F377937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 152 | 253 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300049459|Ga0495678_006203|Ga0495678_006203_2182_3045 |
| Length | 287 |
| Sequence | MPKQVRHDKIIFLTFKQINSPFRGLGGMTILDKIVAYKKKEVASAKKRTSYVELEESEYFHRETYSFKEFLLDPTRTGIIAEFKRKSPSKGIINDKVRVSAVTNGYANAGASALSVLTDRNFFMGRKADLVKARSVNTIPILRKDFMIDEYQVIEAKSLGADIILLIAAILTPAQIDTMATLAKSIGLNVLLEVHNLEELERSIHPKLDAIGVNNRNLADFTVSVETSYELAKHIPAEFMKISESAISDPETIRHLKLAGFNGFLIGETFMKQPDPGEAMRDFVAQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 3 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 4 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 5 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 6 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 7 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 8 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 9 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 10 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 11 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 12 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 13 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 14 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 15 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 16 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 17 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 104 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 111 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 148 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 149 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 151 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 152 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.36 |
| Metatranscriptomes | 0 |
| Isolates | 6.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.81 |
| Nodule | 0 |
| Rhizoplane | 0.37 |
| Rhizosphere | 79.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001996 | 3300001904 | Bacteria | 3626 |
| 2 | JGI24741J21665_1010754 | 3300001915 | Bacteria | 1623 |
| 3 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 4 | JGI24735J21928_10047780 | 3300002067 | Bacteria | 1240 |
| 5 | JGI25162J39368_1000055 | 3300002737 | Bacteria | 147236 |
| 6 | JGI25162J39368_1001849 | 3300002737 | Bacteria | 9811 |
| 7 | JGI25165J46597_1000305 | 3300003214 | Bacteria | 61229 |
| 8 | rootH1_10016176 | 3300003316 | Bacteria | 26999 |
| 9 | rootH1_10016176 | 3300003323 | Bacteria | 2806 |
| 10 | rootH2_10055701 | 3300003320 | Bacteria | 1010 |
| 11 | rootH2_10236101 | 3300003320 | Bacteria | 1723 |
| 12 | rootL2_10093441 | 3300003322 | Bacteria | 1644 |
| 13 | rootH1_10005288 | 3300003323 | Bacteria | 25229 |
| 14 | rootH1_10015911 | 3300003323 | Bacteria | 2460 |
| 15 | rootH1_10107111 | 3300003323 | Bacteria | 2102 |
| 16 | rootH1_10108314 | 3300003323 | Bacteria | 3091 |
| 17 | Ga0055538_1000354 | 3300003751 | Bacteria | 19744 |
| 18 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 19 | Ga0055536_1012573 | 3300003781 | Bacteria | 3128 |
| 20 | Ga0055530_10004623 | 3300003791 | Bacteria | 7006 |
| 21 | Ga0070658_10141098 | 3300005327 | Bacteria | 2013 |
| 22 | Ga0070660_100025877 | 3300005339 | Bacteria | 4364 |
| 23 | Ga0070660_100026304 | 3300005339 | Bacteria | 4331 |
| 24 | Ga0070660_100082220 | 3300005339 | Bacteria | 2529 |
| 25 | Ga0070674_100045589 | 3300005356 | Bacteria | 2996 |
| 26 | Ga0070674_100230791 | 3300005356 | Bacteria | 1444 |
| 27 | Ga0070659_100003407 | 3300005366 | Bacteria | 11330 |
| 28 | Ga0070659_100034316 | 3300005366 | Bacteria | 3946 |
| 29 | Ga0070663_100000447 | 3300005455 | Bacteria | 21810 |
| 30 | Ga0070662_100000468 | 3300005457 | Bacteria | 24024 |
| 31 | Ga0070684_100050348 | 3300005535 | Bacteria | 3618 |
| 32 | Ga0068853_100021233 | 3300005539 | Bacteria | 5409 |
| 33 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 34 | Ga0068855_100001431 | 3300005563 | Bacteria | 29691 |
| 35 | Ga0068855_100004525 | 3300005563 | Bacteria | 16986 |
| 36 | Ga0068855_100019618 | 3300005563 | Bacteria | 8121 |
| 37 | Ga0068855_100032516 | 3300005563 | Bacteria | 6227 |
| 38 | Ga0068855_100082149 | 3300005563 | Bacteria | 3735 |
| 39 | Ga0068855_100913108 | 3300005563 | Bacteria | 927 |
| 40 | Ga0068857_100201810 | 3300005577 | Bacteria | 1813 |
| 41 | Ga0068854_100043274 | 3300005578 | Bacteria | 3191 |
| 42 | Ga0068856_100000108 | 3300005614 | Bacteria | 81559 |
| 43 | Ga0068856_100015811 | 3300005614 | Bacteria | 7299 |
| 44 | Ga0068856_100051537 | 3300005614 | Bacteria | 4058 |
| 45 | Ga0068856_100060532 | 3300005614 | Bacteria | 3741 |
| 46 | Ga0068856_100477679 | 3300005614 | Bacteria | 1267 |
| 47 | Ga0068852_100064985 | 3300005616 | Bacteria | 3182 |
| 48 | Ga0068858_100107579 | 3300005842 | Bacteria | 2603 |
| 49 | Ga0075366_10065981 | 3300006195 | Bacteria | 2153 |
| 50 | Ga0075366_10071465 | 3300006195 | Bacteria | 2068 |
| 51 | Ga0105244_10017654 | 3300009036 | Bacteria | 4027 |
| 52 | Ga0105240_10036011 | 3300009093 | Bacteria | 6373 |
| 53 | Ga0105240_10045368 | 3300009093 | Bacteria | 5576 |
| 54 | Ga0105240_10091089 | 3300009093 | Bacteria | 3726 |
| 55 | Ga0105240_10759393 | 3300009093 | Bacteria | 1054 |
| 56 | Ga0105241_10007909 | 3300009174 | Bacteria | 7817 |
| 57 | Ga0105241_10127353 | 3300009174 | Bacteria | 2058 |
| 58 | Ga0105241_10246004 | 3300009174 | Bacteria | 1514 |
| 59 | Ga0105237_10004869 | 3300009545 | Bacteria | 15388 |
| 60 | Ga0105237_10023728 | 3300009545 | Bacteria | 6280 |
| 61 | Ga0105237_10024437 | 3300009545 | Bacteria | 6181 |
| 62 | Ga0105237_10035341 | 3300009545 | Bacteria | 5057 |
| 63 | Ga0105237_10063449 | 3300009545 | Bacteria | 3692 |
| 64 | Ga0105237_10073531 | 3300009545 | Bacteria | 3410 |
| 65 | Ga0105237_10107173 | 3300009545 | Bacteria | 2786 |
| 66 | Ga0105237_10151999 | 3300009545 | Bacteria | 2311 |
| 67 | Ga0105237_10984596 | 3300009545 | Bacteria | 850 |
| 68 | Ga0105238_10021356 | 3300009551 | Bacteria | 6596 |
| 69 | Ga0105238_10208643 | 3300009551 | Bacteria | 1929 |
| 70 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 71 | Ga0105239_10000095 | 3300010375 | Bacteria | 124330 |
| 72 | Ga0105239_10000327 | 3300010375 | Bacteria | 70423 |
| 73 | Ga0105239_10000428 | 3300010375 | Bacteria | 61391 |
| 74 | Ga0105239_10004144 | 3300010375 | Bacteria | 17403 |
| 75 | Ga0105239_10006307 | 3300010375 | Bacteria | 13793 |
| 76 | Ga0105239_10108288 | 3300010375 | Bacteria | 3079 |
| 77 | Ga0157373_10000152 | 3300013100 | Bacteria | 55831 |
| 78 | Ga0157373_10053561 | 3300013100 | Bacteria | 2869 |
| 79 | Ga0157373_10223726 | 3300013100 | Bacteria | 1328 |
| 80 | Ga0157373_10251808 | 3300013100 | Bacteria | 1249 |
| 81 | Ga0157371_10000117 | 3300013102 | Bacteria | 121069 |
| 82 | Ga0157371_10008927 | 3300013102 | Bacteria | 7936 |
| 83 | Ga0157371_10029645 | 3300013102 | Bacteria | 3954 |
| 84 | Ga0157371_10225726 | 3300013102 | Bacteria | 1345 |
| 85 | Ga0157370_10001102 | 3300013104 | Bacteria | 33889 |
| 86 | Ga0157370_10022085 | 3300013104 | Bacteria | 6337 |
| 87 | Ga0157370_10036289 | 3300013104 | Bacteria | 4785 |
| 88 | Ga0157370_10072938 | 3300013104 | Bacteria | 3239 |
| 89 | Ga0157370_10157545 | 3300013104 | Bacteria | 2113 |
| 90 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 91 | Ga0157369_10000101 | 3300013105 | Bacteria | 118683 |
| 92 | Ga0157369_10021821 | 3300013105 | Bacteria | 7160 |
| 93 | Ga0157369_10064434 | 3300013105 | Bacteria | 3947 |
| 94 | Ga0157369_10158513 | 3300013105 | Bacteria | 2389 |
| 95 | Ga0157374_10000741 | 3300013296 | Bacteria | 28443 |
| 96 | Ga0157378_10052948 | 3300013297 | Bacteria | 3612 |
| 97 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 98 | Ga0163162_10000557 | 3300013306 | Bacteria | 34493 |
| 99 | Ga0163162_10016065 | 3300013306 | Bacteria | 7316 |
| 100 | Ga0163162_10064932 | 3300013306 | Bacteria | 3696 |
| 101 | Ga0163162_10375547 | 3300013306 | Bacteria | 1555 |
| 102 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 103 | Ga0157372_10004737 | 3300013307 | Bacteria | 14447 |
| 104 | Ga0157372_10044745 | 3300013307 | Bacteria | 4906 |
| 105 | Ga0157375_10022320 | 3300013308 | Bacteria | 5824 |
| 106 | Ga0182008_10000315 | 3300014497 | Bacteria | 38030 |
| 107 | Ga0157377_10091154 | 3300014745 | Bacteria | 1800 |
| 108 | Ga0182006_1000153 | 3300015261 | Bacteria | 73985 |
| 109 | Ga0182006_1000287 | 3300015261 | Bacteria | 44409 |
| 110 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 111 | Ga0182007_10020652 | 3300015262 | Bacteria | 2351 |
| 112 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 113 | Ga0163161_10000306 | 3300017792 | Bacteria | 42759 |
| 114 | Ga0163161_10000360 | 3300017792 | Bacteria | 38354 |
| 115 | Ga0163161_10020833 | 3300017792 | Bacteria | 4604 |
| 116 | Ga0209784_100054 | 3300025224 | Bacteria | 178541 |
| 117 | Ga0207427_100423 | 3300025231 | Bacteria | 23892 |
| 118 | Ga0209437_100026 | 3300025233 | Bacteria | 542698 |
| 119 | Ga0209437_100130 | 3300025233 | Bacteria | 183731 |
| 120 | Ga0209026_1004800 | 3300025250 | Bacteria | 3860 |
| 121 | Ga0209233_1000206 | 3300025261 | Bacteria | 117820 |
| 122 | Ga0209233_1000466 | 3300025261 | Bacteria | 25583 |
| 123 | Ga0209233_1038929 | 3300025261 | Bacteria | 1046 |
| 124 | Ga0209455_1000854 | 3300025272 | Bacteria | 16294 |
| 125 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 126 | Ga0209676_1001268 | 3300025292 | Bacteria | 26245 |
| 127 | Ga0209676_1008041 | 3300025292 | Bacteria | 4797 |
| 128 | Ga0209676_1026065 | 3300025292 | Bacteria | 1863 |
| 129 | Ga0209025_1002322 | 3300025294 | Bacteria | 20551 |
| 130 | Ga0209025_1002597 | 3300025294 | Bacteria | 18646 |
| 131 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 132 | Ga0207647_10000049 | 3300025904 | Bacteria | 88392 |
| 133 | Ga0207647_10000103 | 3300025904 | Bacteria | 65792 |
| 134 | Ga0207705_10111340 | 3300025909 | Bacteria | 2023 |
| 135 | Ga0207654_10004708 | 3300025911 | Bacteria | 6903 |
| 136 | Ga0207654_10008233 | 3300025911 | Bacteria | 5264 |
| 137 | Ga0207654_10071425 | 3300025911 | Bacteria | 2063 |
| 138 | Ga0207654_10350169 | 3300025911 | Bacteria | 1017 |
| 139 | Ga0207695_10000235 | 3300025913 | Bacteria | 146984 |
| 140 | Ga0207695_10007414 | 3300025913 | Bacteria | 13973 |
| 141 | Ga0207695_10015443 | 3300025913 | Bacteria | 8988 |
| 142 | Ga0207695_10113439 | 3300025913 | Bacteria | 2686 |
| 143 | Ga0207671_10003198 | 3300025914 | Bacteria | 16504 |
| 144 | Ga0207671_10005006 | 3300025914 | Bacteria | 12403 |
| 145 | Ga0207671_10007251 | 3300025914 | Bacteria | 9654 |
| 146 | Ga0207671_10007981 | 3300025914 | Bacteria | 9066 |
| 147 | Ga0207671_10086717 | 3300025914 | Bacteria | 2353 |
| 148 | Ga0207657_10025398 | 3300025919 | Bacteria | 5464 |
| 149 | Ga0207657_10152323 | 3300025919 | Bacteria | 1882 |
| 150 | Ga0207694_10020393 | 3300025924 | Bacteria | 5015 |
| 151 | Ga0207687_10127453 | 3300025927 | Bacteria | 1913 |
| 152 | Ga0207690_10013035 | 3300025932 | Bacteria | 4986 |
| 153 | Ga0207690_10032027 | 3300025932 | Bacteria | 3370 |
| 154 | Ga0207706_10000111 | 3300025933 | Bacteria | 87282 |
| 155 | Ga0207667_10000457 | 3300025949 | Bacteria | 54773 |
| 156 | Ga0207667_10001338 | 3300025949 | Bacteria | 30924 |
| 157 | Ga0207667_10068214 | 3300025949 | Bacteria | 3704 |
| 158 | Ga0207667_10155583 | 3300025949 | Bacteria | 2352 |
| 159 | Ga0207667_10622574 | 3300025949 | Bacteria | 1087 |
| 160 | Ga0207640_10021566 | 3300025981 | Bacteria | 3842 |
| 161 | Ga0207703_10259323 | 3300026035 | Bacteria | 1571 |
| 162 | Ga0207639_10015609 | 3300026041 | Bacteria | 5359 |
| 163 | Ga0207639_10489552 | 3300026041 | Bacteria | 1122 |
| 164 | Ga0207678_10169954 | 3300026067 | Bacteria | 1861 |
| 165 | Ga0207702_10000183 | 3300026078 | Bacteria | 75210 |
| 166 | Ga0207702_10004469 | 3300026078 | Bacteria | 12422 |
| 167 | Ga0207702_10046590 | 3300026078 | Bacteria | 3650 |
| 168 | Ga0207702_10865563 | 3300026078 | Bacteria | 895 |
| 169 | Ga0207674_10175948 | 3300026116 | Bacteria | 2092 |
| 170 | Ga0207698_10384728 | 3300026142 | Bacteria | 1336 |
| 171 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 172 | Ga0307515_10000077 | 3300028794 | Bacteria | 228162 |
| 173 | Ga0307515_10007186 | 3300028794 | Bacteria | 22080 |
| 174 | Ga0307515_10064389 | 3300028794 | Bacteria | 5126 |
| 175 | Ga0265338_10054341 | 3300028800 | Bacteria | 3573 |
| 176 | Ga0307509_10060583 | 3300031507 | Bacteria | 4000 |
| 177 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 178 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 179 | Ga0307412_10097983 | 3300031911 | Unclassified | 2067 |
| 180 | Ga0307409_100055346 | 3300031995 | Bacteria | 3062 |
| 181 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 182 | Ga0307414_10010567 | 3300032004 | Bacteria | 5366 |
| 183 | Ga0307507_10002369 | 3300033179 | Bacteria | 39902 |
| 184 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 185 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 186 | Ga0395900_0004216 | 3300037418 | Bacteria | 15260 |
| 187 | Ga0395900_0148954 | 3300037418 | Bacteria | 2392 |
| 188 | Ga0395898_0180594 | 3300037466 | Bacteria | 2017 |
| 189 | Ga0395905_0000347 | 3300037471 | Bacteria | 65943 |
| 190 | Ga0395901_0002910 | 3300038443 | Bacteria | 17294 |
| 191 | Ga0395901_0147914 | 3300038443 | Bacteria | 2469 |
| 192 | Ga0466966_0021578 | 3300044684 | Bacteria | 4229 |
| 193 | Ga0466961_0008211 | 3300044693 | Bacteria | 6652 |
| 194 | Ga0466958_0047669 | 3300045836 | Bacteria | 2587 |
| 195 | Ga0495592_0204161 | 3300046454 | Bacteria | 1332 |
| 196 | Ga0495638_0095527 | 3300046460 | Bacteria | 1785 |
| 197 | Ga0495651_0062632 | 3300046462 | Bacteria | 2846 |
| 198 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 199 | Ga0495650_0030667 | 3300046471 | Bacteria | 2431 |
| 200 | Ga0495585_0000097 | 3300046492 | Bacteria | 93394 |
| 201 | Ga0495585_0000235 | 3300046492 | Bacteria | 57308 |
| 202 | Ga0495583_0044380 | 3300046506 | Bacteria | 2063 |
| 203 | Ga0495606_0000036 | 3300046507 | Bacteria | 234596 |
| 204 | Ga0495606_0008266 | 3300046507 | Bacteria | 9082 |
| 205 | Ga0495606_0013057 | 3300046507 | Bacteria | 6598 |
| 206 | Ga0495606_0014319 | 3300046507 | Bacteria | 6203 |
| 207 | Ga0495606_0024849 | 3300046507 | Bacteria | 4305 |
| 208 | Ga0495606_0126393 | 3300046507 | Bacteria | 1524 |
| 209 | Ga0495610_0003036 | 3300046512 | Bacteria | 13440 |
| 210 | Ga0495610_0005070 | 3300046512 | Bacteria | 9491 |
| 211 | Ga0495616_0001383 | 3300046513 | Bacteria | 16895 |
| 212 | Ga0495616_0002111 | 3300046513 | Bacteria | 13329 |
| 213 | Ga0495637_0020372 | 3300046520 | Bacteria | 3053 |
| 214 | Ga0495644_0006793 | 3300046523 | Bacteria | 4432 |
| 215 | Ga0495648_0013965 | 3300046524 | Bacteria | 5908 |
| 216 | Ga0495648_0059806 | 3300046524 | Bacteria | 2271 |
| 217 | Ga0495663_0020111 | 3300046525 | Bacteria | 1915 |
| 218 | Ga0495642_0079625 | 3300046528 | Bacteria | 1378 |
| 219 | Ga0495609_0021112 | 3300046538 | Bacteria | 3004 |
| 220 | Ga0495609_0060834 | 3300046538 | Bacteria | 1669 |
| 221 | Ga0495609_0086052 | 3300046538 | Bacteria | 1370 |
| 222 | Ga0495633_0000004 | 3300046558 | Bacteria | 370781 |
| 223 | Ga0495668_0000058 | 3300046616 | Bacteria | 195501 |
| 224 | Ga0495625_0000105 | 3300046660 | Bacteria | 126078 |
| 225 | Ga0495625_0000641 | 3300046660 | Bacteria | 50345 |
| 226 | Ga0495625_0001733 | 3300046660 | Bacteria | 25233 |
| 227 | Ga0495625_0036441 | 3300046660 | Bacteria | 3615 |
| 228 | Ga0495625_0100558 | 3300046660 | Bacteria | 1987 |
| 229 | Ga0495661_0069661 | 3300046665 | Bacteria | 2060 |
| 230 | Ga0495661_0167674 | 3300046665 | Bacteria | 1174 |
| 231 | Ga0495671_0018260 | 3300046692 | Bacteria | 3724 |
| 232 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 233 | Ga0495660_0001859 | 3300046810 | Bacteria | 13854 |
| 234 | Ga0495683_0079196 | 3300047323 | Bacteria | 1605 |
| 235 | Ga0495687_001623 | 3300047443 | Bacteria | 20253 |
| 236 | Ga0495677_0028388 | 3300047445 | Bacteria | 2031 |
| 237 | Ga0495685_060652 | 3300047447 | Bacteria | 1275 |
| 238 | Ga0495673_0010850 | 3300047469 | Bacteria | 4930 |
| 239 | Ga0495681_0140927 | 3300047470 | Bacteria | 1018 |
| 240 | Ga0495686_0000341 | 3300047472 | Bacteria | 76751 |
| 241 | Ga0495686_0001597 | 3300047472 | Bacteria | 23929 |
| 242 | Ga0495686_0020165 | 3300047472 | Bacteria | 4448 |
| 243 | Ga0495678_006203 | 3300049459 | Bacteria | 6396 |
| 244 | Ga0501033_0064708 | 3300049570 | Bacteria | 2691 |
| 245 | Ga0501034_0007113 | 3300049571 | Bacteria | 11936 |
| 246 | Ga0501035_0153461 | 3300049822 | Bacteria | 1997 |
| 247 | nmdc:mga0k408_3876_c1 | 3300050493 | Bacteria | 7927 |
| 248 | Ga0500635_0005036 | 3300053080 | Bacteria | 3442 |
| 249 | Ga0500635_0012440 | 3300053080 | Bacteria | 2444 |
| 250 | Ga0500608_000417 | 3300053122 | Bacteria | 16208 |
| 251 | Ga0500618_000020 | 3300053125 | Bacteria | 161356 |
| 252 | Ga0500573_0129621 | 3300053140 | Bacteria | 1398 |
| 253 | Ga0500624_001227 | 3300053157 | Bacteria | 4574 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001321 | 231 |
| 2 | 3300031995 | Ga0307409_100055346 | Ga0307409_1000553463 | 231 |
| 3 | 3300032002 | Ga0307416_100000008 | Ga0307416_10000000868 | 231 |
| 4 | 3300032004 | Ga0307414_10010567 | Ga0307414_100105673 | 231 |
| 5 | 3300014497 | Ga0182008_10000315 | Ga0182008_100003159 | 242 |
| 6 | 3300015682 | Ga0183373_1002 | Ga0183373_1002719 | 242 |
| 7 | 3300017792 | Ga0163161_10000360 | Ga0163161_1000036034 | 242 |
| 8 | 3300013100 | Ga0157373_10053561 | Ga0157373_100535613 | 243 |
| 9 | 3300013105 | Ga0157369_10000047 | Ga0157369_1000004745 | 243 |
| 10 | 3300013306 | Ga0163162_10000557 | Ga0163162_1000055721 | 243 |
| 11 | 3300015261 | Ga0182006_1000153 | Ga0182006_100015347 | 243 |
| 12 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005132 | 243 |
| 13 | 3300046507 | Ga0495606_0024849 | Ga0495606_0024849_2465_3247 | 243 |
| 14 | 3300046512 | Ga0495610_0003036 | Ga0495610_0003036_2259_3041 | 243 |
| 15 | 3300046525 | Ga0495663_0020111 | Ga0495663_0020111_856_1638 | 243 |
| 16 | 3300013102 | Ga0157371_10225726 | Ga0157371_102257261 | 245 |
| 17 | 3300031731 | Ga0307405_10000009 | Ga0307405_10000009144 | 249 |
| 18 | 3300049570 | Ga0501033_0064708 | Ga0501033_0064708_844_1632 | 250 |
| 19 | 3300049822 | Ga0501035_0153461 | Ga0501035_0153461_342_1130 | 250 |
| 20 | iso_pu_bacteria | 2788500588 | 2791214515 | 250 |
| 21 | iso_pu_bacteria | 2818991451 | 2819628417 | 250 |
| 22 | iso_pu_bacteria | 2904606771 | 2904609853 | 250 |
| 23 | iso_pu_bacteria | 8055531788 | 8055535577 | 250 |
| 24 | 3300046810 | Ga0495660_0001859 | Ga0495660_0001859_10467_11249 | 253 |
| 25 | 3300053125 | Ga0500618_000020 | Ga0500618_000020_21009_21791 | 253 |
| 26 | 3300003751 | Ga0055538_1000354 | Ga0055538_10003543 | 254 |
| 27 | 3300003781 | Ga0055536_1012573 | Ga0055536_10125733 | 254 |
| 28 | 3300025224 | Ga0209784_100054 | Ga0209784_10005477 | 254 |
| 29 | 3300025292 | Ga0209676_1001268 | Ga0209676_10012687 | 254 |
| 30 | 3300025292 | Ga0209676_1008041 | Ga0209676_10080413 | 254 |
| 31 | 3300025292 | Ga0209676_1026065 | Ga0209676_10260652 | 254 |
| 32 | 3300025294 | Ga0209025_1002322 | Ga0209025_100232211 | 254 |
| 33 | 3300025294 | Ga0209025_1002597 | Ga0209025_10025974 | 254 |
| 34 | 3300046492 | Ga0495585_0000235 | Ga0495585_0000235_8394_9176 | 254 |
| 35 | 3300046524 | Ga0495648_0013965 | Ga0495648_0013965_1337_2119 | 254 |
| 36 | 3300046616 | Ga0495668_0000058 | Ga0495668_0000058_111035_111817 | 254 |
| 37 | 3300046660 | Ga0495625_0001733 | Ga0495625_0001733_22050_22832 | 254 |
| 38 | 3300046507 | Ga0495606_0013057 | Ga0495606_0013057_4431_5213 | 255 |
| 39 | 3300046660 | Ga0495625_0036441 | Ga0495625_0036441_2601_3383 | 255 |
| 40 | iso_pu_bacteria | 2599185184 | 2599481912 | 256 |
| 41 | iso_pu_bacteria | 2739367651 | 2739586982 | 256 |
| 42 | iso_pu_bacteria | 2739367663 | 2739648096 | 256 |
| 43 | iso_pu_bacteria | 2818991437 | 2819547435 | 256 |
| 44 | iso_pu_bacteria | 2852623160 | 2852627118 | 256 |
| 45 | iso_pu_bacteria | 2857627736 | 2857630531 | 256 |
| 46 | iso_pu_bacteria | 2884933994 | 2884935150 | 256 |
| 47 | iso_pu_bacteria | 2904445276 | 2904449676 | 256 |
| 48 | iso_pu_bacteria | 2919437846 | 2919439567 | 256 |
| 49 | iso_pu_bacteria | 2928078545 | 2928084072 | 256 |
| 50 | iso_pu_bacteria | 2928147474 | 2928152838 | 256 |
| 51 | iso_pu_bacteria | 2932082852 | 2932087446 | 256 |
| 52 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_1000000712 | 260 |
| 53 | 3300002067 | JGI24735J21928_10047780 | JGI24735J21928_100477801 | 260 |
| 54 | 3300002737 | JGI25162J39368_1000055 | JGI25162J39368_100005597 | 260 |
| 55 | 3300003316 | rootH1_10016176 | rootH1_1001617612 | 260 |
| 56 | 3300003322 | rootL2_10093441 | rootL2_100934412 | 260 |
| 57 | 3300003323 | rootH1_10108314 | rootH1_101083142 | 260 |
| 58 | 3300003781 | Ga0055536_1000006 | Ga0055536_1000006219 | 260 |
| 59 | 3300003791 | Ga0055530_10004623 | Ga0055530_100046234 | 260 |
| 60 | 3300005327 | Ga0070658_10141098 | Ga0070658_101410982 | 260 |
| 61 | 3300005339 | Ga0070660_100026304 | Ga0070660_1000263045 | 260 |
| 62 | 3300005339 | Ga0070660_100082220 | Ga0070660_1000822204 | 260 |
| 63 | 3300005356 | Ga0070674_100045589 | Ga0070674_1000455893 | 260 |
| 64 | 3300005356 | Ga0070674_100230791 | Ga0070674_1002307912 | 260 |
| 65 | 3300005366 | Ga0070659_100003407 | Ga0070659_1000034079 | 260 |
| 66 | 3300005366 | Ga0070659_100034316 | Ga0070659_1000343163 | 260 |
| 67 | 3300005535 | Ga0070684_100050348 | Ga0070684_1000503482 | 260 |
| 68 | 3300005539 | Ga0068853_100021233 | Ga0068853_1000212338 | 260 |
| 69 | 3300005548 | Ga0070665_100000118 | Ga0070665_100000118139 | 260 |
| 70 | 3300005563 | Ga0068855_100004525 | Ga0068855_1000045257 | 260 |
| 71 | 3300005563 | Ga0068855_100019618 | Ga0068855_10001961810 | 260 |
| 72 | 3300005563 | Ga0068855_100032516 | Ga0068855_1000325162 | 260 |
| 73 | 3300005563 | Ga0068855_100082149 | Ga0068855_1000821494 | 260 |
| 74 | 3300005563 | Ga0068855_100913108 | Ga0068855_1009131081 | 260 |
| 75 | 3300005577 | Ga0068857_100201810 | Ga0068857_1002018102 | 260 |
| 76 | 3300005578 | Ga0068854_100043274 | Ga0068854_1000432743 | 260 |
| 77 | 3300005614 | Ga0068856_100015811 | Ga0068856_1000158118 | 260 |
| 78 | 3300006195 | Ga0075366_10065981 | Ga0075366_100659811 | 260 |
| 79 | 3300006195 | Ga0075366_10071465 | Ga0075366_100714652 | 260 |
| 80 | 3300009036 | Ga0105244_10017654 | Ga0105244_100176542 | 260 |
| 81 | 3300009093 | Ga0105240_10036011 | Ga0105240_100360113 | 260 |
| 82 | 3300009093 | Ga0105240_10045368 | Ga0105240_100453682 | 260 |
| 83 | 3300009093 | Ga0105240_10759393 | Ga0105240_107593931 | 260 |
| 84 | 3300009174 | Ga0105241_10127353 | Ga0105241_101273531 | 260 |
| 85 | 3300009174 | Ga0105241_10246004 | Ga0105241_102460042 | 260 |
| 86 | 3300009545 | Ga0105237_10004869 | Ga0105237_100048695 | 260 |
| 87 | 3300009545 | Ga0105237_10023728 | Ga0105237_100237287 | 260 |
| 88 | 3300009545 | Ga0105237_10035341 | Ga0105237_100353414 | 260 |
| 89 | 3300009545 | Ga0105237_10063449 | Ga0105237_100634492 | 260 |
| 90 | 3300009545 | Ga0105237_10073531 | Ga0105237_100735313 | 260 |
| 91 | 3300009545 | Ga0105237_10107173 | Ga0105237_101071732 | 260 |
| 92 | 3300009545 | Ga0105237_10151999 | Ga0105237_101519992 | 260 |
| 93 | 3300009545 | Ga0105237_10984596 | Ga0105237_109845961 | 260 |
| 94 | 3300010375 | Ga0105239_10000095 | Ga0105239_1000009550 | 260 |
| 95 | 3300010375 | Ga0105239_10000327 | Ga0105239_100003273 | 260 |
| 96 | 3300010375 | Ga0105239_10004144 | Ga0105239_1000414416 | 260 |
| 97 | 3300010375 | Ga0105239_10006307 | Ga0105239_100063073 | 260 |
| 98 | 3300010375 | Ga0105239_10108288 | Ga0105239_101082881 | 260 |
| 99 | 3300013100 | Ga0157373_10000152 | Ga0157373_1000015213 | 260 |
| 100 | 3300013102 | Ga0157371_10000117 | Ga0157371_100001173 | 260 |
| 101 | 3300013102 | Ga0157371_10029645 | Ga0157371_100296452 | 260 |
| 102 | 3300013104 | Ga0157370_10001102 | Ga0157370_1000110220 | 260 |
| 103 | 3300013104 | Ga0157370_10022085 | Ga0157370_100220858 | 260 |
| 104 | 3300013104 | Ga0157370_10036289 | Ga0157370_100362895 | 260 |
| 105 | 3300013105 | Ga0157369_10064434 | Ga0157369_100644343 | 260 |
| 106 | 3300013105 | Ga0157369_10158513 | Ga0157369_101585133 | 260 |
| 107 | 3300013297 | Ga0157378_10052948 | Ga0157378_100529483 | 260 |
| 108 | 3300013306 | Ga0163162_10000012 | Ga0163162_10000012150 | 260 |
| 109 | 3300013306 | Ga0163162_10016065 | Ga0163162_100160653 | 260 |
| 110 | 3300013307 | Ga0157372_10004737 | Ga0157372_1000473714 | 260 |
| 111 | 3300015261 | Ga0182006_1000287 | Ga0182006_10002874 | 260 |
| 112 | 3300015262 | Ga0182007_10020652 | Ga0182007_100206522 | 260 |
| 113 | 3300017792 | Ga0163161_10000306 | Ga0163161_1000030617 | 260 |
| 114 | 3300017792 | Ga0163161_10020833 | Ga0163161_100208335 | 260 |
| 115 | 3300025233 | Ga0209437_100130 | Ga0209437_100130129 | 260 |
| 116 | 3300025261 | Ga0209233_1000466 | Ga0209233_100046623 | 260 |
| 117 | 3300025272 | Ga0209455_1000854 | Ga0209455_100085411 | 260 |
| 118 | 3300025292 | Ga0209676_1000039 | Ga0209676_1000039311 | 260 |
| 119 | 3300025298 | Ga0209050_1000033 | Ga0209050_1000033137 | 260 |
| 120 | 3300025904 | Ga0207647_10000103 | Ga0207647_1000010315 | 260 |
| 121 | 3300025909 | Ga0207705_10111340 | Ga0207705_101113402 | 260 |
| 122 | 3300025911 | Ga0207654_10071425 | Ga0207654_100714253 | 260 |
| 123 | 3300025911 | Ga0207654_10350169 | Ga0207654_103501692 | 260 |
| 124 | 3300025913 | Ga0207695_10015443 | Ga0207695_1001544310 | 260 |
| 125 | 3300025913 | Ga0207695_10113439 | Ga0207695_101134394 | 260 |
| 126 | 3300025914 | Ga0207671_10005006 | Ga0207671_100050069 | 260 |
| 127 | 3300025914 | Ga0207671_10007251 | Ga0207671_100072515 | 260 |
| 128 | 3300025914 | Ga0207671_10007981 | Ga0207671_100079816 | 260 |
| 129 | 3300025914 | Ga0207671_10086717 | Ga0207671_100867172 | 260 |
| 130 | 3300025919 | Ga0207657_10152323 | Ga0207657_101523232 | 260 |
| 131 | 3300025927 | Ga0207687_10127453 | Ga0207687_101274532 | 260 |
| 132 | 3300025932 | Ga0207690_10013035 | Ga0207690_100130353 | 260 |
| 133 | 3300025932 | Ga0207690_10032027 | Ga0207690_100320272 | 260 |
| 134 | 3300025949 | Ga0207667_10000457 | Ga0207667_1000045746 | 260 |
| 135 | 3300025949 | Ga0207667_10068214 | Ga0207667_100682143 | 260 |
| 136 | 3300025949 | Ga0207667_10155583 | Ga0207667_101555832 | 260 |
| 137 | 3300025981 | Ga0207640_10021566 | Ga0207640_100215661 | 260 |
| 138 | 3300026041 | Ga0207639_10015609 | Ga0207639_100156097 | 260 |
| 139 | 3300026041 | Ga0207639_10489552 | Ga0207639_104895522 | 260 |
| 140 | 3300026078 | Ga0207702_10004469 | Ga0207702_100044697 | 260 |
| 141 | 3300026116 | Ga0207674_10175948 | Ga0207674_101759482 | 260 |
| 142 | 3300028379 | Ga0268266_10000121 | Ga0268266_1000012118 | 260 |
| 143 | 3300028794 | Ga0307515_10000077 | Ga0307515_1000007759 | 260 |
| 144 | 3300028794 | Ga0307515_10007186 | Ga0307515_1000718612 | 260 |
| 145 | 3300028794 | Ga0307515_10064389 | Ga0307515_100643893 | 260 |
| 146 | 3300031507 | Ga0307509_10060583 | Ga0307509_100605831 | 260 |
| 147 | 3300033179 | Ga0307507_10002369 | Ga0307507_1000236919 | 260 |
| 148 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_228199_228981 | 260 |
| 149 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_184341_185123 | 260 |
| 150 | 3300037418 | Ga0395900_0004216 | Ga0395900_0004216_6001_6783 | 260 |
| 151 | 3300037418 | Ga0395900_0148954 | Ga0395900_0148954_949_1731 | 260 |
| 152 | 3300037466 | Ga0395898_0180594 | Ga0395898_0180594_635_1417 | 260 |
| 153 | 3300037471 | Ga0395905_0000347 | Ga0395905_0000347_52987_53847 | 260 |
| 154 | 3300038443 | Ga0395901_0002910 | Ga0395901_0002910_12104_12964 | 260 |
| 155 | 3300038443 | Ga0395901_0147914 | Ga0395901_0147914_15_797 | 260 |
| 156 | 3300046454 | Ga0495592_0204161 | Ga0495592_0204161_38_820 | 260 |
| 157 | 3300046460 | Ga0495638_0095527 | Ga0495638_0095527_652_1434 | 260 |
| 158 | 3300046462 | Ga0495651_0062632 | Ga0495651_0062632_1382_2164 | 260 |
| 159 | 3300046471 | Ga0495650_0000050 | Ga0495650_0000050_301317_302099 | 260 |
| 160 | 3300046471 | Ga0495650_0030667 | Ga0495650_0030667_1038_1820 | 260 |
| 161 | 3300046492 | Ga0495585_0000097 | Ga0495585_0000097_89248_90030 | 260 |
| 162 | 3300046506 | Ga0495583_0044380 | Ga0495583_0044380_370_1152 | 260 |
| 163 | 3300046507 | Ga0495606_0000036 | Ga0495606_0000036_49110_49919 | 260 |
| 164 | 3300046507 | Ga0495606_0008266 | Ga0495606_0008266_7061_7843 | 260 |
| 165 | 3300046507 | Ga0495606_0014319 | Ga0495606_0014319_134_916 | 260 |
| 166 | 3300046507 | Ga0495606_0126393 | Ga0495606_0126393_670_1452 | 260 |
| 167 | 3300046512 | Ga0495610_0005070 | Ga0495610_0005070_2593_3375 | 260 |
| 168 | 3300046513 | Ga0495616_0001383 | Ga0495616_0001383_11762_12544 | 260 |
| 169 | 3300046513 | Ga0495616_0002111 | Ga0495616_0002111_4655_5437 | 260 |
| 170 | 3300046520 | Ga0495637_0020372 | Ga0495637_0020372_1747_2529 | 260 |
| 171 | 3300046524 | Ga0495648_0059806 | Ga0495648_0059806_1292_2074 | 260 |
| 172 | 3300046538 | Ga0495609_0021112 | Ga0495609_0021112_1668_2450 | 260 |
| 173 | 3300046538 | Ga0495609_0086052 | Ga0495609_0086052_19_801 | 260 |
| 174 | 3300046558 | Ga0495633_0000004 | Ga0495633_0000004_39130_39912 | 260 |
| 175 | 3300046660 | Ga0495625_0000105 | Ga0495625_0000105_65552_66334 | 260 |
| 176 | 3300046660 | Ga0495625_0000641 | Ga0495625_0000641_1789_2571 | 260 |
| 177 | 3300046660 | Ga0495625_0100558 | Ga0495625_0100558_1089_1871 | 260 |
| 178 | 3300046665 | Ga0495661_0069661 | Ga0495661_0069661_475_1257 | 260 |
| 179 | 3300046692 | Ga0495671_0018260 | Ga0495671_0018260_1292_2074 | 260 |
| 180 | 3300046694 | Ga0495649_0000011 | Ga0495649_0000011_58607_59389 | 260 |
| 181 | 3300047323 | Ga0495683_0079196 | Ga0495683_0079196_802_1584 | 260 |
| 182 | 3300047443 | Ga0495687_001623 | Ga0495687_001623_3283_4065 | 260 |
| 183 | 3300047469 | Ga0495673_0010850 | Ga0495673_0010850_3189_3971 | 260 |
| 184 | 3300047472 | Ga0495686_0000341 | Ga0495686_0000341_41032_41814 | 260 |
| 185 | 3300047472 | Ga0495686_0020165 | Ga0495686_0020165_1894_2676 | 260 |
| 186 | 3300049459 | Ga0495678_006203 | Ga0495678_006203_2182_3045 | 260 |
| 187 | 3300049571 | Ga0501034_0007113 | Ga0501034_0007113_10442_11230 | 260 |
| 188 | 3300050493 | nmdc:mga0k408_3876_c1 | nmdc:mga0k408_3876_c1_350_1132 | 260 |
| 189 | 3300053080 | Ga0500635_0012440 | Ga0500635_0012440_392_1174 | 260 |
| 190 | 3300053122 | Ga0500608_000417 | Ga0500608_000417_4269_5051 | 260 |
| 191 | 3300053157 | Ga0500624_001227 | Ga0500624_001227_1892_2674 | 260 |
| 192 | iso_pu_bacteria | 2849281842 | 2849283171 | 260 |
| 193 | iso_pu_bacteria | 2945997725 | 2946003239 | 260 |
| 194 | 3300001915 | JGI24741J21665_1010754 | JGI24741J21665_10107542 | 261 |
| 195 | 3300003320 | rootH2_10236101 | rootH2_102361012 | 261 |
| 196 | 3300005455 | Ga0070663_100000447 | Ga0070663_10000044715 | 261 |
| 197 | 3300005563 | Ga0068855_100001431 | Ga0068855_10000143113 | 261 |
| 198 | 3300005614 | Ga0068856_100000108 | Ga0068856_10000010832 | 261 |
| 199 | 3300005614 | Ga0068856_100060532 | Ga0068856_1000605322 | 261 |
| 200 | 3300005614 | Ga0068856_100477679 | Ga0068856_1004776791 | 261 |
| 201 | 3300005616 | Ga0068852_100064985 | Ga0068852_1000649852 | 261 |
| 202 | 3300005842 | Ga0068858_100107579 | Ga0068858_1001075791 | 261 |
| 203 | 3300009545 | Ga0105237_10024437 | Ga0105237_100244374 | 261 |
| 204 | 3300009551 | Ga0105238_10021356 | Ga0105238_100213565 | 261 |
| 205 | 3300009551 | Ga0105238_10208643 | Ga0105238_102086431 | 261 |
| 206 | 3300010375 | Ga0105239_10000008 | Ga0105239_10000008337 | 261 |
| 207 | 3300010375 | Ga0105239_10000428 | Ga0105239_100004285 | 261 |
| 208 | 3300013102 | Ga0157371_10008927 | Ga0157371_100089274 | 261 |
| 209 | 3300013104 | Ga0157370_10157545 | Ga0157370_101575452 | 261 |
| 210 | 3300013105 | Ga0157369_10000101 | Ga0157369_1000010155 | 261 |
| 211 | 3300013306 | Ga0163162_10064932 | Ga0163162_100649323 | 261 |
| 212 | 3300013306 | Ga0163162_10375547 | Ga0163162_103755471 | 261 |
| 213 | 3300013307 | Ga0157372_10000041 | Ga0157372_1000004152 | 261 |
| 214 | 3300025250 | Ga0209026_1004800 | Ga0209026_10048003 | 261 |
| 215 | 3300025261 | Ga0209233_1038929 | Ga0209233_10389292 | 261 |
| 216 | 3300025911 | Ga0207654_10008233 | Ga0207654_100082335 | 261 |
| 217 | 3300025913 | Ga0207695_10000235 | Ga0207695_1000023584 | 261 |
| 218 | 3300025914 | Ga0207671_10003198 | Ga0207671_1000319812 | 261 |
| 219 | 3300025924 | Ga0207694_10020393 | Ga0207694_100203935 | 261 |
| 220 | 3300025949 | Ga0207667_10001338 | Ga0207667_1000133813 | 261 |
| 221 | 3300026067 | Ga0207678_10169954 | Ga0207678_101699542 | 261 |
| 222 | 3300026078 | Ga0207702_10000183 | Ga0207702_1000018325 | 261 |
| 223 | 3300026078 | Ga0207702_10046590 | Ga0207702_100465901 | 261 |
| 224 | 3300026078 | Ga0207702_10865563 | Ga0207702_108655631 | 261 |
| 225 | 3300026142 | Ga0207698_10384728 | Ga0207698_103847282 | 261 |
| 226 | 3300028800 | Ga0265338_10054341 | Ga0265338_100543412 | 261 |
| 227 | 3300031911 | Ga0307412_10097983 | Ga0307412_100979832 | 261 |
| 228 | 3300046523 | Ga0495644_0006793 | Ga0495644_0006793_1356_2141 | 261 |
| 229 | 3300046528 | Ga0495642_0079625 | Ga0495642_0079625_288_1073 | 261 |
| 230 | 3300046665 | Ga0495661_0167674 | Ga0495661_0167674_79_864 | 261 |
| 231 | 3300047445 | Ga0495677_0028388 | Ga0495677_0028388_40_825 | 261 |
| 232 | 3300047447 | Ga0495685_060652 | Ga0495685_060652_158_943 | 261 |
| 233 | 3300047470 | Ga0495681_0140927 | Ga0495681_0140927_172_957 | 261 |
| 234 | 3300047472 | Ga0495686_0001597 | Ga0495686_0001597_16016_16801 | 261 |
| 235 | 3300053080 | Ga0500635_0005036 | Ga0500635_0005036_922_1707 | 261 |
| 236 | 3300001904 | JGI24736J21556_1001996 | JGI24736J21556_10019963 | 262 |
| 237 | 3300002737 | JGI25162J39368_1001849 | JGI25162J39368_10018493 | 262 |
| 238 | 3300003214 | JGI25165J46597_1000305 | JGI25165J46597_10003056 | 262 |
| 239 | 3300003320 | rootH2_10055701 | rootH2_100557011 | 262 |
| 240 | 3300003323 | rootH1_10005288 | rootH1_1000528820 | 262 |
| 241 | 3300003323 | rootH1_10015911 | rootH1_100159113 | 262 |
| 242 | 3300003323 | rootH1_10107111 | rootH1_101071112 | 262 |
| 243 | 3300005339 | Ga0070660_100025877 | Ga0070660_1000258773 | 262 |
| 244 | 3300005457 | Ga0070662_100000468 | Ga0070662_10000046818 | 262 |
| 245 | 3300005614 | Ga0068856_100051537 | Ga0068856_1000515372 | 262 |
| 246 | 3300009093 | Ga0105240_10091089 | Ga0105240_100910892 | 262 |
| 247 | 3300009174 | Ga0105241_10007909 | Ga0105241_100079094 | 262 |
| 248 | 3300013100 | Ga0157373_10223726 | Ga0157373_102237262 | 262 |
| 249 | 3300013100 | Ga0157373_10251808 | Ga0157373_102518082 | 262 |
| 250 | 3300013104 | Ga0157370_10072938 | Ga0157370_100729383 | 262 |
| 251 | 3300013105 | Ga0157369_10021821 | Ga0157369_100218217 | 262 |
| 252 | 3300013296 | Ga0157374_10000741 | Ga0157374_1000074121 | 262 |
| 253 | 3300013307 | Ga0157372_10044745 | Ga0157372_100447456 | 262 |
| 254 | 3300013308 | Ga0157375_10022320 | Ga0157375_100223207 | 262 |
| 255 | 3300014745 | Ga0157377_10091154 | Ga0157377_100911542 | 262 |
| 256 | 3300025231 | Ga0207427_100423 | Ga0207427_10042320 | 262 |
| 257 | 3300025233 | Ga0209437_100026 | Ga0209437_100026370 | 262 |
| 258 | 3300025233 | Ga0209437_100026 | Ga0209437_10002658 | 262 |
| 259 | 3300025261 | Ga0209233_1000206 | Ga0209233_100020639 | 262 |
| 260 | 3300025904 | Ga0207647_10000049 | Ga0207647_1000004972 | 262 |
| 261 | 3300025911 | Ga0207654_10004708 | Ga0207654_100047082 | 262 |
| 262 | 3300025913 | Ga0207695_10007414 | Ga0207695_100074147 | 262 |
| 263 | 3300025919 | Ga0207657_10025398 | Ga0207657_100253983 | 262 |
| 264 | 3300025933 | Ga0207706_10000111 | Ga0207706_1000011171 | 262 |
| 265 | 3300025949 | Ga0207667_10622574 | Ga0207667_106225741 | 262 |
| 266 | 3300026035 | Ga0207703_10259323 | Ga0207703_102593232 | 262 |
| 267 | 3300044684 | Ga0466966_0021578 | Ga0466966_0021578_2443_3231 | 262 |
| 268 | 3300044693 | Ga0466961_0008211 | Ga0466961_0008211_1866_2654 | 262 |
| 269 | 3300045836 | Ga0466958_0047669 | Ga0466958_0047669_79_867 | 262 |
| 270 | 3300046538 | Ga0495609_0060834 | Ga0495609_0060834_185_976 | 262 |
| 271 | 3300053140 | Ga0500573_0129621 | Ga0500573_0129621_118_909 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3t55-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) | 0.9482 | 2 | 257 |
| 3t78-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate | 0.939 | 2 | 257 |
| 6y88-assembly8.cif.gz_H | igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp | 0.9366 | 2 | 257 |
| 2c3z-assembly1.cif.gz_A | crystal structure of a truncated variant of indole-3-glycerol phosphate synthase from sulfolobus solfataricus | 0.9352 | 38 | 256 |
| 3t55-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) | 0.934 | 2 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FS35_106_381_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9362 | 2 | 258 | 3.20.20.70 |
| 2c3zA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9352 | 38 | 256 | 3.20.20.70 |
| af_Q0JCI6_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9319 | 40 | 258 | 3.20.20.70 |
| 3o6yX00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9219 | 34 | 262 | 3.20.20.70 |
| af_P00909_2_259_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9211 | 2 | 262 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9P5G5-F1-model_v4 | deleted | 0.9972 | 1 | 260 |
|
| AF-A0A4V1SZQ2-F1-model_v4 | indole-3-glycerol-phosphate synthase (EC 4.1.1.48) | 0.9966 | 1 | 202 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-R9GVY5-F1-model_v4 | Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) | 0.9963 | 1 | 261 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-A0A4R1M0D6-F1-model_v4 | Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) | 0.9963 | 1 | 258 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
| AF-A0A519UT76-F1-model_v4 | Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) | 0.9956 | 1 | 260 |
GO:0000162
GO:0004425 GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar