria 28774
253 nmdc:mga0a205_1947_c1 3300050515 Bacteria 12759
254 Ga0495601_0000811 3300053077 Bacteria 16914
255 Ga0495601_0144956 3300053077 Bacteria 1550
256 Ga0495619_0120914 3300053085 Bacteria 1795
257 Ga0500568_0016806 3300053139 Bacteria 3242
258 Ga0500616_0001466 3300053153 Bacteria 22489
259 Ga0500616_0002097 3300053153 Bacteria 17389
260 Ga0500616_0003278 3300053153 Bacteria 12492
261 Ga0501084_0000401 3300054114 Bacteria 33405
262 Ga0501084_0103365 3300054114 Bacteria 2392
263 Ga0501082_0000845 3300060353 Bacteria 26985
264 Ga0501082_0002852 3300060353 Bacteria 15059
265 2673166814 2671180531 Bacteria 9045424
266 2687234523 2684623219 Bacteria 8442773
267 2688070272 2687453257 Bacteria 6784659
268 2688392589 2687453341 Bacteria 6534136
269 2889419285 2889415604 Bacteria 8048700
270 2920114475 2920107658 Bacteria 10042636
271 Ga0207687_10031228
272 Ga0065704_10083987
273 Ga0065712_10077811
274 Ga0065712_10112404
275 Ga0065707_10133730
276 Ga0070658_10002039
277 Ga0070658_10007248
278 Ga0070683_100127662
279 Ga0070690_100061468
280 Ga0070670_100025279
281 Ga0070689_100010030
282 Ga0070689_100019826
283 Ga0070689_100022970
284 Ga0070689_100034460
285 Ga0070689_100040283
286 Ga0070688_100097580
287 Ga0070701_10015190
288 Ga0070694_100004055
289 Ga0070681_10077648
290 Ga0068853_100000001
291 Ga0068853_100000007
292 Ga0068853_100043914
293 Ga0070686_100004872
294 Ga0070686_100006402
295 Ga0070686_100033159
296 Ga0070665_100003235
297 Ga0070704_100002198
298 Ga0068855_100037010
299 Ga0068855_100039210
300 Ga0068855_100056465
301 Ga0068855_100101577
302 Ga0068855_100110250
303 Ga0068855_100153513
304 Ga0068857_100001967
305 Ga0068859_100132347
306 Ga0068859_100138430
307 Ga0068859_100321953
308 Ga0068864_100158028
309 Ga0068863_100225991
310 Ga0068858_100067505
311 Ga0068858_100098420
312 Ga0068862_100110689
313 Ga0068862_100194591
314 Ga0081455_10039993
315 Ga0097621_100191563
316 Ga0097621_100224183
317 Ga0075428_100001355
318 Ga0075428_100003043
319 Ga0075428_100004859
320 Ga0075428_100009369
321 Ga0075428_100039346
322 Ga0075428_100099019
323 Ga0075428_100174977
324 Ga0075430_100076846
325 Ga0075431_100018874
326 Ga0075431_100169246
327 Ga0075431_100184633
328 Ga0075433_10002140
329 Ga0075429_100051376
330 Ga0075429_100098292
331 Ga0075429_100102383
332 Ga0075429_100155259
333 Ga0075429_100202229
334 Ga0097620_100071988
335 Ga0097620_100132348
336 Ga0097620_100138432
337 Ga0097620_100321916
338 Ga0105240_10001961
339 Ga0111539_10004665
340 Ga0111539_10017660
341 Ga0111539_10026272
342 Ga0111539_10074869
343 Ga0111539_10081303
344 Ga0114129_10089555
345 Ga0114129_10170019
346 Ga0105242_10044042
347 Ga0105237_10005872
348 Ga0105237_10017333
349 Ga0105237_10022345
350 Ga0105237_10028317
351 Ga0105238_10000059
352 Ga0105238_10000667
353 Ga0105249_10026081
354 Ga0105239_10008991
355 Ga0105239_10238727
356 Ga0157370_10123777
357 Ga0157369_10175101
358 Ga0157372_10005446
359 Ga0157372_10216715
360 Ga0157375_10000111
361 Ga0163163_10000133
362 Ga0163163_10013269
363 Ga0163163_10031103
364 Ga0163163_10115020
365 Ga0157379_10016060
366 Ga0157376_10201614
367 Ga0157376_10312386
368 Ga0209050_1000964
369 Ga0209050_1001986
370 Ga0207705_10000408
371 Ga0207705_10001028
372 Ga0207705_10003757
373 Ga0207707_10044230
374 Ga0207695_10002359
375 Ga0207695_10093031
376 Ga0207671_10014379
377 Ga0207671_10032609
378 Ga0207657_10101265
379 Ga0207694_10000483
380 Ga0207694_10009336
381 Ga0207650_10012395
382 Ga0207687_10130124
383 Ga0207670_10002138
384 Ga0207670_10011351
385 Ga0207670_10024216
386 Ga0207670_10024352
387 Ga0207711_10177524
388 Ga0207667_10035503
389 Ga0207667_10065045
390 Ga0207667_10070923
391 Ga0207667_10129233
392 Ga0207703_10075464
393 Ga0207639_10000001
394 Ga0207641_10016636
395 Ga0207641_10273218
396 Ga0207674_10003625
397 Ga0207674_10133224
398 Ga0207428_10004952
399 Ga0207428_10118295
400 Ga0268266_10002927
401 Ga0268264_10264594
402 Ga0265338_10002860
403 Ga0265338_10010421
404 Ga0265338_10107551
405 Ga0265760_10008992
406 Ga0265328_10019595
407 Ga0265325_10001582
408 Ga0265329_10010842
409 Ga0265339_10001491
410 Ga0265331_10000014
411 Ga0265327_10003880
412 Ga0265327_10006140
413 Ga0265313_10000332
414 Ga0265314_10000105
415 Ga0265314_10000547
416 Ga0265314_10014514
417 Ga0265314_10017896
418 Ga0265342_10010110
419 Ga0307414_10040562
420 Ga0373937_0033737
421 Ga0373937_0076480
422 Ga0373937_0163698
423 Ga0395900_0258557
424 Ga0395905_0014729
425 Ga0395905_0114992
426 Ga0436364_0907236
427 Ga0451577_0002743
428 Ga0451576_0140342
429 Ga0451576_0197044
430 Ga0495651_0080137
431 Ga0495653_0109941
432 Ga0495580_0001953
433 Ga0495580_0008003
434 Ga0495580_0051052
435 Ga0495639_0004894
436 Ga0495664_0020449
437 Ga0495664_0070111
438 Ga0495608_0001138
439 Ga0495628_0070994
440 Ga0495630_0002449
441 Ga0495643_0000125
442 Ga0495643_0000658
443 Ga0495666_0064767
444 Ga0495652_0066215
445 Ga0495665_0011431
446 Ga0495640_0109772
447 Ga0495667_0013752
448 Ga0495667_0055875
449 Ga0495635_0064038
450 Ga0495599_0075679
451 Ga0495623_0014135
452 Ga0495658_0007748
453 Ga0495658_0036197
454 Ga0495624_0024816
455 Ga0495600_0003561
456 Ga0495581_0002729
457 Ga0495604_0003985
458 Ga0495604_0012753
459 Ga0495674_0001438
460 Ga0495674_0004156
461 Ga0495674_0005234
462 Ga0495680_0079013
463 Ga0495675_0000952
464 Ga0495684_0000486
465 Ga0495684_0001283
466 Ga0495684_0006311
467 Ga0495684_0010596
468 Ga0495602_0001815
469 Ga0496104_0145160
470 Ga0496113_0090015
471 Ga0501031_0002499
472 Ga0501032_0000976
473 Ga0501033_0001872
474 Ga0501034_0002219
475 Ga0501034_0012142
476 Ga0501034_0014834
477 Ga0501034_0026264
478 Ga0501034_0041338
479 Ga0501034_0084257
480 Ga0501037_0027508
481 Ga0501038_0002417
482 Ga0501039_0005332
483 Ga0501043_0000669
484 Ga0501046_0007116
485 Ga0501046_0056659
486 Ga0501047_0029227
487 Ga0501047_0066743
488 Ga0501047_0072259
489 Ga0501047_0088392
490 Ga0501047_0092566
491 Ga0501067_0000291
492 Ga0501068_0003322
493 Ga0501069_0000904
494 Ga0501070_0001097
495 Ga0501070_0152432
496 Ga0501072_0000619
497 Ga0501073_0086240
498 Ga0501073_0126694
499 Ga0501074_0019495
500 Ga0501080_0000018
501 Ga0501080_0051178
502 Ga0501080_0141542
503 Ga0501083_0005887
504 Ga0501035_0162477
505 Ga0501044_0037399
506 Ga0501044_0049000
507 Ga0501044_0078059
508 Ga0501044_0124077
509 Ga0501044_0198210
510 nmdc:mga09592_17066_c1
511 nmdc:mga09592_44016_c1
512 nmdc:mga09592_91569_c1
513 nmdc:mga0qj67_88901_c1
514 nmdc:mga06r32_152608_c1
515 nmdc:mga06r32_23397_c1
516 nmdc:mga06r32_339070_c1
517 nmdc:mga08y16_213068_c1
518 nmdc:mga08y16_247987_c1
519 nmdc:mga08y16_33880_c1
520 nmdc:mga08y16_70065_c1
521 nmdc:mga08y16_84505_c1
522 nmdc:mga08y16_897_c1
523 nmdc:mga0a205_1947_c1
524 Ga0495601_0000811
525 Ga0495601_0144956
526 Ga0495619_0120914
527 Ga0500568_0016806
528 Ga0500616_0001466
529 Ga0500616_0002097
530 Ga0500616_0003278
531 Ga0501084_0000401
532 Ga0501084_0103365
533 Ga0501082_0000845
534 Ga0501082_0002852
535 2673166814
536 2687234523
537 2688070272
538 2688392589
539 2889419285
540 2920114475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

79

515

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m7m-assembly1.cif.gz_A novel imidazo[1,2-a]pyridine derivatives with potent autotaxin/enpp2 inhibitor activity 0.6715 299 378
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.6542 282 378
6rdz-assembly1.cif.gz_H cryo-em structure of polytomella f-atp synthase, rotary substate 2a, composite map 0.6473 211 258
7p4j-assembly1.cif.gz_A crystal structure of autotaxin and tetrahydrocannabinol 0.6445 299 378
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.6411 282 377
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6401 297 378 3.40.720.10
4gtyB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6374 282 377 3.40.720.10
af_Q9W0F7_144_431_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6365 297 376 3.40.720.10
1shqA00 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6104 297 416 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.609 289 453 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A3B8PRC3-F1-model_v4 DUF1501 domain-containing protein 0.9431 267 367
AF-A0A353DWW6-F1-model_v4 DUF1501 domain-containing protein 0.9383 55 470
AF-A0A3C1UME5-F1-model_v4 DUF1501 domain-containing protein 0.9355 248 470
AF-A0A351FCR5-F1-model_v4 DUF1501 domain-containing protein 0.933 246 470
AF-A0A3L7PK19-F1-model_v4 DUF1501 domain-containing protein 0.9326 50 470

Map