F378006

General Info

Members Datasets Scaffolds Average Seq Length
271 215 226 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221682|2644461518
Length 247
Sequence VRGGTRWKRFALVMVPSVVATAAVGVGLAQGALAASFSVSGQSFKVRTDSLVGKDFVQYGSVAVGTDMKGEKAAHAVAVSGFSSATITNMCQSVVTPNLPFDLGSVTLRLEAGTNAKKPVEATNLYLDVAQLDADASFKNIDIGVAAGSLKNPNRPGSIGIQPGTQANANGFAQRAEEAVLTDVKQTAWATTAGTFKLSDLXAAAAQRYRRAVLLRHVTGWPECSPRAFGRPPLLLTAVPVPGSCFP

Samples

Sample ID Description Type Environment
1 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221578 Streptomyces sp. Root63 Isolate Unclassified
5 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
6 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
13 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
14 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
15 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
16 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
17 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
18 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
19 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
20 2867428634 Streptomyces sp. RP5T Isolate Unclassified
21 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
22 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
23 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
24 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
25 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
26 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
27 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
28 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
29 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
30 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
31 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
32 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
33 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
34 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
35 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
36 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
37 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
38 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
39 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
43 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
47 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
49 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
192 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
193 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
196 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
213 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
214 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
215 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.7
Metatranscriptomes 3.69
Isolates 16.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.28
Nodule 0.37
Rhizoplane 0
Rhizosphere 71.22
Stem 0
Stem Tuber 0
Unclassified 15.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10037661 3300001990 Bacteria 1490
2 JGI24735J21928_10092120 3300002067 Bacteria 869
3 JGI24738J21930_10015674 3300002075 Bacteria 1609
4 Ga0006765J45826_110881 3300003161 Bacteria 993
5 rootH1_10078165 3300003316 Bacteria 1816
6 rootH2_10176978 3300003320 Bacteria 1892
7 Ga0058858_1308971 3300004785 Bacteria 1181
8 Ga0058861_11883342 3300004800 Bacteria 974
9 Ga0058860_10000566 3300004801 Bacteria 1510
10 Ga0058862_12734089 3300004803 Bacteria 1102
11 Ga0070663_100372444 3300005455 Bacteria 1161
12 Ga0070678_100570022 3300005456 Bacteria 1007
13 Ga0068853_100038860 3300005539 Bacteria 4056
14 Ga0068854_100474778 3300005578 Bacteria 1049
15 Ga0075368_10011359 3300006042 Bacteria 3239
16 Ga0075363_100005264 3300006048 Bacteria 5738
17 Ga0075367_10056204 3300006178 Bacteria 2338
18 Ga0075370_10039298 3300006353 Bacteria 2665
19 Ga0099826_10053707 3300006948 Bacteria 2680
20 Ga0105244_10042012 3300009036 Bacteria 2367
21 Ga0105245_10218490 3300009098 Bacteria 1838
22 Ga0105239_10516064 3300010375 Bacteria 1359
23 Ga0105239_10709848 3300010375 Bacteria 1150
24 Ga0105246_10000350 3300011119 Bacteria 24717
25 Ga0105246_10237109 3300011119 Bacteria 1440
26 Ga0157369_10351087 3300013105 Bacteria 1532
27 Ga0157376_10202888 3300014969 Bacteria 1826
28 Ga0206355_1711629 3300020076 Bacteria 1023
29 Ga0206350_10557187 3300020080 Bacteria 1015
30 Ga0206353_10343159 3300020082 Bacteria 1369
31 Ga0213875_10042132 3300021388 Bacteria 2146
32 Ga0207426_1001554 3300025302 Bacteria 18646
33 Ga0207426_1004931 3300025302 Bacteria 6294
34 Ga0207426_1008468 3300025302 Bacteria 4149
35 Ga0207655_1053915 3300025728 Bacteria 1603
36 Ga0207687_10166910 3300025927 Bacteria 1694
37 Ga0207640_10380374 3300025981 Bacteria 1144
38 Ga0207639_10058131 3300026041 Bacteria 2973
39 Ga0209371_1009445 3300027312 Bacteria 3100
40 Ga0209371_1062787 3300027312 Bacteria 678
41 Ga0209813_10013715 3300027866 Bacteria 2168
42 Ga0307517_10011101 3300028786 Bacteria 12508
43 Ga0307515_10000813 3300028794 Bacteria 71821
44 Ga0310981_1011389 3300029285 Bacteria 1052
45 Ga0268256_1007533 3300030500 Bacteria 3860
46 Ga0268256_1070047 3300030500 Bacteria 678
47 Ga0307511_10159373 3300030521 Bacteria 1271
48 Ga0307508_10002289 3300031616 Bacteria 20350
49 Ga0307508_10015197 3300031616 Bacteria 7016
50 Ga0307508_10030613 3300031616 Bacteria 4864
51 Ga0307514_10183154 3300031649 Bacteria 1347
52 Ga0307518_10232009 3300031838 Bacteria 1193
53 Ga0307416_100437209 3300032002 Bacteria 1357
54 Ga0307416_100452956 3300032002 Bacteria 1336
55 Ga0307510_10024559 3300033180 Bacteria 6962
56 Ga0436364_0241510 3300037853 Bacteria 4612
57 Ga0451849_0050952 3300041505 Bacteria 1498
58 Ga0451853_1990182 3300041512 Bacteria 4803
59 Ga0439449_0005594 3300042007 Bacteria 4808
60 Ga0450894_000089 3300042131 Bacteria 15201
61 Ga0466961_0096694 3300044693 Bacteria 1862
62 Ga0466960_0395972 3300044901 Bacteria 795
63 Ga0466967_0739959 3300045976 Bacteria 975
64 Ga0495592_0018656 3300046454 Bacteria 5280
65 Ga0495629_0036634 3300046459 Bacteria 3461
66 Ga0495629_0044414 3300046459 Bacteria 3119
67 Ga0495629_0135898 3300046459 Bacteria 1711
68 Ga0495638_0029238 3300046460 Bacteria 3554
69 Ga0495651_0105628 3300046462 Bacteria 2088
70 Ga0495653_0005718 3300046463 Bacteria 10163
71 Ga0495580_0001943 3300046472 Bacteria 18146
72 Ga0495662_0001290 3300046476 Bacteria 12399
73 Ga0495664_0015933 3300046477 Bacteria 4278
74 Ga0495594_0070328 3300046499 Bacteria 1945
75 Ga0495583_0017375 3300046506 Bacteria 3822
76 Ga0495608_0012064 3300046511 Bacteria 6006
77 Ga0495618_0050377 3300046514 Bacteria 2630
78 Ga0495628_0010642 3300046516 Bacteria 7798
79 Ga0495630_0063082 3300046517 Bacteria 2783
80 Ga0495632_0037880 3300046519 Bacteria 2444
81 Ga0495643_0000753 3300046522 Bacteria 36653
82 Ga0495643_0062874 3300046522 Bacteria 1964
83 Ga0495648_0148501 3300046524 Bacteria 1225
84 Ga0495666_0001871 3300046526 Bacteria 10385
85 Ga0495652_0065985 3300046529 Bacteria 3039
86 Ga0495665_0096300 3300046531 Bacteria 1554
87 Ga0495640_0006460 3300046533 Bacteria 9270
88 Ga0495587_0101050 3300046536 Bacteria 1661
89 Ga0495597_0025259 3300046542 Bacteria 2736
90 Ga0495645_0011346 3300046543 Bacteria 6267
91 Ga0495622_0209541 3300046557 Bacteria 866
92 Ga0495633_0022161 3300046558 Bacteria 3166
93 Ga0495634_0056154 3300046642 Bacteria 2631
94 Ga0495625_0006031 3300046660 Bacteria 10886
95 Ga0495625_0036795 3300046660 Bacteria 3595
96 Ga0495625_0149177 3300046660 Bacteria 1573
97 Ga0495635_0076359 3300046663 Bacteria 2296
98 Ga0495635_0120497 3300046663 Bacteria 1789
99 Ga0495588_0000886 3300046674 Bacteria 13206
100 Ga0495657_0016662 3300046675 Bacteria 5348
101 Ga0495657_0026001 3300046675 Bacteria 4151
102 Ga0495599_0019496 3300046678 Bacteria 4227
103 Ga0495623_0259322 3300046679 Bacteria 974
104 Ga0495646_0025507 3300046680 Bacteria 3717
105 Ga0495658_0332853 3300046683 Bacteria 963
106 Ga0495613_0007798 3300046689 Bacteria 7967
107 Ga0495613_0026351 3300046689 Bacteria 4331
108 Ga0495613_0311091 3300046689 Bacteria 1089
109 Ga0495624_0190721 3300046690 Bacteria 1247
110 Ga0495670_0007077 3300046691 Bacteria 5523
111 Ga0495671_0221146 3300046692 Bacteria 916
112 Ga0495649_0159264 3300046694 Bacteria 1184
113 Ga0495589_0082031 3300046794 Bacteria 1568
114 Ga0495589_0375175 3300046794 Bacteria 654
115 Ga0495600_0009053 3300046809 Bacteria 6137
116 Ga0495660_0025626 3300046810 Bacteria 3348
117 Ga0495660_0090509 3300046810 Bacteria 1591
118 Ga0495581_0049073 3300047315 Bacteria 2437
119 Ga0495604_0000228 3300047317 Bacteria 50550
120 Ga0495604_0055693 3300047317 Bacteria 3047
121 Ga0495674_0188791 3300047319 Bacteria 1713
122 Ga0495676_0004087 3300047321 Bacteria 13294
123 Ga0495680_0015310 3300047322 Bacteria 6617
124 Ga0495683_0335403 3300047323 Bacteria 641
125 Ga0495687_016537 3300047443 Bacteria 3708
126 Ga0495687_019836 3300047443 Bacteria 3289
127 Ga0495675_0163147 3300047444 Bacteria 1371
128 Ga0495685_004217 3300047447 Bacteria 4630
129 Ga0495685_020500 3300047447 Bacteria 2272
130 Ga0495681_0001930 3300047470 Bacteria 15188
131 Ga0495681_0004712 3300047470 Bacteria 9246
132 Ga0495684_0033100 3300047471 Bacteria 3968
133 Ga0495593_0374185 3300047673 Bacteria 712
134 Ga0495602_0071806 3300048088 Bacteria 2954
135 Ga0495614_0002685 3300048089 Bacteria 7909
136 Ga0495626_0135124 3300048091 Bacteria 1050
137 Ga0501031_0007853 3300049568 Bacteria 6944
138 Ga0501031_0017045 3300049568 Bacteria 4718
139 Ga0501031_0684046 3300049568 Bacteria 659
140 Ga0501032_0013727 3300049569 Bacteria 5749
141 Ga0501032_0060865 3300049569 Bacteria 2532
142 Ga0501033_0031233 3300049570 Bacteria 4003
143 Ga0501033_0065198 3300049570 Bacteria 2679
144 Ga0501034_0013110 3300049571 Bacteria 8541
145 Ga0501034_0086526 3300049571 Bacteria 3135
146 Ga0501034_1051582 3300049571 Bacteria 696
147 Ga0501036_0047829 3300049572 Bacteria 3621
148 Ga0501036_0096106 3300049572 Bacteria 2504
149 Ga0501036_0593481 3300049572 Bacteria 919
150 Ga0501036_0882590 3300049572 Bacteria 734
151 Ga0501037_0000724 3300049573 Bacteria 24999
152 Ga0501037_0046849 3300049573 Bacteria 3170
153 Ga0501037_0481752 3300049573 Bacteria 843
154 Ga0501038_0015400 3300049574 Bacteria 6951
155 Ga0501038_0091635 3300049574 Bacteria 2546
156 Ga0501038_0144145 3300049574 Bacteria 1946
157 Ga0501039_0019753 3300049575 Bacteria 5165
158 Ga0501040_0018934 3300049576 Bacteria 4575
159 Ga0501042_0012277 3300049578 Bacteria 5798
160 Ga0501042_0055252 3300049578 Bacteria 2833
161 Ga0501043_0003026 3300049579 Bacteria 13974
162 Ga0501043_0060746 3300049579 Bacteria 2967
163 Ga0501046_0019327 3300049580 Bacteria 5652
164 Ga0501047_0000029 3300049581 Bacteria 218396
165 Ga0501047_0018385 3300049581 Bacteria 6700
166 Ga0501047_0095684 3300049581 Bacteria 2848
167 Ga0501048_0010502 3300049582 Bacteria 6910
168 Ga0501067_0000704 3300049583 Bacteria 18014
169 Ga0501068_0064003 3300049584 Bacteria 2237
170 Ga0501069_0042846 3300049585 Bacteria 2504
171 Ga0501070_0126509 3300049586 Bacteria 2111
172 Ga0501071_0000263 3300049587 Bacteria 24706
173 Ga0501072_0001739 3300049588 Bacteria 16215
174 Ga0501073_0020859 3300049589 Bacteria 4725
175 Ga0501074_0004802 3300049590 Bacteria 9690
176 Ga0501076_0063764 3300049592 Bacteria 2936
177 Ga0501077_0025324 3300049593 Bacteria 3769
178 Ga0501079_0001215 3300049741 Bacteria 18040
179 Ga0501080_0045170 3300049742 Bacteria 4100
180 Ga0501083_0000333 3300049744 Bacteria 29934
181 Ga0501035_0017071 3300049822 Bacteria 6687
182 Ga0501035_0020500 3300049822 Bacteria 6072
183 Ga0501035_0059675 3300049822 Bacteria 3397
184 Ga0501035_0339994 3300049822 Bacteria 1258
185 Ga0501035_0382491 3300049822 Bacteria 1173
186 Ga0501044_0004873 3300049823 Bacteria 14996
187 Ga0501044_0063467 3300049823 Bacteria 3773
188 Ga0501044_0091550 3300049823 Bacteria 3067
189 Ga0501044_0110081 3300049823 Bacteria 2763
190 Ga0501044_0122010 3300049823 Bacteria 2606
191 Ga0501044_0931879 3300049823 Bacteria 742
192 Ga0501045_0030247 3300049824 Bacteria 3918
193 nmdc:mga03n38_422014_c1 3300050490 Bacteria 738
194 nmdc:mga06z11_5553_c1 3300050494 Bacteria 5070
195 nmdc:mga04h51_18293_c1 3300050495 Bacteria 2062
196 Ga0495601_0032989 3300053077 Bacteria 3225
197 Ga0495619_0135553 3300053085 Bacteria 1693
198 Ga0500578_0034219 3300053086 Bacteria 3264
199 Ga0500643_038245 3300053087 Bacteria 1424
200 Ga0500566_0130445 3300053094 Bacteria 1345
201 Ga0500641_0110540 3300053096 Bacteria 1183
202 Ga0500654_019756 3300053099 Bacteria 4334
203 Ga0500553_116745 3300053101 Bacteria 1109
204 Ga0500560_000951 3300053107 Bacteria 4604
205 Ga0500560_098607 3300053107 Bacteria 978
206 Ga0500569_001823 3300053109 Bacteria 4087
207 Ga0500628_003620 3300053129 Bacteria 2552
208 Ga0500652_000893 3300053131 Bacteria 9834
209 Ga0500658_0063050 3300053134 Bacteria 1546
210 Ga0500573_0027537 3300053140 Bacteria 3269
211 Ga0500573_0060020 3300053140 Bacteria 2179
212 Ga0500577_0076439 3300053142 Bacteria 1326
213 Ga0500579_044484 3300053143 Bacteria 2766
214 Ga0500586_106136 3300053145 Bacteria 983
215 Ga0500588_0017265 3300053146 Bacteria 1881
216 Ga0500600_0008625 3300053149 Bacteria 6141
217 Ga0500600_0066119 3300053149 Bacteria 1998
218 Ga0500600_0089243 3300053149 Bacteria 1649
219 Ga0500616_0038032 3300053153 Bacteria 2601
220 Ga0500633_0001365 3300053160 Bacteria 4550
221 Ga0500634_0004019 3300053161 Bacteria 6700
222 Ga0500656_000799 3300053732 Bacteria 2495
223 Ga0501084_0005179 3300054114 Bacteria 10664
224 Ga0587106_010704 3300059605 Bacteria 1195
225 Ga0501082_0004945 3300060353 Bacteria 11629
226 Ga0530510_0602592 3300061734 Bacteria 835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0036634 Ga0495629_0036634_1499_2074 148
2 3300046683 Ga0495658_0332853 Ga0495658_0332853_42_617 148
3 3300053094 Ga0500566_0130445 Ga0500566_0130445_453_1028 148
4 3300053101 Ga0500553_116745 Ga0500553_116745_223_798 148
5 3300053145 Ga0500586_106136 Ga0500586_106136_398_973 148
6 3300046794 Ga0495589_0375175 Ga0495589_0375175_22_597 152
7 3300047443 Ga0495687_019836 Ga0495687_019836_1892_2467 152
8 3300048091 Ga0495626_0135124 Ga0495626_0135124_22_597 152
9 3300053096 Ga0500641_0110540 Ga0500641_0110540_79_654 152
10 3300053129 Ga0500628_003620 Ga0500628_003620_1919_2494 152
11 3300053146 Ga0500588_0017265 Ga0500588_0017265_1212_1787 152
12 3300047323 Ga0495683_0335403 Ga0495683_0335403_10_534 165
13 3300028786 Ga0307517_10011101 Ga0307517_100111017 168
14 3300031616 Ga0307508_10015197 Ga0307508_100151972 168
15 3300046460 Ga0495638_0029238 Ga0495638_0029238_2197_2850 168
16 3300046499 Ga0495594_0070328 Ga0495594_0070328_732_1385 168
17 3300046519 Ga0495632_0037880 Ga0495632_0037880_1710_2363 168
18 3300046522 Ga0495643_0062874 Ga0495643_0062874_130_783 168
19 3300046542 Ga0495597_0025259 Ga0495597_0025259_469_1122 168
20 3300046558 Ga0495633_0022161 Ga0495633_0022161_1707_2360 168
21 3300046691 Ga0495670_0007077 Ga0495670_0007077_1046_1699 168
22 3300046810 Ga0495660_0025626 Ga0495660_0025626_1449_2102 168
23 3300047447 Ga0495685_004217 Ga0495685_004217_3939_4592 168
24 3300047470 Ga0495681_0004712 Ga0495681_0004712_3579_4232 168
25 3300053086 Ga0500578_0034219 Ga0500578_0034219_1040_1693 168
26 3300053087 Ga0500643_038245 Ga0500643_038245_732_1385 168
27 3300053099 Ga0500654_019756 Ga0500654_019756_1469_2122 168
28 3300053109 Ga0500569_001823 Ga0500569_001823_1583_2236 168
29 3300053131 Ga0500652_000893 Ga0500652_000893_8000_8653 168
30 3300053134 Ga0500658_0063050 Ga0500658_0063050_624_1277 168
31 3300053142 Ga0500577_0076439 Ga0500577_0076439_230_883 168
32 3300053143 Ga0500579_044484 Ga0500579_044484_795_1448 168
33 3300053149 Ga0500600_0008625 Ga0500600_0008625_1572_2225 168
34 3300053153 Ga0500616_0038032 Ga0500616_0038032_1235_1888 168
35 3300053160 Ga0500633_0001365 Ga0500633_0001365_1362_2015 168
36 3300053161 Ga0500634_0004019 Ga0500634_0004019_1571_2224 168
37 3300053732 Ga0500656_000799 Ga0500656_000799_1362_2015 168
38 3300010375 Ga0105239_10516064 Ga0105239_105160641 171
39 3300011119 Ga0105246_10237109 Ga0105246_102371092 172
40 3300049572 Ga0501036_0593481 Ga0501036_0593481_194_772 172
41 3300049822 Ga0501035_0059675 Ga0501035_0059675_2012_2590 172
42 3300049823 Ga0501044_0110081 Ga0501044_0110081_2050_2628 172
43 3300050490 nmdc:mga03n38_422014_c1 nmdc:mga03n38_422014_c1_132_722 172
44 iso_pu_bacteria 2867428634 2867429421 173
45 3300044901 Ga0466960_0395972 Ga0466960_0395972_50_631 175
46 3300014969 Ga0157376_10202888 Ga0157376_102028882 176
47 3300046459 Ga0495629_0135898 Ga0495629_0135898_1121_1693 176
48 3300046511 Ga0495608_0012064 Ga0495608_0012064_816_1424 176
49 3300046531 Ga0495665_0096300 Ga0495665_0096300_482_1090 176
50 3300046675 Ga0495657_0016662 Ga0495657_0016662_462_1070 176
51 3300046689 Ga0495613_0026351 Ga0495613_0026351_3079_3687 176
52 3300046689 Ga0495613_0311091 Ga0495613_0311091_156_746 176
53 3300049568 Ga0501031_0684046 Ga0501031_0684046_47_619 176
54 3300049571 Ga0501034_0086526 Ga0501034_0086526_2524_3096 176
55 3300049572 Ga0501036_0882590 Ga0501036_0882590_146_718 176
56 3300049573 Ga0501037_0481752 Ga0501037_0481752_186_758 176
57 3300049574 Ga0501038_0091635 Ga0501038_0091635_86_658 176
58 3300049822 Ga0501035_0020500 Ga0501035_0020500_5408_5980 176
59 3300049823 Ga0501044_0063467 Ga0501044_0063467_3109_3681 176
60 3300042007 Ga0439449_0005594 Ga0439449_0005594_1529_2122 177
61 3300045976 Ga0466967_0739959 Ga0466967_0739959_375_953 177
62 3300046459 Ga0495629_0044414 Ga0495629_0044414_2105_2704 177
63 3300046557 Ga0495622_0209541 Ga0495622_0209541_239_841 177
64 3300046660 Ga0495625_0006031 Ga0495625_0006031_2616_3215 177
65 3300046674 Ga0495588_0000886 Ga0495588_0000886_6932_7531 177
66 3300046692 Ga0495671_0221146 Ga0495671_0221146_54_653 177
67 3300047470 Ga0495681_0001930 Ga0495681_0001930_2050_2649 177
68 3300048089 Ga0495614_0002685 Ga0495614_0002685_2211_2810 177
69 3300049573 Ga0501037_0046849 Ga0501037_0046849_563_1159 177
70 3300049578 Ga0501042_0055252 Ga0501042_0055252_102_698 177
71 3300049581 Ga0501047_0000029 Ga0501047_0000029_192816_193412 177
72 3300049823 Ga0501044_0931879 Ga0501044_0931879_124_720 177
73 3300053107 Ga0500560_000951 Ga0500560_000951_871_1470 177
74 3300053107 Ga0500560_098607 Ga0500560_098607_124_750 183
75 3300053140 Ga0500573_0027537 Ga0500573_0027537_2601_3227 183
76 iso_pu_bacteria 2643221601 2644017722 184
77 iso_pu_bacteria 2643221631 2644173319 184
78 3300005455 Ga0070663_100372444 Ga0070663_1003724442 185
79 3300005456 Ga0070678_100570022 Ga0070678_1005700222 185
80 3300005539 Ga0068853_100038860 Ga0068853_1000388602 185
81 3300005578 Ga0068854_100474778 Ga0068854_1004747781 185
82 3300025981 Ga0207640_10380374 Ga0207640_103803742 185
83 3300026041 Ga0207639_10058131 Ga0207639_100581311 185
84 3300003316 rootH1_10078165 rootH1_100781651 186
85 3300003320 rootH2_10176978 rootH2_101769783 186
86 3300006353 Ga0075370_10039298 Ga0075370_100392982 186
87 3300027312 Ga0209371_1009445 Ga0209371_10094453 186
88 3300030500 Ga0268256_1007533 Ga0268256_10075333 186
89 3300046660 Ga0495625_0036795 Ga0495625_0036795_1346_1990 186
90 3300047447 Ga0495685_020500 Ga0495685_020500_380_1024 186
91 3300053149 Ga0500600_0066119 Ga0500600_0066119_1170_1814 186
92 iso_pu_bacteria 2862705112 2862705604 187
93 iso_pu_bacteria 2912757875 2912762786 187
94 iso_pu_bacteria 2990044586 2990047350 187
95 iso_pu_bacteria 8008485437 8008491568 187
96 iso_pu_bacteria 8025524527 8025524624 187
97 iso_pu_bacteria 8025530807 8025536244 187
98 3300004800 Ga0058861_11883342 Ga0058861_118833421 188
99 3300004803 Ga0058862_12734089 Ga0058862_127340892 188
100 3300049568 Ga0501031_0017045 Ga0501031_0017045_536_1165 188
101 3300049823 Ga0501044_0122010 Ga0501044_0122010_363_992 188
102 iso_pu_bacteria 2862290372 2862293528 188
103 iso_pu_bacteria 2912723979 2912730128 188
104 iso_pu_bacteria 2818991463 2819694595 189
105 iso_pu_bacteria 2875391855 2875396733 189
106 iso_pu_bacteria 2997451912 2997452904 189
107 iso_pu_bacteria 8033684223 8033689163 189
108 iso_pu_bacteria 2616644941 2616903277 190
109 iso_pu_bacteria 2643221548 2643764050 190
110 iso_pu_bacteria 2643221578 2643902227 190
111 iso_pu_bacteria 2643221587 2643943948 190
112 iso_pu_bacteria 2643221647 2644264921 190
113 iso_pu_bacteria 2643221647 2644265774 190
114 iso_pu_bacteria 2643221673 2644406618 190
115 iso_pu_bacteria 2643221677 2644434685 190
116 iso_pu_bacteria 2643221682 2644461518 190
117 iso_pu_bacteria 2802429296 2804847943 190
118 iso_pu_bacteria 2811994917 2812478721 190
119 iso_pu_bacteria 2852635781 2852641051 190
120 iso_pu_bacteria 2863404153 2863408649 190
121 iso_pu_bacteria 2877676314 2877679070 190
122 iso_pu_bacteria 2877676314 2877680401 190
123 iso_pu_bacteria 2946045630 2946047824 190
124 iso_pu_bacteria 2947224130 2947226915 190
125 iso_pu_bacteria 2954711539 2954714282 190
126 iso_pu_bacteria 2954721474 2954724231 190
127 iso_pu_bacteria 2954731030 2954737608 190
128 iso_pu_bacteria 2954740390 2954743128 190
129 iso_pu_bacteria 2954749733 2954756442 190
130 iso_pu_bacteria 2954759201 2954762086 190
131 iso_pu_bacteria 2990059506 2990062976 190
132 iso_pu_bacteria 2997600082 2997606077 190
133 iso_pu_bacteria 3006393351 3006398621 190
134 3300032002 Ga0307416_100437209 Ga0307416_1004372091 191
135 iso_pu_bacteria 2582581313 2585309088 191
136 iso_pu_bacteria 2784746768 2785371535 191
137 iso_pu_bacteria 2954691527 2954694772 191
138 iso_pu_bacteria 2954701450 2954709976 191
139 3300003161 Ga0006765J45826_110881 Ga0006765J45826_1108812 192
140 3300020080 Ga0206350_10557187 Ga0206350_105571871 192
141 3300032002 Ga0307416_100452956 Ga0307416_1004529561 192
142 3300046454 Ga0495592_0018656 Ga0495592_0018656_482_1138 192
143 3300046462 Ga0495651_0105628 Ga0495651_0105628_996_1652 192
144 3300046463 Ga0495653_0005718 Ga0495653_0005718_6900_7556 192
145 3300046472 Ga0495580_0001943 Ga0495580_0001943_5835_6491 192
146 3300046476 Ga0495662_0001290 Ga0495662_0001290_7009_7665 192
147 3300046477 Ga0495664_0015933 Ga0495664_0015933_2602_3258 192
148 3300046516 Ga0495628_0010642 Ga0495628_0010642_5041_5697 192
149 3300046517 Ga0495630_0063082 Ga0495630_0063082_1124_1780 192
150 3300046526 Ga0495666_0001871 Ga0495666_0001871_6099_6755 192
151 3300046529 Ga0495652_0065985 Ga0495652_0065985_1088_1744 192
152 3300046533 Ga0495640_0006460 Ga0495640_0006460_4357_5013 192
153 3300046536 Ga0495587_0101050 Ga0495587_0101050_944_1600 192
154 3300046543 Ga0495645_0011346 Ga0495645_0011346_4314_4970 192
155 3300046642 Ga0495634_0056154 Ga0495634_0056154_1914_2570 192
156 3300046663 Ga0495635_0120497 Ga0495635_0120497_414_1070 192
157 3300046678 Ga0495599_0019496 Ga0495599_0019496_2441_3097 192
158 3300046680 Ga0495646_0025507 Ga0495646_0025507_1061_1717 192
159 3300046690 Ga0495624_0190721 Ga0495624_0190721_494_1150 192
160 3300046809 Ga0495600_0009053 Ga0495600_0009053_1124_1780 192
161 3300047315 Ga0495581_0049073 Ga0495581_0049073_1059_1715 192
162 3300047317 Ga0495604_0000228 Ga0495604_0000228_47588_48244 192
163 3300047319 Ga0495674_0188791 Ga0495674_0188791_576_1232 192
164 3300047471 Ga0495684_0033100 Ga0495684_0033100_720_1376 192
165 3300048088 Ga0495602_0071806 Ga0495602_0071806_1278_1934 192
166 3300049568 Ga0501031_0007853 Ga0501031_0007853_1009_1629 192
167 3300049569 Ga0501032_0013727 Ga0501032_0013727_1771_2391 192
168 3300049570 Ga0501033_0065198 Ga0501033_0065198_1139_1759 192
169 3300049571 Ga0501034_0013110 Ga0501034_0013110_2665_3285 192
170 3300049572 Ga0501036_0096106 Ga0501036_0096106_1009_1629 192
171 3300049573 Ga0501037_0000724 Ga0501037_0000724_12086_12706 192
172 3300049574 Ga0501038_0015400 Ga0501038_0015400_5059_5679 192
173 3300049575 Ga0501039_0019753 Ga0501039_0019753_3799_4419 192
174 3300049576 Ga0501040_0018934 Ga0501040_0018934_747_1367 192
175 3300049578 Ga0501042_0012277 Ga0501042_0012277_1484_2104 192
176 3300049579 Ga0501043_0003026 Ga0501043_0003026_8237_8857 192
177 3300049580 Ga0501046_0019327 Ga0501046_0019327_1009_1629 192
178 3300049581 Ga0501047_0018385 Ga0501047_0018385_5072_5692 192
179 3300049582 Ga0501048_0010502 Ga0501048_0010502_1136_1756 192
180 3300049583 Ga0501067_0000704 Ga0501067_0000704_11658_12278 192
181 3300049584 Ga0501068_0064003 Ga0501068_0064003_793_1413 192
182 3300049585 Ga0501069_0042846 Ga0501069_0042846_876_1496 192
183 3300049586 Ga0501070_0126509 Ga0501070_0126509_1009_1629 192
184 3300049587 Ga0501071_0000263 Ga0501071_0000263_11675_12295 192
185 3300049588 Ga0501072_0001739 Ga0501072_0001739_10789_11409 192
186 3300049589 Ga0501073_0020859 Ga0501073_0020859_3359_3979 192
187 3300049590 Ga0501074_0004802 Ga0501074_0004802_461_1081 192
188 3300049592 Ga0501076_0063764 Ga0501076_0063764_2286_2906 192
189 3300049593 Ga0501077_0025324 Ga0501077_0025324_2573_3193 192
190 3300049741 Ga0501079_0001215 Ga0501079_0001215_3487_4107 192
191 3300049742 Ga0501080_0045170 Ga0501080_0045170_461_1081 192
192 3300049744 Ga0501083_0000333 Ga0501083_0000333_5256_5876 192
193 3300049822 Ga0501035_0017071 Ga0501035_0017071_5059_5679 192
194 3300049823 Ga0501044_0004873 Ga0501044_0004873_9259_9879 192
195 3300049824 Ga0501045_0030247 Ga0501045_0030247_2138_2758 192
196 3300053077 Ga0495601_0032989 Ga0495601_0032989_2086_2742 192
197 3300053085 Ga0495619_0135553 Ga0495619_0135553_264_920 192
198 3300053140 Ga0500573_0060020 Ga0500573_0060020_272_928 192
199 3300054114 Ga0501084_0005179 Ga0501084_0005179_1058_1678 192
200 3300059605 Ga0587106_010704 Ga0587106_010704_145_861 192
201 3300060353 Ga0501082_0004945 Ga0501082_0004945_685_1305 192
202 3300061734 Ga0530510_0602592 Ga0530510_0602592_40_660 192
203 3300004785 Ga0058858_1308971 Ga0058858_13089712 193
204 3300004801 Ga0058860_10000566 Ga0058860_100005662 193
205 3300006048 Ga0075363_100005264 Ga0075363_1000052644 193
206 3300020076 Ga0206355_1711629 Ga0206355_17116291 193
207 3300020082 Ga0206353_10343159 Ga0206353_103431592 193
208 3300021388 Ga0213875_10042132 Ga0213875_100421322 193
209 3300025302 Ga0207426_1001554 Ga0207426_100155420 193
210 3300025302 Ga0207426_1004931 Ga0207426_10049314 193
211 3300025302 Ga0207426_1008468 Ga0207426_10084684 193
212 3300027312 Ga0209371_1062787 Ga0209371_10627871 193
213 3300028794 Ga0307515_10000813 Ga0307515_1000081319 193
214 3300029285 Ga0310981_1011389 Ga0310981_10113891 193
215 3300030500 Ga0268256_1070047 Ga0268256_10700471 193
216 3300030521 Ga0307511_10159373 Ga0307511_101593731 193
217 3300031616 Ga0307508_10002289 Ga0307508_100022894 193
218 3300031616 Ga0307508_10030613 Ga0307508_100306132 193
219 3300031649 Ga0307514_10183154 Ga0307514_101831542 193
220 3300031838 Ga0307518_10232009 Ga0307518_102320092 193
221 3300033180 Ga0307510_10024559 Ga0307510_100245595 193
222 3300037853 Ga0436364_0241510 Ga0436364_0241510_2853_3473 193
223 3300042131 Ga0450894_000089 Ga0450894_000089_4012_4647 193
224 3300044693 Ga0466961_0096694 Ga0466961_0096694_272_916 193
225 3300046679 Ga0495623_0259322 Ga0495623_0259322_25_684 193
226 3300047317 Ga0495604_0055693 Ga0495604_0055693_485_1144 193
227 3300047444 Ga0495675_0163147 Ga0495675_0163147_400_1059 193
228 3300049569 Ga0501032_0060865 Ga0501032_0060865_1865_2491 193
229 3300049570 Ga0501033_0031233 Ga0501033_0031233_694_1320 193
230 3300049571 Ga0501034_1051582 Ga0501034_1051582_44_670 193
231 3300049572 Ga0501036_0047829 Ga0501036_0047829_17_643 193
232 3300049574 Ga0501038_0144145 Ga0501038_0144145_633_1259 193
233 3300049579 Ga0501043_0060746 Ga0501043_0060746_2007_2633 193
234 3300049581 Ga0501047_0095684 Ga0501047_0095684_335_961 193
235 3300049822 Ga0501035_0339994 Ga0501035_0339994_171_818 193
236 3300049822 Ga0501035_0382491 Ga0501035_0382491_42_668 193
237 3300049823 Ga0501044_0091550 Ga0501044_0091550_2400_3026 193
238 3300001990 JGI24737J22298_10037661 JGI24737J22298_100376611 194
239 3300002067 JGI24735J21928_10092120 JGI24735J21928_100921201 194
240 3300002075 JGI24738J21930_10015674 JGI24738J21930_100156742 194
241 3300006042 Ga0075368_10011359 Ga0075368_100113595 194
242 3300006178 Ga0075367_10056204 Ga0075367_100562043 194
243 3300006948 Ga0099826_10053707 Ga0099826_100537073 194
244 3300009036 Ga0105244_10042012 Ga0105244_100420123 194
245 3300009098 Ga0105245_10218490 Ga0105245_102184902 194
246 3300010375 Ga0105239_10709848 Ga0105239_107098481 194
247 3300011119 Ga0105246_10000350 Ga0105246_1000035022 194
248 3300013105 Ga0157369_10351087 Ga0157369_103510872 194
249 3300025728 Ga0207655_1053915 Ga0207655_10539152 194
250 3300025927 Ga0207687_10166910 Ga0207687_101669102 194
251 3300027866 Ga0209813_10013715 Ga0209813_100137152 194
252 3300041505 Ga0451849_0050952 Ga0451849_0050952_785_1399 194
253 3300041512 Ga0451853_1990182 Ga0451853_1990182_2722_3336 194
254 3300046506 Ga0495583_0017375 Ga0495583_0017375_2453_3067 194
255 3300046514 Ga0495618_0050377 Ga0495618_0050377_835_1449 194
256 3300046522 Ga0495643_0000753 Ga0495643_0000753_14970_15584 194
257 3300046524 Ga0495648_0148501 Ga0495648_0148501_502_1116 194
258 3300046660 Ga0495625_0149177 Ga0495625_0149177_574_1188 194
259 3300046663 Ga0495635_0076359 Ga0495635_0076359_830_1444 194
260 3300046675 Ga0495657_0026001 Ga0495657_0026001_3476_4090 194
261 3300046689 Ga0495613_0007798 Ga0495613_0007798_4921_5535 194
262 3300046694 Ga0495649_0159264 Ga0495649_0159264_317_931 194
263 3300046794 Ga0495589_0082031 Ga0495589_0082031_390_1004 194
264 3300046810 Ga0495660_0090509 Ga0495660_0090509_399_1013 194
265 3300047321 Ga0495676_0004087 Ga0495676_0004087_1625_2239 194
266 3300047322 Ga0495680_0015310 Ga0495680_0015310_2006_2620 194
267 3300047443 Ga0495687_016537 Ga0495687_016537_1079_1693 194
268 3300047673 Ga0495593_0374185 Ga0495593_0374185_39_653 194
269 3300050494 nmdc:mga06z11_5553_c1 nmdc:mga06z11_5553_c1_971_1585 194
270 3300050495 nmdc:mga04h51_18293_c1 nmdc:mga04h51_18293_c1_51_665 194
271 3300053149 Ga0500600_0089243 Ga0500600_0089243_978_1592 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19741

DUF6230

Family of unknown function (DUF6230)

40

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r78-assembly1.cif.gz_A crystal structure of a domain of the sensory box sensor histidine kinase/response regulator from geobacter sulfurreducens 0.7365 51 72
3r3j-assembly1.cif.gz_B kinetic and structural characterization of plasmodium falciparum glutamate dehydrogenase 2 0.5923 51 72
8a36-assembly2.cif.gz_D crystal structure of ppsb1-lov-k117e mutant (dark state), monoclinic form 0.5169 51 98
5iu1-assembly1.cif.gz_B n-terminal pas domain homodimer of ppanr map3k from physcomitrella patens. 0.4725 46 96
7r5n-assembly1.cif.gz_A crystal structure of the full-length short lov protein pf5-lov from pseudomonas fluorescens (dark state) 0.4197 48 100
ID Description Score Start End Superfamily
af_Q4D7H5_321_466_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6798 51 77 3.10.620.30
af_P38065_898_1022_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.5272 79 107 3.30.310.10
5j4eA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5164 51 98 3.30.450.20
af_Q4DE91_308_424_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5063 47 77 2.30.29.30
af_K7LXN8_9_117_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4485 80 103 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2G6Y0Y5-F1-model_v4 deleted 0.9529 33 194
AF-A0A7D5AXP2-F1-model_v4 deleted 0.9491 33 194
AF-A0A3D9SH41-F1-model_v4 Cholesterol esterase 0.9466 31 194
AF-A0A4U0SJ60-F1-model_v4 Cholesterol esterase 0.9464 33 194
AF-A0A3R9TVQ4-F1-model_v4 Cholesterol esterase 0.9428 65 194

Feature Viewer

pLDDT pTM Quality
80.13 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map