F377937

General Info

Members Datasets Scaffolds Average Seq Length
271 152 253 260

Family's Representative Sequence

Representative Sequence 3300049459|Ga0495678_006203|Ga0495678_006203_2182_3045
Length 287
Sequence MPKQVRHDKIIFLTFKQINSPFRGLGGMTILDKIVAYKKKEVASAKKRTSYVELEESEYFHRETYSFKEFLLDPTRTGIIAEFKRKSPSKGIINDKVRVSAVTNGYANAGASALSVLTDRNFFMGRKADLVKARSVNTIPILRKDFMIDEYQVIEAKSLGADIILLIAAILTPAQIDTMATLAKSIGLNVLLEVHNLEELERSIHPKLDAIGVNNRNLADFTVSVETSYELAKHIPAEFMKISESAISDPETIRHLKLAGFNGFLIGETFMKQPDPGEAMRDFVAQL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367651 Pedobacter sp. OK291 Isolate Unclassified
3 2739367663 Pedobacter sp. YR510 Isolate Unclassified
4 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
5 2818991437 Pedobacter terrae 518 Isolate Unclassified
6 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
7 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
8 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
9 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
10 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
11 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
12 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
13 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
14 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
15 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
16 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
17 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.36
Metatranscriptomes 0
Isolates 6.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0
Rhizoplane 0.37
Rhizosphere 79.7
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001996 3300001904 Bacteria 3626
2 JGI24741J21665_1010754 3300001915 Bacteria 1623
3 JGI24735J21928_10000007 3300002067 Bacteria 333510
4 JGI24735J21928_10047780 3300002067 Bacteria 1240
5 JGI25162J39368_1000055 3300002737 Bacteria 147236
6 JGI25162J39368_1001849 3300002737 Bacteria 9811
7 JGI25165J46597_1000305 3300003214 Bacteria 61229
8 rootH1_10016176 3300003316 Bacteria 26999
9 rootH1_10016176 3300003323 Bacteria 2806
10 rootH2_10055701 3300003320 Bacteria 1010
11 rootH2_10236101 3300003320 Bacteria 1723
12 rootL2_10093441 3300003322 Bacteria 1644
13 rootH1_10005288 3300003323 Bacteria 25229
14 rootH1_10015911 3300003323 Bacteria 2460
15 rootH1_10107111 3300003323 Bacteria 2102
16 rootH1_10108314 3300003323 Bacteria 3091
17 Ga0055538_1000354 3300003751 Bacteria 19744
18 Ga0055536_1000006 3300003781 Bacteria 347733
19 Ga0055536_1012573 3300003781 Bacteria 3128
20 Ga0055530_10004623 3300003791 Bacteria 7006
21 Ga0070658_10141098 3300005327 Bacteria 2013
22 Ga0070660_100025877 3300005339 Bacteria 4364
23 Ga0070660_100026304 3300005339 Bacteria 4331
24 Ga0070660_100082220 3300005339 Bacteria 2529
25 Ga0070674_100045589 3300005356 Bacteria 2996
26 Ga0070674_100230791 3300005356 Bacteria 1444
27 Ga0070659_100003407 3300005366 Bacteria 11330
28 Ga0070659_100034316 3300005366 Bacteria 3946
29 Ga0070663_100000447 3300005455 Bacteria 21810
30 Ga0070662_100000468 3300005457 Bacteria 24024
31 Ga0070684_100050348 3300005535 Bacteria 3618
32 Ga0068853_100021233 3300005539 Bacteria 5409
33 Ga0070665_100000118 3300005548 Bacteria 149830
34 Ga0068855_100001431 3300005563 Bacteria 29691
35 Ga0068855_100004525 3300005563 Bacteria 16986
36 Ga0068855_100019618 3300005563 Bacteria 8121
37 Ga0068855_100032516 3300005563 Bacteria 6227
38 Ga0068855_100082149 3300005563 Bacteria 3735
39 Ga0068855_100913108 3300005563 Bacteria 927
40 Ga0068857_100201810 3300005577 Bacteria 1813
41 Ga0068854_100043274 3300005578 Bacteria 3191
42 Ga0068856_100000108 3300005614 Bacteria 81559
43 Ga0068856_100015811 3300005614 Bacteria 7299
44 Ga0068856_100051537 3300005614 Bacteria 4058
45 Ga0068856_100060532 3300005614 Bacteria 3741
46 Ga0068856_100477679 3300005614 Bacteria 1267
47 Ga0068852_100064985 3300005616 Bacteria 3182
48 Ga0068858_100107579 3300005842 Bacteria 2603
49 Ga0075366_10065981 3300006195 Bacteria 2153
50 Ga0075366_10071465 3300006195 Bacteria 2068
51 Ga0105244_10017654 3300009036 Bacteria 4027
52 Ga0105240_10036011 3300009093 Bacteria 6373
53 Ga0105240_10045368 3300009093 Bacteria 5576
54 Ga0105240_10091089 3300009093 Bacteria 3726
55 Ga0105240_10759393 3300009093 Bacteria 1054
56 Ga0105241_10007909 3300009174 Bacteria 7817
57 Ga0105241_10127353 3300009174 Bacteria 2058
58 Ga0105241_10246004 3300009174 Bacteria 1514
59 Ga0105237_10004869 3300009545 Bacteria 15388
60 Ga0105237_10023728 3300009545 Bacteria 6280
61 Ga0105237_10024437 3300009545 Bacteria 6181
62 Ga0105237_10035341 3300009545 Bacteria 5057
63 Ga0105237_10063449 3300009545 Bacteria 3692
64 Ga0105237_10073531 3300009545 Bacteria 3410
65 Ga0105237_10107173 3300009545 Bacteria 2786
66 Ga0105237_10151999 3300009545 Bacteria 2311
67 Ga0105237_10984596 3300009545 Bacteria 850
68 Ga0105238_10021356 3300009551 Bacteria 6596
69 Ga0105238_10208643 3300009551 Bacteria 1929
70 Ga0105239_10000008 3300010375 Bacteria 376925
71 Ga0105239_10000095 3300010375 Bacteria 124330
72 Ga0105239_10000327 3300010375 Bacteria 70423
73 Ga0105239_10000428 3300010375 Bacteria 61391
74 Ga0105239_10004144 3300010375 Bacteria 17403
75 Ga0105239_10006307 3300010375 Bacteria 13793
76 Ga0105239_10108288 3300010375 Bacteria 3079
77 Ga0157373_10000152 3300013100 Bacteria 55831
78 Ga0157373_10053561 3300013100 Bacteria 2869
79 Ga0157373_10223726 3300013100 Bacteria 1328
80 Ga0157373_10251808 3300013100 Bacteria 1249
81 Ga0157371_10000117 3300013102 Bacteria 121069
82 Ga0157371_10008927 3300013102 Bacteria 7936
83 Ga0157371_10029645 3300013102 Bacteria 3954
84 Ga0157371_10225726 3300013102 Bacteria 1345
85 Ga0157370_10001102 3300013104 Bacteria 33889
86 Ga0157370_10022085 3300013104 Bacteria 6337
87 Ga0157370_10036289 3300013104 Bacteria 4785
88 Ga0157370_10072938 3300013104 Bacteria 3239
89 Ga0157370_10157545 3300013104 Bacteria 2113
90 Ga0157369_10000047 3300013105 Bacteria 172682
91 Ga0157369_10000101 3300013105 Bacteria 118683
92 Ga0157369_10021821 3300013105 Bacteria 7160
93 Ga0157369_10064434 3300013105 Bacteria 3947
94 Ga0157369_10158513 3300013105 Bacteria 2389
95 Ga0157374_10000741 3300013296 Bacteria 28443
96 Ga0157378_10052948 3300013297 Bacteria 3612
97 Ga0163162_10000012 3300013306 Bacteria 292674
98 Ga0163162_10000557 3300013306 Bacteria 34493
99 Ga0163162_10016065 3300013306 Bacteria 7316
100 Ga0163162_10064932 3300013306 Bacteria 3696
101 Ga0163162_10375547 3300013306 Bacteria 1555
102 Ga0157372_10000041 3300013307 Bacteria 158494
103 Ga0157372_10004737 3300013307 Bacteria 14447
104 Ga0157372_10044745 3300013307 Bacteria 4906
105 Ga0157375_10022320 3300013308 Bacteria 5824
106 Ga0182008_10000315 3300014497 Bacteria 38030
107 Ga0157377_10091154 3300014745 Bacteria 1800
108 Ga0182006_1000153 3300015261 Bacteria 73985
109 Ga0182006_1000287 3300015261 Bacteria 44409
110 Ga0182007_10000005 3300015262 Bacteria 442702
111 Ga0182007_10020652 3300015262 Bacteria 2351
112 Ga0183373_1002 3300015682 Bacteria 990153
113 Ga0163161_10000306 3300017792 Bacteria 42759
114 Ga0163161_10000360 3300017792 Bacteria 38354
115 Ga0163161_10020833 3300017792 Bacteria 4604
116 Ga0209784_100054 3300025224 Bacteria 178541
117 Ga0207427_100423 3300025231 Bacteria 23892
118 Ga0209437_100026 3300025233 Bacteria 542698
119 Ga0209437_100130 3300025233 Bacteria 183731
120 Ga0209026_1004800 3300025250 Bacteria 3860
121 Ga0209233_1000206 3300025261 Bacteria 117820
122 Ga0209233_1000466 3300025261 Bacteria 25583
123 Ga0209233_1038929 3300025261 Bacteria 1046
124 Ga0209455_1000854 3300025272 Bacteria 16294
125 Ga0209676_1000039 3300025292 Bacteria 443158
126 Ga0209676_1001268 3300025292 Bacteria 26245
127 Ga0209676_1008041 3300025292 Bacteria 4797
128 Ga0209676_1026065 3300025292 Bacteria 1863
129 Ga0209025_1002322 3300025294 Bacteria 20551
130 Ga0209025_1002597 3300025294 Bacteria 18646
131 Ga0209050_1000033 3300025298 Bacteria 442615
132 Ga0207647_10000049 3300025904 Bacteria 88392
133 Ga0207647_10000103 3300025904 Bacteria 65792
134 Ga0207705_10111340 3300025909 Bacteria 2023
135 Ga0207654_10004708 3300025911 Bacteria 6903
136 Ga0207654_10008233 3300025911 Bacteria 5264
137 Ga0207654_10071425 3300025911 Bacteria 2063
138 Ga0207654_10350169 3300025911 Bacteria 1017
139 Ga0207695_10000235 3300025913 Bacteria 146984
140 Ga0207695_10007414 3300025913 Bacteria 13973
141 Ga0207695_10015443 3300025913 Bacteria 8988
142 Ga0207695_10113439 3300025913 Bacteria 2686
143 Ga0207671_10003198 3300025914 Bacteria 16504
144 Ga0207671_10005006 3300025914 Bacteria 12403
145 Ga0207671_10007251 3300025914 Bacteria 9654
146 Ga0207671_10007981 3300025914 Bacteria 9066
147 Ga0207671_10086717 3300025914 Bacteria 2353
148 Ga0207657_10025398 3300025919 Bacteria 5464
149 Ga0207657_10152323 3300025919 Bacteria 1882
150 Ga0207694_10020393 3300025924 Bacteria 5015
151 Ga0207687_10127453 3300025927 Bacteria 1913
152 Ga0207690_10013035 3300025932 Bacteria 4986
153 Ga0207690_10032027 3300025932 Bacteria 3370
154 Ga0207706_10000111 3300025933 Bacteria 87282
155 Ga0207667_10000457 3300025949 Bacteria 54773
156 Ga0207667_10001338 3300025949 Bacteria 30924
157 Ga0207667_10068214 3300025949 Bacteria 3704
158 Ga0207667_10155583 3300025949 Bacteria 2352
159 Ga0207667_10622574 3300025949 Bacteria 1087
160 Ga0207640_10021566 3300025981 Bacteria 3842
161 Ga0207703_10259323 3300026035 Bacteria 1571
162 Ga0207639_10015609 3300026041 Bacteria 5359
163 Ga0207639_10489552 3300026041 Bacteria 1122
164 Ga0207678_10169954 3300026067 Bacteria 1861
165 Ga0207702_10000183 3300026078 Bacteria 75210
166 Ga0207702_10004469 3300026078 Bacteria 12422
167 Ga0207702_10046590 3300026078 Bacteria 3650
168 Ga0207702_10865563 3300026078 Bacteria 895
169 Ga0207674_10175948 3300026116 Bacteria 2092
170 Ga0207698_10384728 3300026142 Bacteria 1336
171 Ga0268266_10000121 3300028379 Bacteria 154995
172 Ga0307515_10000077 3300028794 Bacteria 228162
173 Ga0307515_10007186 3300028794 Bacteria 22080
174 Ga0307515_10064389 3300028794 Bacteria 5126
175 Ga0265338_10054341 3300028800 Bacteria 3573
176 Ga0307509_10060583 3300031507 Bacteria 4000
177 Ga0307405_10000009 3300031731 Bacteria 259388
178 Ga0307407_10000001 3300031903 Bacteria 570048
179 Ga0307412_10097983 3300031911 Unclassified 2067
180 Ga0307409_100055346 3300031995 Bacteria 3062
181 Ga0307416_100000008 3300032002 Bacteria 401343
182 Ga0307414_10010567 3300032004 Bacteria 5366
183 Ga0307507_10002369 3300033179 Bacteria 39902
184 Ga0395899_0000017 3300037312 Bacteria 440179
185 Ga0395899_0000024 3300037312 Bacteria 357402
186 Ga0395900_0004216 3300037418 Bacteria 15260
187 Ga0395900_0148954 3300037418 Bacteria 2392
188 Ga0395898_0180594 3300037466 Bacteria 2017
189 Ga0395905_0000347 3300037471 Bacteria 65943
190 Ga0395901_0002910 3300038443 Bacteria 17294
191 Ga0395901_0147914 3300038443 Bacteria 2469
192 Ga0466966_0021578 3300044684 Bacteria 4229
193 Ga0466961_0008211 3300044693 Bacteria 6652
194 Ga0466958_0047669 3300045836 Bacteria 2587
195 Ga0495592_0204161 3300046454 Bacteria 1332
196 Ga0495638_0095527 3300046460 Bacteria 1785
197 Ga0495651_0062632 3300046462 Bacteria 2846
198 Ga0495650_0000050 3300046471 Bacteria 318894
199 Ga0495650_0030667 3300046471 Bacteria 2431
200 Ga0495585_0000097 3300046492 Bacteria 93394
201 Ga0495585_0000235 3300046492 Bacteria 57308
202 Ga0495583_0044380 3300046506 Bacteria 2063
203 Ga0495606_0000036 3300046507 Bacteria 234596
204 Ga0495606_0008266 3300046507 Bacteria 9082
205 Ga0495606_0013057 3300046507 Bacteria 6598
206 Ga0495606_0014319 3300046507 Bacteria 6203
207 Ga0495606_0024849 3300046507 Bacteria 4305
208 Ga0495606_0126393 3300046507 Bacteria 1524
209 Ga0495610_0003036 3300046512 Bacteria 13440
210 Ga0495610_0005070 3300046512 Bacteria 9491
211 Ga0495616_0001383 3300046513 Bacteria 16895
212 Ga0495616_0002111 3300046513 Bacteria 13329
213 Ga0495637_0020372 3300046520 Bacteria 3053
214 Ga0495644_0006793 3300046523 Bacteria 4432
215 Ga0495648_0013965 3300046524 Bacteria 5908
216 Ga0495648_0059806 3300046524 Bacteria 2271
217 Ga0495663_0020111 3300046525 Bacteria 1915
218 Ga0495642_0079625 3300046528 Bacteria 1378
219 Ga0495609_0021112 3300046538 Bacteria 3004
220 Ga0495609_0060834 3300046538 Bacteria 1669
221 Ga0495609_0086052 3300046538 Bacteria 1370
222 Ga0495633_0000004 3300046558 Bacteria 370781
223 Ga0495668_0000058 3300046616 Bacteria 195501
224 Ga0495625_0000105 3300046660 Bacteria 126078
225 Ga0495625_0000641 3300046660 Bacteria 50345
226 Ga0495625_0001733 3300046660 Bacteria 25233
227 Ga0495625_0036441 3300046660 Bacteria 3615
228 Ga0495625_0100558 3300046660 Bacteria 1987
229 Ga0495661_0069661 3300046665 Bacteria 2060
230 Ga0495661_0167674 3300046665 Bacteria 1174
231 Ga0495671_0018260 3300046692 Bacteria 3724
232 Ga0495649_0000011 3300046694 Bacteria 416695
233 Ga0495660_0001859 3300046810 Bacteria 13854
234 Ga0495683_0079196 3300047323 Bacteria 1605
235 Ga0495687_001623 3300047443 Bacteria 20253
236 Ga0495677_0028388 3300047445 Bacteria 2031
237 Ga0495685_060652 3300047447 Bacteria 1275
238 Ga0495673_0010850 3300047469 Bacteria 4930
239 Ga0495681_0140927 3300047470 Bacteria 1018
240 Ga0495686_0000341 3300047472 Bacteria 76751
241 Ga0495686_0001597 3300047472 Bacteria 23929
242 Ga0495686_0020165 3300047472 Bacteria 4448
243 Ga0495678_006203 3300049459 Bacteria 6396
244 Ga0501033_0064708 3300049570 Bacteria 2691
245 Ga0501034_0007113 3300049571 Bacteria 11936
246 Ga0501035_0153461 3300049822 Bacteria 1997
247 nmdc:mga0k408_3876_c1 3300050493 Bacteria 7927
248 Ga0500635_0005036 3300053080 Bacteria 3442
249 Ga0500635_0012440 3300053080 Bacteria 2444
250 Ga0500608_000417 3300053122 Bacteria 16208
251 Ga0500618_000020 3300053125 Bacteria 161356
252 Ga0500573_0129621 3300053140 Bacteria 1398
253 Ga0500624_001227 3300053157 Bacteria 4574

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10000001 Ga0307407_10000001321 231
2 3300031995 Ga0307409_100055346 Ga0307409_1000553463 231
3 3300032002 Ga0307416_100000008 Ga0307416_10000000868 231
4 3300032004 Ga0307414_10010567 Ga0307414_100105673 231
5 3300014497 Ga0182008_10000315 Ga0182008_100003159 242
6 3300015682 Ga0183373_1002 Ga0183373_1002719 242
7 3300017792 Ga0163161_10000360 Ga0163161_1000036034 242
8 3300013100 Ga0157373_10053561 Ga0157373_100535613 243
9 3300013105 Ga0157369_10000047 Ga0157369_1000004745 243
10 3300013306 Ga0163162_10000557 Ga0163162_1000055721 243
11 3300015261 Ga0182006_1000153 Ga0182006_100015347 243
12 3300015262 Ga0182007_10000005 Ga0182007_10000005132 243
13 3300046507 Ga0495606_0024849 Ga0495606_0024849_2465_3247 243
14 3300046512 Ga0495610_0003036 Ga0495610_0003036_2259_3041 243
15 3300046525 Ga0495663_0020111 Ga0495663_0020111_856_1638 243
16 3300013102 Ga0157371_10225726 Ga0157371_102257261 245
17 3300031731 Ga0307405_10000009 Ga0307405_10000009144 249
18 3300049570 Ga0501033_0064708 Ga0501033_0064708_844_1632 250
19 3300049822 Ga0501035_0153461 Ga0501035_0153461_342_1130 250
20 iso_pu_bacteria 2788500588 2791214515 250
21 iso_pu_bacteria 2818991451 2819628417 250
22 iso_pu_bacteria 2904606771 2904609853 250
23 iso_pu_bacteria 8055531788 8055535577 250
24 3300046810 Ga0495660_0001859 Ga0495660_0001859_10467_11249 253
25 3300053125 Ga0500618_000020 Ga0500618_000020_21009_21791 253
26 3300003751 Ga0055538_1000354 Ga0055538_10003543 254
27 3300003781 Ga0055536_1012573 Ga0055536_10125733 254
28 3300025224 Ga0209784_100054 Ga0209784_10005477 254
29 3300025292 Ga0209676_1001268 Ga0209676_10012687 254
30 3300025292 Ga0209676_1008041 Ga0209676_10080413 254
31 3300025292 Ga0209676_1026065 Ga0209676_10260652 254
32 3300025294 Ga0209025_1002322 Ga0209025_100232211 254
33 3300025294 Ga0209025_1002597 Ga0209025_10025974 254
34 3300046492 Ga0495585_0000235 Ga0495585_0000235_8394_9176 254
35 3300046524 Ga0495648_0013965 Ga0495648_0013965_1337_2119 254
36 3300046616 Ga0495668_0000058 Ga0495668_0000058_111035_111817 254
37 3300046660 Ga0495625_0001733 Ga0495625_0001733_22050_22832 254
38 3300046507 Ga0495606_0013057 Ga0495606_0013057_4431_5213 255
39 3300046660 Ga0495625_0036441 Ga0495625_0036441_2601_3383 255
40 iso_pu_bacteria 2599185184 2599481912 256
41 iso_pu_bacteria 2739367651 2739586982 256
42 iso_pu_bacteria 2739367663 2739648096 256
43 iso_pu_bacteria 2818991437 2819547435 256
44 iso_pu_bacteria 2852623160 2852627118 256
45 iso_pu_bacteria 2857627736 2857630531 256
46 iso_pu_bacteria 2884933994 2884935150 256
47 iso_pu_bacteria 2904445276 2904449676 256
48 iso_pu_bacteria 2919437846 2919439567 256
49 iso_pu_bacteria 2928078545 2928084072 256
50 iso_pu_bacteria 2928147474 2928152838 256
51 iso_pu_bacteria 2932082852 2932087446 256
52 3300002067 JGI24735J21928_10000007 JGI24735J21928_1000000712 260
53 3300002067 JGI24735J21928_10047780 JGI24735J21928_100477801 260
54 3300002737 JGI25162J39368_1000055 JGI25162J39368_100005597 260
55 3300003316 rootH1_10016176 rootH1_1001617612 260
56 3300003322 rootL2_10093441 rootL2_100934412 260
57 3300003323 rootH1_10108314 rootH1_101083142 260
58 3300003781 Ga0055536_1000006 Ga0055536_1000006219 260
59 3300003791 Ga0055530_10004623 Ga0055530_100046234 260
60 3300005327 Ga0070658_10141098 Ga0070658_101410982 260
61 3300005339 Ga0070660_100026304 Ga0070660_1000263045 260
62 3300005339 Ga0070660_100082220 Ga0070660_1000822204 260
63 3300005356 Ga0070674_100045589 Ga0070674_1000455893 260
64 3300005356 Ga0070674_100230791 Ga0070674_1002307912 260
65 3300005366 Ga0070659_100003407 Ga0070659_1000034079 260
66 3300005366 Ga0070659_100034316 Ga0070659_1000343163 260
67 3300005535 Ga0070684_100050348 Ga0070684_1000503482 260
68 3300005539 Ga0068853_100021233 Ga0068853_1000212338 260
69 3300005548 Ga0070665_100000118 Ga0070665_100000118139 260
70 3300005563 Ga0068855_100004525 Ga0068855_1000045257 260
71 3300005563 Ga0068855_100019618 Ga0068855_10001961810 260
72 3300005563 Ga0068855_100032516 Ga0068855_1000325162 260
73 3300005563 Ga0068855_100082149 Ga0068855_1000821494 260
74 3300005563 Ga0068855_100913108 Ga0068855_1009131081 260
75 3300005577 Ga0068857_100201810 Ga0068857_1002018102 260
76 3300005578 Ga0068854_100043274 Ga0068854_1000432743 260
77 3300005614 Ga0068856_100015811 Ga0068856_1000158118 260
78 3300006195 Ga0075366_10065981 Ga0075366_100659811 260
79 3300006195 Ga0075366_10071465 Ga0075366_100714652 260
80 3300009036 Ga0105244_10017654 Ga0105244_100176542 260
81 3300009093 Ga0105240_10036011 Ga0105240_100360113 260
82 3300009093 Ga0105240_10045368 Ga0105240_100453682 260
83 3300009093 Ga0105240_10759393 Ga0105240_107593931 260
84 3300009174 Ga0105241_10127353 Ga0105241_101273531 260
85 3300009174 Ga0105241_10246004 Ga0105241_102460042 260
86 3300009545 Ga0105237_10004869 Ga0105237_100048695 260
87 3300009545 Ga0105237_10023728 Ga0105237_100237287 260
88 3300009545 Ga0105237_10035341 Ga0105237_100353414 260
89 3300009545 Ga0105237_10063449 Ga0105237_100634492 260
90 3300009545 Ga0105237_10073531 Ga0105237_100735313 260
91 3300009545 Ga0105237_10107173 Ga0105237_101071732 260
92 3300009545 Ga0105237_10151999 Ga0105237_101519992 260
93 3300009545 Ga0105237_10984596 Ga0105237_109845961 260
94 3300010375 Ga0105239_10000095 Ga0105239_1000009550 260
95 3300010375 Ga0105239_10000327 Ga0105239_100003273 260
96 3300010375 Ga0105239_10004144 Ga0105239_1000414416 260
97 3300010375 Ga0105239_10006307 Ga0105239_100063073 260
98 3300010375 Ga0105239_10108288 Ga0105239_101082881 260
99 3300013100 Ga0157373_10000152 Ga0157373_1000015213 260
100 3300013102 Ga0157371_10000117 Ga0157371_100001173 260
101 3300013102 Ga0157371_10029645 Ga0157371_100296452 260
102 3300013104 Ga0157370_10001102 Ga0157370_1000110220 260
103 3300013104 Ga0157370_10022085 Ga0157370_100220858 260
104 3300013104 Ga0157370_10036289 Ga0157370_100362895 260
105 3300013105 Ga0157369_10064434 Ga0157369_100644343 260
106 3300013105 Ga0157369_10158513 Ga0157369_101585133 260
107 3300013297 Ga0157378_10052948 Ga0157378_100529483 260
108 3300013306 Ga0163162_10000012 Ga0163162_10000012150 260
109 3300013306 Ga0163162_10016065 Ga0163162_100160653 260
110 3300013307 Ga0157372_10004737 Ga0157372_1000473714 260
111 3300015261 Ga0182006_1000287 Ga0182006_10002874 260
112 3300015262 Ga0182007_10020652 Ga0182007_100206522 260
113 3300017792 Ga0163161_10000306 Ga0163161_1000030617 260
114 3300017792 Ga0163161_10020833 Ga0163161_100208335 260
115 3300025233 Ga0209437_100130 Ga0209437_100130129 260
116 3300025261 Ga0209233_1000466 Ga0209233_100046623 260
117 3300025272 Ga0209455_1000854 Ga0209455_100085411 260
118 3300025292 Ga0209676_1000039 Ga0209676_1000039311 260
119 3300025298 Ga0209050_1000033 Ga0209050_1000033137 260
120 3300025904 Ga0207647_10000103 Ga0207647_1000010315 260
121 3300025909 Ga0207705_10111340 Ga0207705_101113402 260
122 3300025911 Ga0207654_10071425 Ga0207654_100714253 260
123 3300025911 Ga0207654_10350169 Ga0207654_103501692 260
124 3300025913 Ga0207695_10015443 Ga0207695_1001544310 260
125 3300025913 Ga0207695_10113439 Ga0207695_101134394 260
126 3300025914 Ga0207671_10005006 Ga0207671_100050069 260
127 3300025914 Ga0207671_10007251 Ga0207671_100072515 260
128 3300025914 Ga0207671_10007981 Ga0207671_100079816 260
129 3300025914 Ga0207671_10086717 Ga0207671_100867172 260
130 3300025919 Ga0207657_10152323 Ga0207657_101523232 260
131 3300025927 Ga0207687_10127453 Ga0207687_101274532 260
132 3300025932 Ga0207690_10013035 Ga0207690_100130353 260
133 3300025932 Ga0207690_10032027 Ga0207690_100320272 260
134 3300025949 Ga0207667_10000457 Ga0207667_1000045746 260
135 3300025949 Ga0207667_10068214 Ga0207667_100682143 260
136 3300025949 Ga0207667_10155583 Ga0207667_101555832 260
137 3300025981 Ga0207640_10021566 Ga0207640_100215661 260
138 3300026041 Ga0207639_10015609 Ga0207639_100156097 260
139 3300026041 Ga0207639_10489552 Ga0207639_104895522 260
140 3300026078 Ga0207702_10004469 Ga0207702_100044697 260
141 3300026116 Ga0207674_10175948 Ga0207674_101759482 260
142 3300028379 Ga0268266_10000121 Ga0268266_1000012118 260
143 3300028794 Ga0307515_10000077 Ga0307515_1000007759 260
144 3300028794 Ga0307515_10007186 Ga0307515_1000718612 260
145 3300028794 Ga0307515_10064389 Ga0307515_100643893 260
146 3300031507 Ga0307509_10060583 Ga0307509_100605831 260
147 3300033179 Ga0307507_10002369 Ga0307507_1000236919 260
148 3300037312 Ga0395899_0000017 Ga0395899_0000017_228199_228981 260
149 3300037312 Ga0395899_0000024 Ga0395899_0000024_184341_185123 260
150 3300037418 Ga0395900_0004216 Ga0395900_0004216_6001_6783 260
151 3300037418 Ga0395900_0148954 Ga0395900_0148954_949_1731 260
152 3300037466 Ga0395898_0180594 Ga0395898_0180594_635_1417 260
153 3300037471 Ga0395905_0000347 Ga0395905_0000347_52987_53847 260
154 3300038443 Ga0395901_0002910 Ga0395901_0002910_12104_12964 260
155 3300038443 Ga0395901_0147914 Ga0395901_0147914_15_797 260
156 3300046454 Ga0495592_0204161 Ga0495592_0204161_38_820 260
157 3300046460 Ga0495638_0095527 Ga0495638_0095527_652_1434 260
158 3300046462 Ga0495651_0062632 Ga0495651_0062632_1382_2164 260
159 3300046471 Ga0495650_0000050 Ga0495650_0000050_301317_302099 260
160 3300046471 Ga0495650_0030667 Ga0495650_0030667_1038_1820 260
161 3300046492 Ga0495585_0000097 Ga0495585_0000097_89248_90030 260
162 3300046506 Ga0495583_0044380 Ga0495583_0044380_370_1152 260
163 3300046507 Ga0495606_0000036 Ga0495606_0000036_49110_49919 260
164 3300046507 Ga0495606_0008266 Ga0495606_0008266_7061_7843 260
165 3300046507 Ga0495606_0014319 Ga0495606_0014319_134_916 260
166 3300046507 Ga0495606_0126393 Ga0495606_0126393_670_1452 260
167 3300046512 Ga0495610_0005070 Ga0495610_0005070_2593_3375 260
168 3300046513 Ga0495616_0001383 Ga0495616_0001383_11762_12544 260
169 3300046513 Ga0495616_0002111 Ga0495616_0002111_4655_5437 260
170 3300046520 Ga0495637_0020372 Ga0495637_0020372_1747_2529 260
171 3300046524 Ga0495648_0059806 Ga0495648_0059806_1292_2074 260
172 3300046538 Ga0495609_0021112 Ga0495609_0021112_1668_2450 260
173 3300046538 Ga0495609_0086052 Ga0495609_0086052_19_801 260
174 3300046558 Ga0495633_0000004 Ga0495633_0000004_39130_39912 260
175 3300046660 Ga0495625_0000105 Ga0495625_0000105_65552_66334 260
176 3300046660 Ga0495625_0000641 Ga0495625_0000641_1789_2571 260
177 3300046660 Ga0495625_0100558 Ga0495625_0100558_1089_1871 260
178 3300046665 Ga0495661_0069661 Ga0495661_0069661_475_1257 260
179 3300046692 Ga0495671_0018260 Ga0495671_0018260_1292_2074 260
180 3300046694 Ga0495649_0000011 Ga0495649_0000011_58607_59389 260
181 3300047323 Ga0495683_0079196 Ga0495683_0079196_802_1584 260
182 3300047443 Ga0495687_001623 Ga0495687_001623_3283_4065 260
183 3300047469 Ga0495673_0010850 Ga0495673_0010850_3189_3971 260
184 3300047472 Ga0495686_0000341 Ga0495686_0000341_41032_41814 260
185 3300047472 Ga0495686_0020165 Ga0495686_0020165_1894_2676 260
186 3300049459 Ga0495678_006203 Ga0495678_006203_2182_3045 260
187 3300049571 Ga0501034_0007113 Ga0501034_0007113_10442_11230 260
188 3300050493 nmdc:mga0k408_3876_c1 nmdc:mga0k408_3876_c1_350_1132 260
189 3300053080 Ga0500635_0012440 Ga0500635_0012440_392_1174 260
190 3300053122 Ga0500608_000417 Ga0500608_000417_4269_5051 260
191 3300053157 Ga0500624_001227 Ga0500624_001227_1892_2674 260
192 iso_pu_bacteria 2849281842 2849283171 260
193 iso_pu_bacteria 2945997725 2946003239 260
194 3300001915 JGI24741J21665_1010754 JGI24741J21665_10107542 261
195 3300003320 rootH2_10236101 rootH2_102361012 261
196 3300005455 Ga0070663_100000447 Ga0070663_10000044715 261
197 3300005563 Ga0068855_100001431 Ga0068855_10000143113 261
198 3300005614 Ga0068856_100000108 Ga0068856_10000010832 261
199 3300005614 Ga0068856_100060532 Ga0068856_1000605322 261
200 3300005614 Ga0068856_100477679 Ga0068856_1004776791 261
201 3300005616 Ga0068852_100064985 Ga0068852_1000649852 261
202 3300005842 Ga0068858_100107579 Ga0068858_1001075791 261
203 3300009545 Ga0105237_10024437 Ga0105237_100244374 261
204 3300009551 Ga0105238_10021356 Ga0105238_100213565 261
205 3300009551 Ga0105238_10208643 Ga0105238_102086431 261
206 3300010375 Ga0105239_10000008 Ga0105239_10000008337 261
207 3300010375 Ga0105239_10000428 Ga0105239_100004285 261
208 3300013102 Ga0157371_10008927 Ga0157371_100089274 261
209 3300013104 Ga0157370_10157545 Ga0157370_101575452 261
210 3300013105 Ga0157369_10000101 Ga0157369_1000010155 261
211 3300013306 Ga0163162_10064932 Ga0163162_100649323 261
212 3300013306 Ga0163162_10375547 Ga0163162_103755471 261
213 3300013307 Ga0157372_10000041 Ga0157372_1000004152 261
214 3300025250 Ga0209026_1004800 Ga0209026_10048003 261
215 3300025261 Ga0209233_1038929 Ga0209233_10389292 261
216 3300025911 Ga0207654_10008233 Ga0207654_100082335 261
217 3300025913 Ga0207695_10000235 Ga0207695_1000023584 261
218 3300025914 Ga0207671_10003198 Ga0207671_1000319812 261
219 3300025924 Ga0207694_10020393 Ga0207694_100203935 261
220 3300025949 Ga0207667_10001338 Ga0207667_1000133813 261
221 3300026067 Ga0207678_10169954 Ga0207678_101699542 261
222 3300026078 Ga0207702_10000183 Ga0207702_1000018325 261
223 3300026078 Ga0207702_10046590 Ga0207702_100465901 261
224 3300026078 Ga0207702_10865563 Ga0207702_108655631 261
225 3300026142 Ga0207698_10384728 Ga0207698_103847282 261
226 3300028800 Ga0265338_10054341 Ga0265338_100543412 261
227 3300031911 Ga0307412_10097983 Ga0307412_100979832 261
228 3300046523 Ga0495644_0006793 Ga0495644_0006793_1356_2141 261
229 3300046528 Ga0495642_0079625 Ga0495642_0079625_288_1073 261
230 3300046665 Ga0495661_0167674 Ga0495661_0167674_79_864 261
231 3300047445 Ga0495677_0028388 Ga0495677_0028388_40_825 261
232 3300047447 Ga0495685_060652 Ga0495685_060652_158_943 261
233 3300047470 Ga0495681_0140927 Ga0495681_0140927_172_957 261
234 3300047472 Ga0495686_0001597 Ga0495686_0001597_16016_16801 261
235 3300053080 Ga0500635_0005036 Ga0500635_0005036_922_1707 261
236 3300001904 JGI24736J21556_1001996 JGI24736J21556_10019963 262
237 3300002737 JGI25162J39368_1001849 JGI25162J39368_10018493 262
238 3300003214 JGI25165J46597_1000305 JGI25165J46597_10003056 262
239 3300003320 rootH2_10055701 rootH2_100557011 262
240 3300003323 rootH1_10005288 rootH1_1000528820 262
241 3300003323 rootH1_10015911 rootH1_100159113 262
242 3300003323 rootH1_10107111 rootH1_101071112 262
243 3300005339 Ga0070660_100025877 Ga0070660_1000258773 262
244 3300005457 Ga0070662_100000468 Ga0070662_10000046818 262
245 3300005614 Ga0068856_100051537 Ga0068856_1000515372 262
246 3300009093 Ga0105240_10091089 Ga0105240_100910892 262
247 3300009174 Ga0105241_10007909 Ga0105241_100079094 262
248 3300013100 Ga0157373_10223726 Ga0157373_102237262 262
249 3300013100 Ga0157373_10251808 Ga0157373_102518082 262
250 3300013104 Ga0157370_10072938 Ga0157370_100729383 262
251 3300013105 Ga0157369_10021821 Ga0157369_100218217 262
252 3300013296 Ga0157374_10000741 Ga0157374_1000074121 262
253 3300013307 Ga0157372_10044745 Ga0157372_100447456 262
254 3300013308 Ga0157375_10022320 Ga0157375_100223207 262
255 3300014745 Ga0157377_10091154 Ga0157377_100911542 262
256 3300025231 Ga0207427_100423 Ga0207427_10042320 262
257 3300025233 Ga0209437_100026 Ga0209437_100026370 262
258 3300025233 Ga0209437_100026 Ga0209437_10002658 262
259 3300025261 Ga0209233_1000206 Ga0209233_100020639 262
260 3300025904 Ga0207647_10000049 Ga0207647_1000004972 262
261 3300025911 Ga0207654_10004708 Ga0207654_100047082 262
262 3300025913 Ga0207695_10007414 Ga0207695_100074147 262
263 3300025919 Ga0207657_10025398 Ga0207657_100253983 262
264 3300025933 Ga0207706_10000111 Ga0207706_1000011171 262
265 3300025949 Ga0207667_10622574 Ga0207667_106225741 262
266 3300026035 Ga0207703_10259323 Ga0207703_102593232 262
267 3300044684 Ga0466966_0021578 Ga0466966_0021578_2443_3231 262
268 3300044693 Ga0466961_0008211 Ga0466961_0008211_1866_2654 262
269 3300045836 Ga0466958_0047669 Ga0466958_0047669_79_867 262
270 3300046538 Ga0495609_0060834 Ga0495609_0060834_185_976 262
271 3300053140 Ga0500573_0129621 Ga0500573_0129621_118_909 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

31

283

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.9482 2 257
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.939 2 257
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9366 2 257
2c3z-assembly1.cif.gz_A crystal structure of a truncated variant of indole-3-glycerol phosphate synthase from sulfolobus solfataricus 0.9352 38 256
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.934 2 257
ID Description Score Start End Superfamily
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9362 2 258 3.20.20.70
2c3zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9352 38 256 3.20.20.70
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9319 40 258 3.20.20.70
3o6yX00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9219 34 262 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9211 2 262 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7T9P5G5-F1-model_v4 deleted 0.9972 1 260
AF-A0A4V1SZQ2-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9966 1 202 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-R9GVY5-F1-model_v4 Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) 0.9963 1 261 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A4R1M0D6-F1-model_v4 Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) 0.9963 1 258 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A519UT76-F1-model_v4 Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) 0.9956 1 260 GO:0000162
GO:0004425
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
95.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map