F377768

General Info

Members Datasets Scaffolds Average Seq Length
271 189 249 243

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100100396|Ga0307416_1001003962
Length 282
Sequence MEQNPEVGLGHSWVSCSSDSWLVGPVPDTEQGTKPHTGRRSVTVISRLIRKLERRDVLSGEEKQALKSAVARVKEARMDEDLVREGDRPSESTLLLEGFAARYKLLRNGRRQITALHIPGDFVDLHSFLLKTMDHGVVALTPCRVGLVPHSTLREITETYLHLGRLLWLSTLIDAAIHREWLVAMGRRPAFNQIAHLLCELFLRLQAVGLTQGMSFELPLTQAELGDVLGLSTVHVNRVIQQLRADGLVTWSEQRIAIEDWAQLQEVAEFDPTFLNLDNEPR

Samples

Sample ID Description Type Environment
1 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
2 2643221718 Rhizobium sp. Root268 Isolate Unclassified
3 2643221736 Bosea sp. Root483D1 Isolate Unclassified
4 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
5 2773857925 Microvirga vignae BR3299 Isolate Unclassified
6 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
7 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
8 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
9 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
10 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
11 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
12 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
13 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
14 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
15 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
16 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
17 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
112 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
134 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
135 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
151 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
158 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
161 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
162 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
163 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
164 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
180 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
189 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 0
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.25
Nodule 1.48
Rhizoplane 1.85
Rhizosphere 61.99
Stem 0
Stem Tuber 0.37
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005394 3300001915 Bacteria 2683
2 JGI24740J21852_10002342 3300001979 Bacteria 8624
3 JGI24739J22299_10060304 3300001989 Bacteria 1201
4 JGI25159J45721_1000859 3300002987 Bacteria 13230
5 Ga0065165_1000044 3300005262 Bacteria 203774
6 Ga0065165_1004106 3300005262 Bacteria 9387
7 Ga0070658_10013918 3300005327 Bacteria 6459
8 Ga0070668_100028577 3300005347 Bacteria 4232
9 Ga0070671_100342329 3300005355 Unclassified 1276
10 Ga0070674_100143792 3300005356 Bacteria 1793
11 Ga0070667_100010891 3300005367 Bacteria 7522
12 Ga0070663_100039905 3300005455 Bacteria 3284
13 Ga0068853_100004832 3300005539 Bacteria 10471
14 Ga0070686_100001601 3300005544 Bacteria 12729
15 Ga0070665_100000080 3300005548 Bacteria 185165
16 Ga0070665_100129078 3300005548 Bacteria 2530
17 Ga0070664_100568195 3300005564 Bacteria 1050
18 Ga0068857_100156599 3300005577 Bacteria 2066
19 Ga0068854_100146290 3300005578 Bacteria 1818
20 Ga0068856_100598394 3300005614 Bacteria 1124
21 Ga0068852_100068575 3300005616 Bacteria 3105
22 Ga0068852_100198445 3300005616 Bacteria 1898
23 Ga0068859_100000783 3300005617 Bacteria 32120
24 Ga0068864_100002274 3300005618 Bacteria 15886
25 Ga0068861_100110779 3300005719 Bacteria 2199
26 Ga0068863_100087592 3300005841 Bacteria 2950
27 Ga0068863_100121938 3300005841 Bacteria 2486
28 Ga0068860_100063691 3300005843 Bacteria 3501
29 Ga0068862_100015334 3300005844 Bacteria 6364
30 Ga0068862_100233284 3300005844 Bacteria 1670
31 Ga0075365_10002421 3300006038 Bacteria 9145
32 Ga0075365_10099496 3300006038 Bacteria 1990
33 Ga0075368_10088805 3300006042 Bacteria 1263
34 Ga0075363_100052854 3300006048 Bacteria 2169
35 Ga0075363_100102539 3300006048 Bacteria 1584
36 Ga0075364_10000795 3300006051 Bacteria 16652
37 Ga0075364_10080849 3300006051 Bacteria 2148
38 Ga0075364_10108547 3300006051 Unclassified 1851
39 Ga0075364_10115775 3300006051 Unclassified 1792
40 Ga0075362_10003275 3300006177 Bacteria 5628
41 Ga0075362_10037643 3300006177 Unclassified 2122
42 Ga0075367_10001808 3300006178 Bacteria 9417
43 Ga0075367_10008349 3300006178 Bacteria 5365
44 Ga0075369_10014915 3300006186 Bacteria 3111
45 Ga0075366_10007374 3300006195 Bacteria 6071
46 Ga0075366_10120051 3300006195 Bacteria 1584
47 Ga0075366_10217401 3300006195 Unclassified 1164
48 Ga0075370_10009955 3300006353 Bacteria 4954
49 Ga0075370_10014759 3300006353 Bacteria 4171
50 Ga0075370_10103703 3300006353 Bacteria 1648
51 Ga0097620_100000783 3300006931 Bacteria 32120
52 Ga0105250_10027166 3300009092 Bacteria 2306
53 Ga0105245_10128621 3300009098 Unclassified 2374
54 Ga0105247_10300802 3300009101 Bacteria 1113
55 Ga0105237_10029626 3300009545 Bacteria 5562
56 Ga0105237_10849785 3300009545 Unclassified 919
57 Ga0105238_10020153 3300009551 Bacteria 6787
58 Ga0105238_10058740 3300009551 Bacteria 3855
59 Ga0105238_10066873 3300009551 Bacteria 3595
60 Ga0105239_10006893 3300010375 Bacteria 13107
61 Ga0105239_10066076 3300010375 Bacteria 3973
62 Ga0105239_10613940 3300010375 Unclassified 1241
63 Ga0105246_10307823 3300011119 Bacteria 1282
64 Ga0105246_10472841 3300011119 Bacteria 1058
65 Ga0157371_10008220 3300013102 Bacteria 8340
66 Ga0157370_10003410 3300013104 Bacteria 18668
67 Ga0157370_10070835 3300013104 Bacteria 3291
68 Ga0157370_10085847 3300013104 Bacteria 2957
69 Ga0157369_10006876 3300013105 Bacteria 13126
70 Ga0157369_10020847 3300013105 Bacteria 7327
71 Ga0157374_10076621 3300013296 Bacteria 3162
72 Ga0163162_10028372 3300013306 Bacteria 5538
73 Ga0163163_10300084 3300014325 Bacteria 1659
74 Ga0163163_10428385 3300014325 Bacteria 1382
75 Ga0182008_10022636 3300014497 Bacteria 3218
76 Ga0157379_10004595 3300014968 Bacteria 11843
77 Ga0182007_10025703 3300015262 Bacteria 2048
78 Ga0182005_1027717 3300015265 Bacteria 1544
79 Ga0213876_10010373 3300021384 Bacteria 5002
80 Ga0209130_1000089 3300025284 Bacteria 152711
81 Ga0209025_1020556 3300025294 Bacteria 3604
82 Ga0207696_1060019 3300025711 Bacteria 1071
83 Ga0207682_10139866 3300025893 Bacteria 1086
84 Ga0207688_10275321 3300025901 Bacteria 1024
85 Ga0207647_10013729 3300025904 Bacteria 5610
86 Ga0207705_10020744 3300025909 Bacteria 4690
87 Ga0207695_10020181 3300025913 Bacteria 7640
88 Ga0207671_10022114 3300025914 Bacteria 4813
89 Ga0207681_10081882 3300025923 Bacteria 2280
90 Ga0207694_10002634 3300025924 Bacteria 14548
91 Ga0207694_10040263 3300025924 Bacteria 3597
92 Ga0207694_10620145 3300025924 Bacteria 910
93 Ga0207687_10071415 3300025927 Unclassified 2480
94 Ga0207644_10378371 3300025931 Unclassified 1154
95 Ga0207711_10000244 3300025941 Bacteria 58260
96 Ga0207689_10474964 3300025942 Unclassified 1046
97 Ga0207667_10380372 3300025949 Unclassified 1438
98 Ga0207651_10006153 3300025960 Bacteria 6244
99 Ga0207668_10018304 3300025972 Bacteria 4405
100 Ga0207640_10140615 3300025981 Bacteria 1759
101 Ga0207658_10005035 3300025986 Bacteria 9101
102 Ga0207703_10027804 3300026035 Bacteria 4454
103 Ga0207639_10016159 3300026041 Bacteria 5273
104 Ga0207702_10083554 3300026078 Bacteria 2778
105 Ga0207641_10174899 3300026088 Bacteria 1962
106 Ga0207698_10053096 3300026142 Bacteria 3109
107 Ga0207698_10309880 3300026142 Bacteria 1474
108 Ga0207698_10497398 3300026142 Bacteria 1186
109 Ga0209813_10000158 3300027866 Bacteria 22914
110 Ga0209813_10001696 3300027866 Bacteria 4966
111 Ga0209974_10037178 3300027876 Bacteria 1616
112 Ga0268266_10000055 3300028379 Bacteria 291630
113 Ga0268266_10044223 3300028379 Bacteria 3807
114 Ga0268265_10102357 3300028380 Bacteria 2316
115 Ga0268264_10003356 3300028381 Bacteria 13841
116 Ga0268264_10104972 3300028381 Bacteria 2464
117 Ga0307413_10000319 3300031824 Bacteria 14991
118 Ga0307410_10004584 3300031852 Bacteria 7168
119 Ga0307410_10310277 3300031852 Bacteria 1248
120 Ga0307406_10509215 3300031901 Bacteria 977
121 Ga0307407_10281770 3300031903 Bacteria 1151
122 Ga0307412_10439631 3300031911 Unclassified 1072
123 Ga0307409_100230396 3300031995 Bacteria 1679
124 Ga0307409_100328801 3300031995 Unclassified 1433
125 Ga0307416_100025962 3300032002 Bacteria 4308
126 Ga0307416_100100396 3300032002 Bacteria 2517
127 Ga0307416_100475837 3300032002 Bacteria 1308
128 Ga0307414_10049583 3300032004 Plasmid 2904
129 Ga0307411_10001575 3300032005 Bacteria 9463
130 Ga0307411_10498282 3300032005 Bacteria 1029
131 Ga0307415_100413851 3300032126 Bacteria 1155
132 Ga0237819_00932 3300038705 Bacteria 8990
133 Ga0237819_11380 3300038705 Bacteria 1129
134 Ga0237816_00745 3300039145 Bacteria 2725
135 Ga0436365_1912822 3300039437 Bacteria 6964
136 Ga0451791_1120109 3300041451 Bacteria 1315
137 Ga0439434_0042039 3300042435 Bacteria 1405
138 Ga0495606_0002073 3300046507 Bacteria 24490
139 Ga0495671_0091451 3300046692 Unclassified 1489
140 Ga0495672_0057632 3300047320 Unclassified 2255
141 Ga0495686_0000920 3300047472 Bacteria 36782
142 Ga0495686_0002178 3300047472 Bacteria 19063
143 Ga0495686_0015747 3300047472 Bacteria 5151
144 Ga0495686_0051759 3300047472 Bacteria 2576
145 Ga0496110_0703676 3300048913 Bacteria 912
146 Ga0496111_0271117 3300048914 Bacteria 1259
147 Ga0496113_0353894 3300048916 Bacteria 1178
148 Ga0496114_0419228 3300048917 Bacteria 1186
149 Ga0496117_0174747 3300048920 Bacteria 1242
150 Ga0496118_0006137 3300048921 Bacteria 13341
151 Ga0496119_0109800 3300048922 Bacteria 1533
152 Ga0496121_0014024 3300048924 Bacteria 8555
153 Ga0496121_0015059 3300048924 Bacteria 8140
154 Ga0496122_0003964 3300048925 Bacteria 18914
155 Ga0496122_0064547 3300048925 Bacteria 2663
156 Ga0496123_0002609 3300048926 Bacteria 21896
157 Ga0496123_0085584 3300048926 Bacteria 1896
158 Ga0496124_0000397 3300048927 Bacteria 79293
159 Ga0496124_0453031 3300048927 Bacteria 874
160 Ga0496125_0000294 3300048928 Bacteria 98233
161 Ga0496125_0002886 3300048928 Bacteria 21646
162 Ga0496126_0094744 3300048929 Bacteria 2620
163 Ga0501290_000122 3300049513 Bacteria 11951
164 Ga0501290_003362 3300049513 Bacteria 2023
165 Ga0501292_000002 3300049515 Bacteria 188289
166 Ga0501294_000666 3300049517 Bacteria 3868
167 Ga0501300_000788 3300049523 Bacteria 4801
168 Ga0501300_004738 3300049523 Bacteria 2011
169 Ga0501032_0000524 3300049569 Bacteria 31194
170 Ga0501032_0256141 3300049569 Bacteria 1135
171 Ga0501033_0000732 3300049570 Bacteria 30126
172 Ga0501033_0251590 3300049570 Bacteria 1252
173 Ga0501034_0001550 3300049571 Bacteria 30141
174 Ga0501034_0031724 3300049571 Bacteria 5367
175 Ga0501034_0040875 3300049571 Bacteria 4692
176 Ga0501034_0054146 3300049571 Bacteria 4039
177 Ga0501034_0088967 3300049571 Bacteria 3085
178 Ga0501034_0114447 3300049571 Bacteria 2686
179 Ga0501034_0255531 3300049571 Bacteria 1696
180 Ga0501034_0451988 3300049571 Bacteria 1202
181 Ga0501036_0000414 3300049572 Bacteria 30141
182 Ga0501036_0175293 3300049572 Bacteria 1806
183 Ga0501037_0000509 3300049573 Bacteria 31179
184 Ga0501038_0000684 3300049574 Bacteria 30141
185 Ga0501039_0000437 3300049575 Bacteria 30141
186 Ga0501040_0018509 3300049576 Bacteria 4625
187 Ga0501043_0002307 3300049579 Bacteria 16171
188 Ga0501047_0008784 3300049581 Bacteria 9534
189 Ga0501070_0066682 3300049586 Bacteria 2981
190 Ga0501070_0737179 3300049586 Bacteria 777
191 Ga0501073_0111999 3300049589 Bacteria 1893
192 Ga0501202_001594 3300049652 Bacteria 3669
193 Ga0501206_001646 3300049653 Bacteria 2796
194 Ga0501222_001205 3300049662 Bacteria 3650
195 Ga0501223_000104 3300049663 Bacteria 24070
196 Ga0501223_003262 3300049663 Bacteria 3543
197 Ga0501224_000516 3300049664 Bacteria 4699
198 Ga0501227_010054 3300049665 Bacteria 2046
199 Ga0501227_010190 3300049665 Bacteria 2034
200 Ga0501235_000722 3300049669 Bacteria 6735
201 Ga0501257_000041 3300049686 Bacteria 36608
202 Ga0501257_052535 3300049686 Bacteria 1018
203 Ga0501261_000025 3300049690 Bacteria 36093
204 Ga0501221_002093 3300049704 Bacteria 3320
205 Ga0501225_0003116 3300049705 Bacteria 5065
206 Ga0501245_002082 3300049708 Bacteria 2655
207 Ga0501279_000003 3300049775 Bacteria 188296
208 Ga0501280_000009 3300049776 Bacteria 66042
209 Ga0501280_000355 3300049776 Bacteria 11410
210 Ga0501281_00013 3300049777 Bacteria 24830
211 Ga0501283_001781 3300049779 Bacteria 2794
212 Ga0501035_0000986 3300049822 Bacteria 30120
213 Ga0501044_0001253 3300049823 Bacteria 30141
214 nmdc:mga03683_7120_c1 3300050489 Bacteria 3867
215 nmdc:mga03n38_37071_c1 3300050490 Bacteria 2101
216 nmdc:mga03n38_43522_c1 3300050490 Bacteria 1968
217 nmdc:mga03n38_81672_c1 3300050490 Bacteria 1520
218 nmdc:mga00v17_102125_c1 3300050491 Unclassified 1811
219 nmdc:mga00v17_2176_c1 3300050491 Bacteria 10066
220 nmdc:mga00v17_34482_c1 3300050491 Bacteria 3007
221 nmdc:mga00v17_34483_c1 3300050491 Bacteria 3007
222 nmdc:mga0yw44_136164_c1 3300050492 Bacteria 1593
223 nmdc:mga0yw44_198_c1 3300050492 Bacteria 21245
224 nmdc:mga0k408_408693_c1 3300050493 Bacteria 808
225 nmdc:mga0k408_5007_c1 3300050493 Bacteria 7017
226 nmdc:mga06z11_549_c1 3300050494 Bacteria 13773
227 nmdc:mga06z11_77054_c1 3300050494 Bacteria 1779
228 nmdc:mga06z11_971_c1 3300050494 Bacteria 10453
229 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
230 nmdc:mga04h51_8582_c1 3300050495 Bacteria 2737
231 nmdc:mga07m45_2062_c1 3300050496 Bacteria 6413
232 nmdc:mga07m45_273808_c1 3300050496 Bacteria 982
233 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
234 nmdc:mga0sz30_2016_c1 3300050516 Bacteria 7255
235 nmdc:mga0sz30_25412_c1 3300050516 Bacteria 1389
236 Ga0500643_001667 3300053087 Bacteria 12375
237 Ga0500643_008609 3300053087 Bacteria 3995
238 Ga0500646_0005291 3300053090 Bacteria 3263
239 Ga0500566_0000542 3300053094 Bacteria 21143
240 Ga0500593_000036 3300053117 Bacteria 47889
241 Ga0500607_000006 3300053121 Bacteria 136863
242 Ga0500608_079757 3300053122 Bacteria 1546
243 Ga0500559_0000125 3300053136 Bacteria 59849
244 Ga0500573_0000042 3300053140 Bacteria 103567
245 Ga0500604_0000015 3300053151 Bacteria 92018
246 Ga0500616_0046083 3300053153 Bacteria 2319
247 Ga0500616_0084069 3300053153 Bacteria 1593
248 Ga0500637_0002350 3300053178 Bacteria 8381
249 Ga0500645_004069 3300053730 Bacteria 5730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2928972540 2928973633 197
2 3300049571 Ga0501034_0451988 Ga0501034_0451988_300_1028 225
3 3300048927 Ga0496124_0000397 Ga0496124_0000397_1822_2598 227
4 3300009098 Ga0105245_10128621 Ga0105245_101286212 229
5 3300025927 Ga0207687_10071415 Ga0207687_100714154 229
6 3300010375 Ga0105239_10006893 Ga0105239_100068936 231
7 3300049569 Ga0501032_0000524 Ga0501032_0000524_5083_5781 232
8 3300049570 Ga0501033_0000732 Ga0501033_0000732_24346_25044 232
9 3300049571 Ga0501034_0001550 Ga0501034_0001550_5083_5781 232
10 3300049572 Ga0501036_0000414 Ga0501036_0000414_5083_5781 232
11 3300049573 Ga0501037_0000509 Ga0501037_0000509_25414_26112 232
12 3300049574 Ga0501038_0000684 Ga0501038_0000684_5083_5781 232
13 3300049575 Ga0501039_0000437 Ga0501039_0000437_24361_25059 232
14 3300049576 Ga0501040_0018509 Ga0501040_0018509_2686_3384 232
15 3300049579 Ga0501043_0002307 Ga0501043_0002307_10430_11128 232
16 3300049581 Ga0501047_0008784 Ga0501047_0008784_5059_5757 232
17 3300049586 Ga0501070_0066682 Ga0501070_0066682_1113_1811 232
18 3300049822 Ga0501035_0000986 Ga0501035_0000986_5083_5781 232
19 3300049823 Ga0501044_0001253 Ga0501044_0001253_5083_5781 232
20 iso_pu_bacteria 2643221637 2644209253 235
21 iso_pu_bacteria 2643221718 2644652755 235
22 iso_pu_bacteria 2773857925 2774873227 235
23 iso_pu_bacteria 2773857925 2774873684 235
24 iso_pu_bacteria 2835312727 2835315168 235
25 iso_pu_bacteria 2903448605 2903451863 235
26 iso_pu_bacteria 2928521798 2928526037 235
27 iso_pu_bacteria 2968083720 2968088493 235
28 iso_pu_bacteria 2977240413 2977241032 235
29 iso_pu_bacteria 8002285264 8002286725 235
30 iso_pu_bacteria 2775506901 2776262414 236
31 iso_pu_bacteria 2899259804 2899261096 236
32 3300049513 Ga0501290_003362 Ga0501290_003362_526_1239 237
33 3300049523 Ga0501300_004738 Ga0501300_004738_955_1668 237
34 3300049663 Ga0501223_003262 Ga0501223_003262_1623_2336 237
35 3300049665 Ga0501227_010190 Ga0501227_010190_396_1109 237
36 3300049686 Ga0501257_000041 Ga0501257_000041_720_1433 237
37 3300049776 Ga0501280_000355 Ga0501280_000355_3954_4667 237
38 iso_pu_bacteria 2643221736 2644743680 237
39 iso_pu_bacteria 2713897090 2715500088 237
40 iso_pu_bacteria 2834578030 2834578312 237
41 iso_pu_bacteria 2855020534 2855020656 237
42 iso_pu_bacteria 2899275550 2899276731 237
43 iso_pu_bacteria 8057132660 8057133814 237
44 3300006038 Ga0075365_10099496 Ga0075365_100994962 238
45 3300006048 Ga0075363_100102539 Ga0075363_1001025393 238
46 3300006051 Ga0075364_10108547 Ga0075364_101085472 238
47 3300006051 Ga0075364_10115775 Ga0075364_101157752 238
48 3300006177 Ga0075362_10003275 Ga0075362_100032756 238
49 3300006177 Ga0075362_10037643 Ga0075362_100376434 238
50 3300006195 Ga0075366_10007374 Ga0075366_100073746 238
51 3300006353 Ga0075370_10014759 Ga0075370_100147596 238
52 3300006353 Ga0075370_10103703 Ga0075370_101037031 238
53 3300027876 Ga0209974_10037178 Ga0209974_100371782 238
54 3300031824 Ga0307413_10000319 Ga0307413_100003198 238
55 3300031852 Ga0307410_10004584 Ga0307410_100045844 238
56 3300031903 Ga0307407_10281770 Ga0307407_102817701 238
57 3300031995 Ga0307409_100328801 Ga0307409_1003288012 238
58 3300032002 Ga0307416_100025962 Ga0307416_1000259622 238
59 3300032004 Ga0307414_10049583 Ga0307414_100495834 238
60 3300032005 Ga0307411_10001575 Ga0307411_100015753 238
61 3300032005 Ga0307411_10498282 Ga0307411_104982821 238
62 3300042435 Ga0439434_0042039 Ga0439434_0042039_336_1070 238
63 3300049571 Ga0501034_0040875 Ga0501034_0040875_2294_3028 238
64 3300049571 Ga0501034_0088967 Ga0501034_0088967_584_1315 238
65 3300050489 nmdc:mga03683_7120_c1 nmdc:mga03683_7120_c1_2365_3099 238
66 3300050490 nmdc:mga03n38_81672_c1 nmdc:mga03n38_81672_c1_568_1302 238
67 3300050491 nmdc:mga00v17_102125_c1 nmdc:mga00v17_102125_c1_979_1713 238
68 3300050492 nmdc:mga0yw44_136164_c1 nmdc:mga0yw44_136164_c1_746_1480 238
69 3300050493 nmdc:mga0k408_5007_c1 nmdc:mga0k408_5007_c1_1004_1738 238
70 3300050494 nmdc:mga06z11_77054_c1 nmdc:mga06z11_77054_c1_1028_1762 238
71 3300050496 nmdc:mga07m45_273808_c1 nmdc:mga07m45_273808_c1_188_922 238
72 3300053087 Ga0500643_001667 Ga0500643_001667_8596_9312 238
73 3300001915 JGI24741J21665_1005394 JGI24741J21665_10053942 239
74 3300001979 JGI24740J21852_10002342 JGI24740J21852_100023425 239
75 3300001989 JGI24739J22299_10060304 JGI24739J22299_100603041 239
76 3300002987 JGI25159J45721_1000859 JGI25159J45721_10008598 239
77 3300005262 Ga0065165_1000044 Ga0065165_100004487 239
78 3300005262 Ga0065165_1004106 Ga0065165_100410611 239
79 3300005327 Ga0070658_10013918 Ga0070658_100139184 239
80 3300005347 Ga0070668_100028577 Ga0070668_1000285772 239
81 3300005355 Ga0070671_100342329 Ga0070671_1003423292 239
82 3300005356 Ga0070674_100143792 Ga0070674_1001437922 239
83 3300005367 Ga0070667_100010891 Ga0070667_1000108919 239
84 3300005455 Ga0070663_100039905 Ga0070663_1000399054 239
85 3300005539 Ga0068853_100004832 Ga0068853_1000048327 239
86 3300005544 Ga0070686_100001601 Ga0070686_1000016015 239
87 3300005548 Ga0070665_100000080 Ga0070665_10000008020 239
88 3300005548 Ga0070665_100129078 Ga0070665_1001290784 239
89 3300005564 Ga0070664_100568195 Ga0070664_1005681951 239
90 3300005577 Ga0068857_100156599 Ga0068857_1001565992 239
91 3300005578 Ga0068854_100146290 Ga0068854_1001462902 239
92 3300005614 Ga0068856_100598394 Ga0068856_1005983942 239
93 3300005616 Ga0068852_100068575 Ga0068852_1000685753 239
94 3300005616 Ga0068852_100198445 Ga0068852_1001984454 239
95 3300005617 Ga0068859_100000783 Ga0068859_10000078334 239
96 3300005618 Ga0068864_100002274 Ga0068864_10000227417 239
97 3300005719 Ga0068861_100110779 Ga0068861_1001107793 239
98 3300005841 Ga0068863_100087592 Ga0068863_1000875923 239
99 3300005841 Ga0068863_100121938 Ga0068863_1001219383 239
100 3300005843 Ga0068860_100063691 Ga0068860_1000636915 239
101 3300005844 Ga0068862_100015334 Ga0068862_1000153348 239
102 3300005844 Ga0068862_100233284 Ga0068862_1002332842 239
103 3300006038 Ga0075365_10002421 Ga0075365_100024217 239
104 3300006042 Ga0075368_10088805 Ga0075368_100888052 239
105 3300006048 Ga0075363_100052854 Ga0075363_1000528543 239
106 3300006051 Ga0075364_10000795 Ga0075364_1000079514 239
107 3300006051 Ga0075364_10080849 Ga0075364_100808491 239
108 3300006178 Ga0075367_10001808 Ga0075367_100018086 239
109 3300006178 Ga0075367_10008349 Ga0075367_100083494 239
110 3300006186 Ga0075369_10014915 Ga0075369_100149155 239
111 3300006195 Ga0075366_10120051 Ga0075366_101200513 239
112 3300006195 Ga0075366_10217401 Ga0075366_102174011 239
113 3300006353 Ga0075370_10009955 Ga0075370_100099556 239
114 3300006931 Ga0097620_100000783 Ga0097620_1000007835 239
115 3300009092 Ga0105250_10027166 Ga0105250_100271663 239
116 3300009101 Ga0105247_10300802 Ga0105247_103008021 239
117 3300009545 Ga0105237_10029626 Ga0105237_100296265 239
118 3300009545 Ga0105237_10849785 Ga0105237_108497851 239
119 3300009551 Ga0105238_10020153 Ga0105238_100201536 239
120 3300009551 Ga0105238_10058740 Ga0105238_100587402 239
121 3300009551 Ga0105238_10066873 Ga0105238_100668733 239
122 3300010375 Ga0105239_10066076 Ga0105239_100660763 239
123 3300010375 Ga0105239_10613940 Ga0105239_106139402 239
124 3300011119 Ga0105246_10307823 Ga0105246_103078232 239
125 3300011119 Ga0105246_10472841 Ga0105246_104728412 239
126 3300013102 Ga0157371_10008220 Ga0157371_100082207 239
127 3300013104 Ga0157370_10003410 Ga0157370_1000341014 239
128 3300013104 Ga0157370_10070835 Ga0157370_100708353 239
129 3300013104 Ga0157370_10085847 Ga0157370_100858472 239
130 3300013105 Ga0157369_10006876 Ga0157369_100068764 239
131 3300013105 Ga0157369_10020847 Ga0157369_100208475 239
132 3300013296 Ga0157374_10076621 Ga0157374_100766213 239
133 3300013306 Ga0163162_10028372 Ga0163162_100283726 239
134 3300014325 Ga0163163_10300084 Ga0163163_103000842 239
135 3300014325 Ga0163163_10428385 Ga0163163_104283852 239
136 3300014497 Ga0182008_10022636 Ga0182008_100226362 239
137 3300014968 Ga0157379_10004595 Ga0157379_100045959 239
138 3300015262 Ga0182007_10025703 Ga0182007_100257031 239
139 3300015265 Ga0182005_1027717 Ga0182005_10277173 239
140 3300021384 Ga0213876_10010373 Ga0213876_100103737 239
141 3300025284 Ga0209130_1000089 Ga0209130_100008937 239
142 3300025294 Ga0209025_1020556 Ga0209025_10205562 239
143 3300025711 Ga0207696_1060019 Ga0207696_10600192 239
144 3300025893 Ga0207682_10139866 Ga0207682_101398662 239
145 3300025901 Ga0207688_10275321 Ga0207688_102753211 239
146 3300025904 Ga0207647_10013729 Ga0207647_100137294 239
147 3300025909 Ga0207705_10020744 Ga0207705_100207442 239
148 3300025913 Ga0207695_10020181 Ga0207695_100201815 239
149 3300025914 Ga0207671_10022114 Ga0207671_100221143 239
150 3300025923 Ga0207681_10081882 Ga0207681_100818822 239
151 3300025924 Ga0207694_10002634 Ga0207694_1000263411 239
152 3300025924 Ga0207694_10040263 Ga0207694_100402633 239
153 3300025924 Ga0207694_10620145 Ga0207694_106201451 239
154 3300025931 Ga0207644_10378371 Ga0207644_103783711 239
155 3300025941 Ga0207711_10000244 Ga0207711_100002441 239
156 3300025942 Ga0207689_10474964 Ga0207689_104749642 239
157 3300025949 Ga0207667_10380372 Ga0207667_103803722 239
158 3300025960 Ga0207651_10006153 Ga0207651_100061533 239
159 3300025972 Ga0207668_10018304 Ga0207668_100183042 239
160 3300025981 Ga0207640_10140615 Ga0207640_101406151 239
161 3300025986 Ga0207658_10005035 Ga0207658_100050358 239
162 3300026035 Ga0207703_10027804 Ga0207703_100278046 239
163 3300026041 Ga0207639_10016159 Ga0207639_100161592 239
164 3300026078 Ga0207702_10083554 Ga0207702_100835543 239
165 3300026088 Ga0207641_10174899 Ga0207641_101748994 239
166 3300026142 Ga0207698_10053096 Ga0207698_100530961 239
167 3300026142 Ga0207698_10309880 Ga0207698_103098802 239
168 3300026142 Ga0207698_10497398 Ga0207698_104973982 239
169 3300027866 Ga0209813_10000158 Ga0209813_1000015819 239
170 3300027866 Ga0209813_10001696 Ga0209813_100016962 239
171 3300028379 Ga0268266_10000055 Ga0268266_10000055147 239
172 3300028379 Ga0268266_10044223 Ga0268266_100442234 239
173 3300028380 Ga0268265_10102357 Ga0268265_101023572 239
174 3300028381 Ga0268264_10003356 Ga0268264_100033568 239
175 3300028381 Ga0268264_10104972 Ga0268264_101049722 239
176 3300031852 Ga0307410_10310277 Ga0307410_103102772 239
177 3300031901 Ga0307406_10509215 Ga0307406_105092151 239
178 3300031911 Ga0307412_10439631 Ga0307412_104396311 239
179 3300031995 Ga0307409_100230396 Ga0307409_1002303963 239
180 3300032002 Ga0307416_100100396 Ga0307416_1001003962 239
181 3300032002 Ga0307416_100475837 Ga0307416_1004758371 239
182 3300032126 Ga0307415_100413851 Ga0307415_1004138511 239
183 3300038705 Ga0237819_00932 Ga0237819_00932_1944_2696 239
184 3300038705 Ga0237819_11380 Ga0237819_11380_57_782 239
185 3300039145 Ga0237816_00745 Ga0237816_00745_368_1120 239
186 3300039437 Ga0436365_1912822 Ga0436365_1912822_5308_6027 239
187 3300041451 Ga0451791_1120109 Ga0451791_1120109_543_1289 239
188 3300046507 Ga0495606_0002073 Ga0495606_0002073_10985_11704 239
189 3300046692 Ga0495671_0091451 Ga0495671_0091451_306_1025 239
190 3300047320 Ga0495672_0057632 Ga0495672_0057632_1016_1735 239
191 3300047472 Ga0495686_0000920 Ga0495686_0000920_20209_20928 239
192 3300047472 Ga0495686_0002178 Ga0495686_0002178_7145_7894 239
193 3300047472 Ga0495686_0015747 Ga0495686_0015747_1136_1855 239
194 3300047472 Ga0495686_0051759 Ga0495686_0051759_413_1150 239
195 3300048913 Ga0496110_0703676 Ga0496110_0703676_119_841 239
196 3300048914 Ga0496111_0271117 Ga0496111_0271117_173_916 239
197 3300048916 Ga0496113_0353894 Ga0496113_0353894_436_1155 239
198 3300048917 Ga0496114_0419228 Ga0496114_0419228_149_928 239
199 3300048920 Ga0496117_0174747 Ga0496117_0174747_446_1165 239
200 3300048921 Ga0496118_0006137 Ga0496118_0006137_9066_9785 239
201 3300048922 Ga0496119_0109800 Ga0496119_0109800_653_1372 239
202 3300048924 Ga0496121_0014024 Ga0496121_0014024_6578_7297 239
203 3300048924 Ga0496121_0015059 Ga0496121_0015059_5339_6058 239
204 3300048925 Ga0496122_0003964 Ga0496122_0003964_4804_5547 239
205 3300048925 Ga0496122_0064547 Ga0496122_0064547_1773_2528 239
206 3300048926 Ga0496123_0002609 Ga0496123_0002609_7338_8081 239
207 3300048926 Ga0496123_0085584 Ga0496123_0085584_1105_1824 239
208 3300048927 Ga0496124_0453031 Ga0496124_0453031_45_764 239
209 3300048928 Ga0496125_0000294 Ga0496125_0000294_94908_95627 239
210 3300048928 Ga0496125_0002886 Ga0496125_0002886_13783_14553 239
211 3300048929 Ga0496126_0094744 Ga0496126_0094744_1606_2325 239
212 3300049513 Ga0501290_000122 Ga0501290_000122_8167_8901 239
213 3300049515 Ga0501292_000002 Ga0501292_000002_163522_164256 239
214 3300049517 Ga0501294_000666 Ga0501294_000666_350_1084 239
215 3300049523 Ga0501300_000788 Ga0501300_000788_3061_3795 239
216 3300049569 Ga0501032_0256141 Ga0501032_0256141_364_1083 239
217 3300049570 Ga0501033_0251590 Ga0501033_0251590_426_1163 239
218 3300049571 Ga0501034_0031724 Ga0501034_0031724_3288_4007 239
219 3300049571 Ga0501034_0054146 Ga0501034_0054146_331_1071 239
220 3300049571 Ga0501034_0114447 Ga0501034_0114447_1560_2282 239
221 3300049571 Ga0501034_0255531 Ga0501034_0255531_785_1525 239
222 3300049572 Ga0501036_0175293 Ga0501036_0175293_954_1787 239
223 3300049586 Ga0501070_0737179 Ga0501070_0737179_31_750 239
224 3300049589 Ga0501073_0111999 Ga0501073_0111999_778_1512 239
225 3300049652 Ga0501202_001594 Ga0501202_001594_344_1078 239
226 3300049653 Ga0501206_001646 Ga0501206_001646_1508_2242 239
227 3300049662 Ga0501222_001205 Ga0501222_001205_227_961 239
228 3300049663 Ga0501223_000104 Ga0501223_000104_9903_10637 239
229 3300049664 Ga0501224_000516 Ga0501224_000516_2993_3727 239
230 3300049665 Ga0501227_010054 Ga0501227_010054_786_1520 239
231 3300049669 Ga0501235_000722 Ga0501235_000722_1016_1750 239
232 3300049686 Ga0501257_052535 Ga0501257_052535_243_977 239
233 3300049690 Ga0501261_000025 Ga0501261_000025_18498_19232 239
234 3300049704 Ga0501221_002093 Ga0501221_002093_995_1729 239
235 3300049705 Ga0501225_0003116 Ga0501225_0003116_2465_3199 239
236 3300049708 Ga0501245_002082 Ga0501245_002082_1926_2645 239
237 3300049775 Ga0501279_000003 Ga0501279_000003_24041_24775 239
238 3300049776 Ga0501280_000009 Ga0501280_000009_9798_10532 239
239 3300049777 Ga0501281_00013 Ga0501281_00013_16387_17121 239
240 3300049779 Ga0501283_001781 Ga0501283_001781_318_1052 239
241 3300050490 nmdc:mga03n38_37071_c1 nmdc:mga03n38_37071_c1_801_1520 239
242 3300050490 nmdc:mga03n38_43522_c1 nmdc:mga03n38_43522_c1_658_1377 239
243 3300050491 nmdc:mga00v17_2176_c1 nmdc:mga00v17_2176_c1_5986_6705 239
244 3300050491 nmdc:mga00v17_34482_c1 nmdc:mga00v17_34482_c1_175_894 239
245 3300050491 nmdc:mga00v17_34483_c1 nmdc:mga00v17_34483_c1_175_894 239
246 3300050492 nmdc:mga0yw44_198_c1 nmdc:mga0yw44_198_c1_15842_16561 239
247 3300050493 nmdc:mga0k408_408693_c1 nmdc:mga0k408_408693_c1_15_734 239
248 3300050494 nmdc:mga06z11_549_c1 nmdc:mga06z11_549_c1_8941_9660 239
249 3300050494 nmdc:mga06z11_971_c1 nmdc:mga06z11_971_c1_1595_2314 239
250 3300050495 nmdc:mga04h51_73_c1 nmdc:mga04h51_73_c1_1601_2320 239
251 3300050495 nmdc:mga04h51_8582_c1 nmdc:mga04h51_8582_c1_241_960 239
252 3300050496 nmdc:mga07m45_2062_c1 nmdc:mga07m45_2062_c1_4532_5251 239
253 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_257193_257912 239
254 3300050516 nmdc:mga0sz30_2016_c1 nmdc:mga0sz30_2016_c1_862_1581 239
255 3300050516 nmdc:mga0sz30_25412_c1 nmdc:mga0sz30_25412_c1_507_1226 239
256 3300053087 Ga0500643_008609 Ga0500643_008609_2365_3084 239
257 3300053090 Ga0500646_0005291 Ga0500646_0005291_820_1539 239
258 3300053094 Ga0500566_0000542 Ga0500566_0000542_6621_7340 239
259 3300053117 Ga0500593_000036 Ga0500593_000036_28176_28898 239
260 3300053121 Ga0500607_000006 Ga0500607_000006_62988_63707 239
261 3300053122 Ga0500608_079757 Ga0500608_079757_706_1428 239
262 3300053136 Ga0500559_0000125 Ga0500559_0000125_46454_47173 239
263 3300053140 Ga0500573_0000042 Ga0500573_0000042_47089_47829 239
264 3300053151 Ga0500604_0000015 Ga0500604_0000015_31141_31860 239
265 3300053153 Ga0500616_0046083 Ga0500616_0046083_1124_1849 239
266 3300053153 Ga0500616_0084069 Ga0500616_0084069_181_900 239
267 3300053178 Ga0500637_0002350 Ga0500637_0002350_2844_3563 239
268 3300053730 Ga0500645_004069 Ga0500645_004069_4490_5209 239
269 iso_pu_bacteria 2842922631 2842923098 239
270 iso_pu_bacteria 2928972540 2928974483 239
271 iso_pu_bacteria 2977240413 2977243402 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

218

249

0.97

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

73

160

0.95

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

192

267

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9265 29 227
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9195 29 224
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.9108 8 227
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9099 8 226
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8884 29 227
ID Description Score Start End Superfamily
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.927 29 144 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9025 29 144 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8905 29 144 2.60.120.10
5e44A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8873 9 144 2.60.120.10
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8805 146 226 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A653J5C4-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9828 2 239 GO:0003677
GO:0006355
AF-A0A2W5QYJ5-F1-model_v4 deleted 0.9813 1 239
AF-A0A1Y6ET54-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9774 2 233 GO:0003677
GO:0006355
GO:0016301
AF-A0A4Q5QDY6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9759 29 232 GO:0003677
GO:0006355
AF-A0A1M3KQD0-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9757 2 239 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
95.82 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map