F378076

General Info

Members Datasets Scaffolds Average Seq Length
272 156 536 451

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10041881|rootL2_100418813
Length 499
Sequence LPAILFLMNVRLKKLDFLILRSFMGPFVVTFFIVLFTLAMQFYWLYMDELIGKGFGVLMTLQLMLYMSTTLFPIALPLGILLASIMTFGSLGENFELVAIKSAGISLYRFMRPLIIFIAVISVLAFFFNNYVIPVTNLKSYSLLYDMRNQKPAMNIREGFFNKDIDGFAIRVGKKEKDGQTIRDIVIYDHTSGRGNDRTILAKNGRMYPSKDKRYLIFELNDGCRYEEDNTKNNHSQTRMEFGKWYKVFDLSKFAFSRTKEELFKGNNEMMNVSQLNNNIDSMNKKLELSAKDLNRYLDPFFSLYQKRKEDSLTYRRVAKGNGKISRYQRNFFDLVPDSSRRKVMQTAESNIRSAQRLIAIVSSDVKLRKDNINQFQIAWHKKYTLSFACMLLFLIGAPLGAIIRKGGLGMPVIIAIAFFIIYFIISSTGEKLAQQSAVAPWYGMWLATGVLLPIAFVIMAAARNDSGLFNKEWYQRGWTKLTAFVNKLTGRQQKIRKD

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
129 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
132 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
133 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
134 2738541284 Pedobacter sp. YR016 Isolate Unclassified
135 2738541302 Pedobacter sp. CF074 Isolate Unclassified
136 2738543023 Pedobacter sp. OK628 Isolate Unclassified
137 2739367651 Pedobacter sp. OK291 Isolate Unclassified
138 2739367656 Pedobacter sp. CF523 Isolate Unclassified
139 2739367663 Pedobacter sp. YR510 Isolate Unclassified
140 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
141 2818991437 Pedobacter terrae 518 Isolate Unclassified
142 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
143 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
144 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
145 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
146 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
147 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
148 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
149 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
150 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
151 2914759650 Rhizosphaericola mali Isolate Rhizosphere
152 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
153 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
154 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
155 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
156 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 0
Isolates 8.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.19
Nodule 0
Rhizoplane 0
Rhizosphere 81.62
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10041881 3300003322 Bacteria 4966
2 SwRhRL2b_contig_1572405 2162886007 Bacteria 7731
3 JGI24739J22299_10021207 3300001989 Bacteria 2315
4 JGI24737J22298_10000464 3300001990 Bacteria 13967
5 JGI24737J22298_10010741 3300001990 Unclassified 3012
6 JGI24735J21928_10000027 3300002067 Bacteria 83494
7 JGI24735J21928_10004420 3300002067 Bacteria 4727
8 JGI25162J39368_1000016 3300002737 Bacteria 288734
9 JGI25152J39213_1000408 3300002773 Bacteria 26030
10 JGI25150J39212_1000001 3300002774 Bacteria 1318726
11 JGI25151J46595_10000001 3300003187 Bacteria 887211
12 JGI25153J46596_10000001 3300003215 Bacteria 748985
13 rootH1_10148170 3300003316 Bacteria 2223
14 rootH2_10006334 3300003320 Bacteria 20923
15 rootH2_10011116 3300003320 Bacteria 111907
16 rootH2_10102951 3300003320 Bacteria 2276
17 rootL2_10109490 3300003322 Bacteria 2890
18 rootH1_10028743 3300003323 Bacteria 10631
19 Ga0055536_1000038 3300003781 Bacteria 133102
20 Ga0055530_10000250 3300003791 Bacteria 48786
21 Ga0065714_10004459 3300005288 Bacteria 8197
22 Ga0065714_10006418 3300005288 Bacteria 8600
23 Ga0065714_10065960 3300005288 Bacteria 7971
24 Ga0065714_10066012 3300005288 Bacteria 7825
25 Ga0065714_10074279 3300005288 Bacteria 3047
26 Ga0065704_10000347 3300005289 Bacteria 28981
27 Ga0070658_10000027 3300005327 Bacteria 164254
28 Ga0070676_10000657 3300005328 Bacteria 16815
29 Ga0070660_100008348 3300005339 Bacteria 7242
30 Ga0070660_100051429 3300005339 Bacteria 3173
31 Ga0070660_100057195 3300005339 Bacteria 3020
32 Ga0070673_100045508 3300005364 Bacteria 3403
33 Ga0070659_100000016 3300005366 Bacteria 169522
34 Ga0070659_100012048 3300005366 Bacteria 6402
35 Ga0070663_100040961 3300005455 Bacteria 3246
36 Ga0070662_100000020 3300005457 Bacteria 99425
37 Ga0070681_10104245 3300005458 Bacteria 2779
38 Ga0068867_100000492 3300005459 Bacteria 26405
39 Ga0070679_100005174 3300005530 Bacteria 12074
40 Ga0068853_100019970 3300005539 Bacteria 5566
41 Ga0068853_100032305 3300005539 Bacteria 4433
42 Ga0070665_100000125 3300005548 Bacteria 146809
43 Ga0068855_100038589 3300005563 Bacteria 5674
44 Ga0068855_100103826 3300005563 Bacteria 3269
45 Ga0068855_100180199 3300005563 Bacteria 2389
46 Ga0068857_100007656 3300005577 Bacteria 9303
47 Ga0068852_100002090 3300005616 Bacteria 13646
48 Ga0075366_10000375 3300006195 Bacteria 20782
49 Ga0097621_100000087 3300006237 Bacteria 49983
50 Ga0068871_100000240 3300006358 Bacteria 38671
51 Ga0068865_100000037 3300006881 Bacteria 81388
52 Ga0105240_10000158 3300009093 Bacteria 139180
53 Ga0105240_10003925 3300009093 Bacteria 22967
54 Ga0105240_10038475 3300009093 Bacteria 6136
55 Ga0105240_10075338 3300009093 Bacteria 4162
56 Ga0105240_10162611 3300009093 Bacteria 2650
57 Ga0105240_10242855 3300009093 Bacteria 2087
58 Ga0105243_10006501 3300009148 Bacteria 9035
59 Ga0105241_10001158 3300009174 Bacteria 20034
60 Ga0105241_10002239 3300009174 Bacteria 14541
61 Ga0105241_10012821 3300009174 Bacteria 6153
62 Ga0105241_10129327 3300009174 Bacteria 2042
63 Ga0105242_10077810 3300009176 Bacteria 2768
64 Ga0105237_10000206 3300009545 Bacteria 84005
65 Ga0105237_10001637 3300009545 Bacteria 29074
66 Ga0105237_10010794 3300009545 Bacteria 9695
67 Ga0105237_10051113 3300009545 Bacteria 4153
68 Ga0105237_10059415 3300009545 Bacteria 3825
69 Ga0105237_10059416 3300009545 Bacteria 3825
70 Ga0105238_10021329 3300009551 Bacteria 6602
71 Ga0105239_10000137 3300010375 Bacteria 102833
72 Ga0105239_10000428 3300010375 Bacteria 61391
73 Ga0105239_10001003 3300010375 Bacteria 39536
74 Ga0105239_10002353 3300010375 Bacteria 24104
75 Ga0105239_10009745 3300010375 Bacteria 10800
76 Ga0105239_10016290 3300010375 Bacteria 8220
77 Ga0105239_10031391 3300010375 Bacteria 5844
78 Ga0105239_10078759 3300010375 Bacteria 3626
79 Ga0105239_10097309 3300010375 Bacteria 3252
80 Ga0157373_10000487 3300013100 Bacteria 31398
81 Ga0157373_10001390 3300013100 Bacteria 18573
82 Ga0157373_10001448 3300013100 Bacteria 18133
83 Ga0157373_10034799 3300013100 Bacteria 3618
84 Ga0157371_10000133 3300013102 Bacteria 110113
85 Ga0157371_10000164 3300013102 Bacteria 96408
86 Ga0157371_10000779 3300013102 Bacteria 36655
87 Ga0157371_10009030 3300013102 Bacteria 7881
88 Ga0157370_10006813 3300013104 Bacteria 12524
89 Ga0157370_10021891 3300013104 Bacteria 6367
90 Ga0157370_10031977 3300013104 Bacteria 5142
91 Ga0157370_10158520 3300013104 Bacteria 2106
92 Ga0157369_10002458 3300013105 Bacteria 22223
93 Ga0157374_10000546 3300013296 Bacteria 33583
94 Ga0157374_10004756 3300013296 Bacteria 11388
95 Ga0157374_10142604 3300013296 Bacteria 2326
96 Ga0157374_10194669 3300013296 Bacteria 1984
97 Ga0157378_10003393 3300013297 Bacteria 14165
98 Ga0157378_10011092 3300013297 Bacteria 7888
99 Ga0157378_10098520 3300013297 Bacteria 2666
100 Ga0163162_10000005 3300013306 Bacteria 447195
101 Ga0163162_10000035 3300013306 Bacteria 147102
102 Ga0163162_10048684 3300013306 Bacteria 4247
103 Ga0157372_10000042 3300013307 Bacteria 157651
104 Ga0157372_10000188 3300013307 Bacteria 68086
105 Ga0157372_10001866 3300013307 Bacteria 22866
106 Ga0157372_10006226 3300013307 Bacteria 12685
107 Ga0157372_10132213 3300013307 Bacteria 2872
108 Ga0157372_10171013 3300013307 Bacteria 2514
109 Ga0182008_10000014 3300014497 Bacteria 263844
110 Ga0182008_10001434 3300014497 Bacteria 15949
111 Ga0182008_10062983 3300014497 Bacteria 1827
112 Ga0157377_10070925 3300014745 Bacteria 2014
113 Ga0182006_1000121 3300015261 Bacteria 84758
114 Ga0182006_1006631 3300015261 Bacteria 5362
115 Ga0182006_1009518 3300015261 Bacteria 4352
116 Ga0163161_10002533 3300017792 Bacteria 13033
117 Ga0163161_10050159 3300017792 Bacteria 3020
118 Ga0209437_100119 3300025233 Bacteria 206549
119 Ga0207425_1000002 3300025245 Bacteria 1362590
120 Ga0209026_1000408 3300025250 Bacteria 37522
121 Ga0209026_1000799 3300025250 Bacteria 17141
122 Ga0209026_1007648 3300025250 Bacteria 2385
123 Ga0209129_1000002 3300025258 Bacteria 1359086
124 Ga0209233_1002900 3300025261 Bacteria 6128
125 Ga0209233_1016239 3300025261 Bacteria 2055
126 Ga0209676_1000201 3300025292 Bacteria 133195
127 Ga0209025_1000004 3300025294 Bacteria 1361782
128 Ga0209758_1000006 3300025297 Bacteria 1359562
129 Ga0209050_1000203 3300025298 Bacteria 133156
130 Ga0207647_10000117 3300025904 Bacteria 61849
131 Ga0207647_10001922 3300025904 Bacteria 15883
132 Ga0207645_10000177 3300025907 Bacteria 51193
133 Ga0207705_10000053 3300025909 Bacteria 162124
134 Ga0207705_10076062 3300025909 Bacteria 2440
135 Ga0207654_10000524 3300025911 Bacteria 21970
136 Ga0207654_10010914 3300025911 Bacteria 4625
137 Ga0207654_10022823 3300025911 Bacteria 3344
138 Ga0207654_10100769 3300025911 Bacteria 1779
139 Ga0207695_10000235 3300025913 Bacteria 146984
140 Ga0207695_10008260 3300025913 Bacteria 13066
141 Ga0207695_10040201 3300025913 Bacteria 5018
142 Ga0207695_10051701 3300025913 Bacteria 4311
143 Ga0207671_10000316 3300025914 Bacteria 71241
144 Ga0207671_10005620 3300025914 Bacteria 11502
145 Ga0207671_10006482 3300025914 Bacteria 10418
146 Ga0207671_10032506 3300025914 Bacteria 3884
147 Ga0207671_10033824 3300025914 Bacteria 3802
148 Ga0207657_10016786 3300025919 Bacteria 7049
149 Ga0207657_10071612 3300025919 Bacteria 2935
150 Ga0207657_10093214 3300025919 Bacteria 2509
151 Ga0207652_10031746 3300025921 Bacteria 4436
152 Ga0207652_10107595 3300025921 Bacteria 2470
153 Ga0207694_10045293 3300025924 Bacteria 3398
154 Ga0207694_10056925 3300025924 Bacteria 3038
155 Ga0207690_10000099 3300025932 Bacteria 71527
156 Ga0207690_10021146 3300025932 Bacteria 4030
157 Ga0207706_10000044 3300025933 Bacteria 123576
158 Ga0207686_10101689 3300025934 Bacteria 1920
159 Ga0207704_10000023 3300025938 Bacteria 142638
160 Ga0207667_10034842 3300025949 Bacteria 5403
161 Ga0207667_10048152 3300025949 Bacteria 4508
162 Ga0207667_10178979 3300025949 Bacteria 2178
163 Ga0207651_10032282 3300025960 Bacteria 3361
164 Ga0207677_10118979 3300026023 Bacteria 1983
165 Ga0207639_10031504 3300026041 Bacteria 3898
166 Ga0207639_10042421 3300026041 Bacteria 3409
167 Ga0207639_10072169 3300026041 Bacteria 2702
168 Ga0207678_10065256 3300026067 Bacteria 3127
169 Ga0207648_10000774 3300026089 Bacteria 36044
170 Ga0207674_10022800 3300026116 Bacteria 6718
171 Ga0207683_10004068 3300026121 Bacteria 12641
172 Ga0268266_10000132 3300028379 Bacteria 145563
173 Ga0307517_10107125 3300028786 Bacteria 2156
174 Ga0307515_10001029 3300028794 Bacteria 63730
175 Ga0307515_10010864 3300028794 Bacteria 17373
176 Ga0307408_100000934 3300031548 Bacteria 22734
177 Ga0316576_10037998 3300031727 Bacteria 3450
178 Ga0307407_10000007 3300031903 Bacteria 210716
179 Ga0307412_10000043 3300031911 Bacteria 166562
180 Ga0307416_100000015 3300032002 Bacteria 210716
181 Ga0307414_10001401 3300032004 Bacteria 12505
182 Ga0307414_10020110 3300032004 Bacteria 4153
183 Ga0307414_10021410 3300032004 Bacteria 4056
184 Ga0307414_10035806 3300032004 Bacteria 3307
185 Ga0307507_10000099 3300033179 Bacteria 139532
186 Ga0395899_0000177 3300037312 Bacteria 94226
187 Ga0395899_0000553 3300037312 Bacteria 40280
188 Ga0395899_0000733 3300037312 Bacteria 32767
189 Ga0395900_0000494 3300037418 Bacteria 55588
190 Ga0395900_0002658 3300037418 Bacteria 19532
191 Ga0395900_0142850 3300037418 Bacteria 2450
192 Ga0395898_0010764 3300037466 Bacteria 9554
193 Ga0395905_0000757 3300037471 Bacteria 42574
194 Ga0395905_0018609 3300037471 Bacteria 6589
195 Ga0395901_0003012 3300038443 Bacteria 16991
196 Ga0395901_0070399 3300038443 Bacteria 3644
197 Ga0436361_1173686 3300039447 Bacteria 7433
198 Ga0466966_0045079 3300044684 Bacteria 2820
199 Ga0453684_0039586 3300044712 Bacteria 6420
200 Ga0466958_0003195 3300045836 Bacteria 8450
201 Ga0495629_0123678 3300046459 Bacteria 1802
202 Ga0495650_0000098 3300046471 Bacteria 215716
203 Ga0495585_0000312 3300046492 Bacteria 48297
204 Ga0495606_0000021 3300046507 Bacteria 271238
205 Ga0495606_0003902 3300046507 Bacteria 15364
206 Ga0495606_0022589 3300046507 Bacteria 4578
207 Ga0495606_0067926 3300046507 Bacteria 2256
208 Ga0495606_0088326 3300046507 Bacteria 1911
209 Ga0495606_0110578 3300046507 Bacteria 1658
210 Ga0495610_0003007 3300046512 Bacteria 13536
211 Ga0495616_0002808 3300046513 Bacteria 11368
212 Ga0495631_0007049 3300046518 Bacteria 5748
213 Ga0495648_0004093 3300046524 Bacteria 12577
214 Ga0495652_0103042 3300046529 Bacteria 2311
215 Ga0495652_0104978 3300046529 Bacteria 2284
216 Ga0495609_0002000 3300046538 Bacteria 12877
217 Ga0495633_0000006 3300046558 Bacteria 326774
218 Ga0495668_0000086 3300046616 Bacteria 151960
219 Ga0495668_0000677 3300046616 Bacteria 41080
220 Ga0495625_0000183 3300046660 Bacteria 98174
221 Ga0495625_0000371 3300046660 Bacteria 68809
222 Ga0495625_0000589 3300046660 Bacteria 52785
223 Ga0495625_0141812 3300046660 Bacteria 1620
224 Ga0495661_0002113 3300046665 Bacteria 15587
225 Ga0495661_0016159 3300046665 Bacteria 4956
226 Ga0495661_0027969 3300046665 Bacteria 3616
227 Ga0495649_0000046 3300046694 Bacteria 120254
228 Ga0495660_0075237 3300046810 Bacteria 1782
229 Ga0495687_000601 3300047443 Bacteria 42037
230 Ga0495681_0026617 3300047470 Bacteria 3006
231 Ga0495686_0000581 3300047472 Bacteria 51820
232 Ga0495686_0000806 3300047472 Bacteria 40626
233 Ga0495686_0002085 3300047472 Bacteria 19661
234 Ga0495686_0021272 3300047472 Bacteria 4311
235 Ga0501240_000979 3300049673 Bacteria 2629
236 Ga0501241_006938 3300049758 Bacteria 2080
237 nmdc:mga0k408_170_c3 3300050493 Bacteria 20840
238 Ga0500635_0000510 3300053080 Bacteria 10714
239 Ga0500618_000018 3300053125 Bacteria 163272
240 Ga0500579_081787 3300053143 Bacteria 1801
241 Ga0500616_0065724 3300053153 Bacteria 1864
242 Ga0500616_0069896 3300053153 Bacteria 1794
243 Ga0500624_000185 3300053157 Bacteria 24629
244 Ga0500627_0002342 3300053158 Bacteria 5596
245 2586209686 2585427687 Bacteria 5544917
246 2738764245 2738541284 Bacteria 5199923
247 2738856389 2738541302 Bacteria 5944758
248 2739305409 2738543023 Bacteria 6767879
249 2739589218 2739367651 Bacteria 6359826
250 2739616159 2739367656 Bacteria 5152243
251 2739646814 2739367663 Bacteria 5040914
252 2776611932 2775506987 Bacteria 5373360
253 2819546872 2818991437 Bacteria 5805520
254 2842725580 2842722452 Bacteria 6263924
255 2842914725 2842909656 Bacteria 6185908
256 2849283275 2849281842 Bacteria 6065644
257 2852625876 2852623160 Bacteria 4376875
258 2852630909 2852627209 Bacteria 5896285
259 2857632575 2857627736 Bacteria 5625397
260 2881957040 2881955468 Bacteria 3545609
261 2884935600 2884933994 Bacteria 4535041
262 2904449224 2904445276 Bacteria 5310396
263 2914760258 2914759650 Bacteria 4701441
264 2919190545 2919186247 Bacteria 6244071
265 2919440491 2919437846 Bacteria 6199444
266 2939668826 2939664404 Bacteria 6364494
267 2946002596 2945997725 Bacteria 6404843
268 2954019444 2954016120 Bacteria 6446024
269 rootL2_10041881
270 SwRhRL2b_contig_1572405
271 JGI24739J22299_10021207
272 JGI24737J22298_10000464
273 JGI24737J22298_10010741
274 JGI24735J21928_10000027
275 JGI24735J21928_10004420
276 JGI25162J39368_1000016
277 JGI25152J39213_1000408
278 JGI25150J39212_1000001
279 JGI25151J46595_10000001
280 JGI25153J46596_10000001
281 rootH1_10148170
282 rootH2_10006334
283 rootH2_10011116
284 rootH2_10102951
285 rootL2_10109490
286 rootH1_10028743
287 Ga0055536_1000038
288 Ga0055530_10000250
289 Ga0065714_10004459
290 Ga0065714_10006418
291 Ga0065714_10065960
292 Ga0065714_10066012
293 Ga0065714_10074279
294 Ga0065704_10000347
295 Ga0070658_10000027
296 Ga0070676_10000657
297 Ga0070660_100008348
298 Ga0070660_100051429
299 Ga0070660_100057195
300 Ga0070673_100045508
301 Ga0070659_100000016
302 Ga0070659_100012048
303 Ga0070663_100040961
304 Ga0070662_100000020
305 Ga0070681_10104245
306 Ga0068867_100000492
307 Ga0070679_100005174
308 Ga0068853_100019970
309 Ga0068853_100032305
310 Ga0070665_100000125
311 Ga0068855_100038589
312 Ga0068855_100103826
313 Ga0068855_100180199
314 Ga0068857_100007656
315 Ga0068852_100002090
316 Ga0075366_10000375
317 Ga0097621_100000087
318 Ga0068871_100000240
319 Ga0068865_100000037
320 Ga0105240_10000158
321 Ga0105240_10003925
322 Ga0105240_10038475
323 Ga0105240_10075338
324 Ga0105240_10162611
325 Ga0105240_10242855
326 Ga0105243_10006501
327 Ga0105241_10001158
328 Ga0105241_10002239
329 Ga0105241_10012821
330 Ga0105241_10129327
331 Ga0105242_10077810
332 Ga0105237_10000206
333 Ga0105237_10001637
334 Ga0105237_10010794
335 Ga0105237_10051113
336 Ga0105237_10059415
337 Ga0105237_10059416
338 Ga0105238_10021329
339 Ga0105239_10000137
340 Ga0105239_10000428
341 Ga0105239_10001003
342 Ga0105239_10002353
343 Ga0105239_10009745
344 Ga0105239_10016290
345 Ga0105239_10031391
346 Ga0105239_10078759
347 Ga0105239_10097309
348 Ga0157373_10000487
349 Ga0157373_10001390
350 Ga0157373_10001448
351 Ga0157373_10034799
352 Ga0157371_10000133
353 Ga0157371_10000164
354 Ga0157371_10000779
355 Ga0157371_10009030
356 Ga0157370_10006813
357 Ga0157370_10021891
358 Ga0157370_10031977
359 Ga0157370_10158520
360 Ga0157369_10002458
361 Ga0157374_10000546
362 Ga0157374_10004756
363 Ga0157374_10142604
364 Ga0157374_10194669
365 Ga0157378_10003393
366 Ga0157378_10011092
367 Ga0157378_10098520
368 Ga0163162_10000005
369 Ga0163162_10000035
370 Ga0163162_10048684
371 Ga0157372_10000042
372 Ga0157372_10000188
373 Ga0157372_10001866
374 Ga0157372_10006226
375 Ga0157372_10132213
376 Ga0157372_10171013
377 Ga0182008_10000014
378 Ga0182008_10001434
379 Ga0182008_10062983
380 Ga0157377_10070925
381 Ga0182006_1000121
382 Ga0182006_1006631
383 Ga0182006_1009518
384 Ga0163161_10002533
385 Ga0163161_10050159
386 Ga0209437_100119
387 Ga0207425_1000002
388 Ga0209026_1000408
389 Ga0209026_1000799
390 Ga0209026_1007648
391 Ga0209129_1000002
392 Ga0209233_1002900
393 Ga0209233_1016239
394 Ga0209676_1000201
395 Ga0209025_1000004
396 Ga0209758_1000006
397 Ga0209050_1000203
398 Ga0207647_10000117
399 Ga0207647_10001922
400 Ga0207645_10000177
401 Ga0207705_10000053
402 Ga0207705_10076062
403 Ga0207654_10000524
404 Ga0207654_10010914
405 Ga0207654_10022823
406 Ga0207654_10100769
407 Ga0207695_10000235
408 Ga0207695_10008260
409 Ga0207695_10040201
410 Ga0207695_10051701
411 Ga0207671_10000316
412 Ga0207671_10005620
413 Ga0207671_10006482
414 Ga0207671_10032506
415 Ga0207671_10033824
416 Ga0207657_10016786
417 Ga0207657_10071612
418 Ga0207657_10093214
419 Ga0207652_10031746
420 Ga0207652_10107595
421 Ga0207694_10045293
422 Ga0207694_10056925
423 Ga0207690_10000099
424 Ga0207690_10021146
425 Ga0207706_10000044
426 Ga0207686_10101689
427 Ga0207704_10000023
428 Ga0207667_10034842
429 Ga0207667_10048152
430 Ga0207667_10178979
431 Ga0207651_10032282
432 Ga0207677_10118979
433 Ga0207639_10031504
434 Ga0207639_10042421
435 Ga0207639_10072169
436 Ga0207678_10065256
437 Ga0207648_10000774
438 Ga0207674_10022800
439 Ga0207683_10004068
440 Ga0268266_10000132
441 Ga0307517_10107125
442 Ga0307515_10001029
443 Ga0307515_10010864
444 Ga0307408_100000934
445 Ga0316576_10037998
446 Ga0307407_10000007
447 Ga0307412_10000043
448 Ga0307416_100000015
449 Ga0307414_10001401
450 Ga0307414_10020110
451 Ga0307414_10021410
452 Ga0307414_10035806
453 Ga0307507_10000099
454 Ga0395899_0000177
455 Ga0395899_0000553
456 Ga0395899_0000733
457 Ga0395900_0000494
458 Ga0395900_0002658
459 Ga0395900_0142850
460 Ga0395898_0010764
461 Ga0395905_0000757
462 Ga0395905_0018609
463 Ga0395901_0003012
464 Ga0395901_0070399
465 Ga0436361_1173686
466 Ga0466966_0045079
467 Ga0453684_0039586
468 Ga0466958_0003195
469 Ga0495629_0123678
470 Ga0495650_0000098
471 Ga0495585_0000312
472 Ga0495606_0000021
473 Ga0495606_0003902
474 Ga0495606_0022589
475 Ga0495606_0067926
476 Ga0495606_0088326
477 Ga0495606_0110578
478 Ga0495610_0003007
479 Ga0495616_0002808
480 Ga0495631_0007049
481 Ga0495648_0004093
482 Ga0495652_0103042
483 Ga0495652_0104978
484 Ga0495609_0002000
485 Ga0495633_0000006
486 Ga0495668_0000086
487 Ga0495668_0000677
488 Ga0495625_0000183
489 Ga0495625_0000371
490 Ga0495625_0000589
491 Ga0495625_0141812
492 Ga0495661_0002113
493 Ga0495661_0016159
494 Ga0495661_0027969
495 Ga0495649_0000046
496 Ga0495660_0075237
497 Ga0495687_000601
498 Ga0495681_0026617
499 Ga0495686_0000581
500 Ga0495686_0000806
501 Ga0495686_0002085
502 Ga0495686_0021272
503 Ga0501240_000979
504 Ga0501241_006938
505 nmdc:mga0k408_170_c3
506 Ga0500635_0000510
507 Ga0500618_000018
508 Ga0500579_081787
509 Ga0500616_0065724
510 Ga0500616_0069896
511 Ga0500624_000185
512 Ga0500627_0002342
513 2586209686
514 2738764245
515 2738856389
516 2739305409
517 2739589218
518 2739616159
519 2739646814
520 2776611932
521 2819546872
522 2842725580
523 2842914725
524 2849283275
525 2852625876
526 2852630909
527 2857632575
528 2881957040
529 2884935600
530 2904449224
531 2914760258
532 2919190545
533 2919440491
534 2939668826
535 2946002596
536 2954019444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

18

304

0.91

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

309

462

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s8g-assembly1.cif.gz_F cryo-em structure of lptb2fgc in complex with amp-pnp 0.8102 334 416
7abg-assembly1.cif.gz_m human pre-bact-1 spliceosome 0.7188 159 210
7oha-assembly1.cif.gz_M nucleosome with tbp and tfiia bound at shl +2 0.6849 153 212
6mit-assembly2.cif.gz_J lptbfgc from enterobacter cloacae 0.6667 4 416
6mit-assembly2.cif.gz_I lptbfgc from enterobacter cloacae 0.6199 2 416
ID Description Score Start End Superfamily
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.8236 159 212 2.30.18.10
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.731 159 212 2.30.18.10
af_A0A0P0VDD6_21_103_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7224 144 215 2.30.30.100
af_A0A2R8QME3_22_118_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.6384 159 215 2.30.30.100
af_Q8ILU8_3_85_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.6201 144 215 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A0S8FWU1-F1-model_v4 LptF/LptG family permease 0.8875 8 416 GO:0015920
GO:0043190
AF-A0A519WW14-F1-model_v4 YjgP/YjgQ family permease 0.825 1 444 GO:0015920
GO:0043190
AF-A0A7C2LXR9-F1-model_v4 YjgP/YjgQ family permease 0.8187 1 447 GO:0015920
GO:0043190
AF-A0A7C2LXR9-F1-model_v4 YjgP/YjgQ family permease 0.8136 1 447 GO:0015920
GO:0043190
AF-A0A519WW14-F1-model_v4 YjgP/YjgQ family permease 0.8131 1 444 GO:0015920
GO:0043190

Map