F378113

General Info

Members Datasets Scaffolds Average Seq Length
272 209 544 281

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10022366|Ga0070676_100223664
Length 298
Sequence MNGMNTMSTPADLSIAASPTILVQLTDLHIREPGRLAYRRVDTSRYFRALVDSVLALKQRADAVVISGDLTDFGRPAEYASLAAQIAPLEAAGLPVYLMPGNHDDRAEMRRSFPTHTHLGDGPSTAVIQFAVDVGPLRLLAIDTCVPMQSAGALDAERLGWLETELDASRERPVVIAMHHPPFQTLIGHMDKIGLLSGAAELEAIVARHRNVERVICGHLHRAIDVRFGGTIASTAPGPAHQVCLDLDPDAVSAWTLEPPAFRVHAWNPAERRLVTHLAASGSFEGPYPFYENGVLID

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
174 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
175 2643221569 Achromobacter sp. Root565 Isolate Unclassified
176 2643221594 Achromobacter sp. Root170 Isolate Unclassified
177 2643221609 Acidovorax sp. Root217 Isolate Unclassified
178 2643221611 Acidovorax sp. Root219 Isolate Unclassified
179 2643221621 Achromobacter sp. Root83 Isolate Unclassified
180 2721755523 Delftia sp. HK171 Isolate Unclassified
181 2738543012 Acidovorax sp. CF301 Isolate Unclassified
182 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
183 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
184 2816332133 Acidovorax radicis 2721A Isolate Unclassified
185 2818991446 Variovorax sp. 1180 Isolate Unclassified
186 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
187 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
188 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
189 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
190 2842733646 Variovorax sp. R-72446 Isolate Unclassified
191 2842747753 Variovorax sp. R-72060 Isolate Unclassified
192 2855730933 Achromobacter sp. HZ28 Isolate Nodule
193 2855767633 Achromobacter sp. HZ34 Isolate Nodule
194 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
195 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
196 2858950400 Achromobacter sp. K91 Isolate Unclassified
197 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
198 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
199 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
200 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
201 2899924645 Variovorax sp. 369 Isolate Unclassified
202 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
203 2928037797 Variovorax sp. 1126 Isolate Unclassified
204 2928044640 Variovorax sp. 1128 Isolate Unclassified
205 2928051484 Variovorax sp. 1133 Isolate Unclassified
206 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
207 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
208 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
209 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.32
Nodule 2.21
Rhizoplane 0.37
Rhizosphere 58.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10022366 3300005328 Bacteria 3544
2 SwRhRL2b_contig_1418626 2162886007 Bacteria 2054
3 JGI25151J46595_10006322 3300003187 Bacteria 5970
4 rootH2_10114082 3300003320 Bacteria 2278
5 rootH1_10093045 3300003323 Bacteria 1704
6 JGI25161J50226_1004375 3300003374 Bacteria 2965
7 Ga0055535_1000142 3300003761 Bacteria 75104
8 Ga0055542_1000022 3300003762 Bacteria 302315
9 Ga0055526_1015128 3300003771 Bacteria 3115
10 Ga0055537_1006109 3300003773 Bacteria 3110
11 Ga0055524_1013259 3300003775 Bacteria 3115
12 Ga0055536_1003239 3300003781 Bacteria 8818
13 Ga0055536_1003639 3300003781 Bacteria 8211
14 Ga0055528_1016552 3300003790 Bacteria 2600
15 Ga0055530_10002217 3300003791 Bacteria 12832
16 Ga0055540_1009523 3300003792 Bacteria 3345
17 Ga0055540_1012381 3300003792 Bacteria 2681
18 Ga0055531_10019846 3300003794 Bacteria 2695
19 Ga0055543_1004842 3300004625 Bacteria 3567
20 Ga0065165_1032933 3300005262 Bacteria 1619
21 Ga0065704_10071587 3300005289 Bacteria 10610
22 Ga0065707_10099318 3300005295 Bacteria 3016
23 Ga0070658_10316331 3300005327 Bacteria 1332
24 Ga0070670_100004735 3300005331 Bacteria 11419
25 Ga0070670_100084354 3300005331 Bacteria 2729
26 Ga0070670_100194609 3300005331 Bacteria 1761
27 Ga0070677_10021941 3300005333 Bacteria 2347
28 Ga0070677_10028887 3300005333 Bacteria 2098
29 Ga0070677_10095163 3300005333 Bacteria 1303
30 Ga0068869_100511465 3300005334 Bacteria 1004
31 Ga0070680_100003976 3300005336 Bacteria 11064
32 Ga0068868_100027173 3300005338 Bacteria 4365
33 Ga0070668_100632476 3300005347 Bacteria 939
34 Ga0070669_100014745 3300005353 Bacteria 5565
35 Ga0070675_100002569 3300005354 Bacteria 13593
36 Ga0070675_100024403 3300005354 Bacteria 4843
37 Ga0070675_100129438 3300005354 Bacteria 2150
38 Ga0070671_100018623 3300005355 Bacteria 5641
39 Ga0070671_100184349 3300005355 Bacteria 1768
40 Ga0070674_100001349 3300005356 Bacteria 12937
41 Ga0070674_100312114 3300005356 Bacteria 1257
42 Ga0070673_100007977 3300005364 Bacteria 7016
43 Ga0070673_100171617 3300005364 Bacteria 1851
44 Ga0070673_100549234 3300005364 Bacteria 1049
45 Ga0070667_100062013 3300005367 Bacteria 3167
46 Ga0070678_100035321 3300005456 Bacteria 3488
47 Ga0070678_100083594 3300005456 Bacteria 2427
48 Ga0070678_100375064 3300005456 Bacteria 1229
49 Ga0070662_100496168 3300005457 Bacteria 1018
50 Ga0070681_10025766 3300005458 Bacteria 5913
51 Ga0068867_100004766 3300005459 Bacteria 9551
52 Ga0070679_100006292 3300005530 Bacteria 11053
53 Ga0070672_100005395 3300005543 Bacteria 8468
54 Ga0070672_100140683 3300005543 Bacteria 1990
55 Ga0070665_100661061 3300005548 Bacteria 1058
56 Ga0068854_100168633 3300005578 Bacteria 1702
57 Ga0068856_100139130 3300005614 Bacteria 2434
58 Ga0068852_100243290 3300005616 Bacteria 1720
59 Ga0068864_100368503 3300005618 Bacteria 1359
60 Ga0068851_10056605 3300005834 Bacteria 2000
61 Ga0068860_100022346 3300005843 Bacteria 6120
62 Ga0075364_10009014 3300006051 Bacteria 5976
63 Ga0075364_10030314 3300006051 Bacteria 3471
64 Ga0075366_10003019 3300006195 Bacteria 8780
65 Ga0097621_100044380 3300006237 Bacteria 3586
66 Ga0068871_100016997 3300006358 Bacteria 5494
67 Ga0068865_100137056 3300006881 Bacteria 1841
68 Ga0079104_1000004 3300006946 Bacteria 444549
69 Ga0114129_10639802 3300009147 Bacteria 1374
70 Ga0105243_10002650 3300009148 Bacteria 14865
71 Ga0105243_10047100 3300009148 Bacteria 3393
72 Ga0105242_10004151 3300009176 Bacteria 11276
73 Ga0105242_10173086 3300009176 Bacteria 1899
74 Ga0157370_10109932 3300013104 Bacteria 2577
75 Ga0157369_10387935 3300013105 Bacteria 1449
76 Ga0163162_10228603 3300013306 Bacteria 1990
77 Ga0157375_10029431 3300013308 Bacteria 5165
78 Ga0157375_10716686 3300013308 Bacteria 1153
79 Ga0157375_10971294 3300013308 Bacteria 990
80 Ga0157380_10106387 3300014326 Bacteria 2347
81 Ga0182008_10006578 3300014497 Bacteria 6486
82 Ga0182008_10032408 3300014497 Bacteria 2626
83 Ga0157376_10296609 3300014969 Bacteria 1528
84 Ga0163161_10004415 3300017792 Bacteria 9809
85 Ga0163161_10034620 3300017792 Bacteria 3614
86 Ga0213872_10003578 3300021361 Bacteria 8554
87 Ga0209436_110411 3300025208 Bacteria 1703
88 Ga0209672_100388 3300025228 Bacteria 26692
89 Ga0209147_100982 3300025229 Bacteria 12407
90 Ga0209258_100009 3300025242 Bacteria 996276
91 Ga0207425_1008223 3300025245 Bacteria 2687
92 Ga0209148_1000007 3300025254 Bacteria 1592273
93 Ga0209129_1007753 3300025258 Bacteria 3118
94 Ga0209565_1000355 3300025263 Bacteria 40050
95 Ga0209565_1001175 3300025263 Bacteria 12538
96 Ga0209673_1000615 3300025273 Bacteria 54497
97 Ga0209673_1000806 3300025273 Bacteria 41441
98 Ga0209130_1000157 3300025284 Bacteria 101890
99 Ga0209675_1000504 3300025291 Bacteria 29131
100 Ga0209676_1000028 3300025292 Bacteria 559745
101 Ga0209676_1000098 3300025292 Bacteria 234305
102 Ga0209676_1000275 3300025292 Bacteria 107485
103 Ga0209676_1004275 3300025292 Bacteria 8052
104 Ga0209025_1000272 3300025294 Bacteria 120328
105 Ga0209025_1002963 3300025294 Bacteria 16867
106 Ga0209564_1000198 3300025295 Bacteria 138511
107 Ga0209758_1014917 3300025297 Bacteria 4078
108 Ga0209050_1000002 3300025298 Bacteria 1792849
109 Ga0209050_1000122 3300025298 Bacteria 195305
110 Ga0209256_1000088 3300025299 Bacteria 217236
111 Ga0207426_1000038 3300025302 Bacteria 441522
112 Ga0209051_1000015 3300025303 Bacteria 546798
113 Ga0209051_1000098 3300025303 Bacteria 165284
114 Ga0209051_1000168 3300025303 Bacteria 119312
115 Ga0209051_1000179 3300025303 Bacteria 114055
116 Ga0209257_1000002 3300025304 Bacteria 1767052
117 Ga0207697_10007997 3300025315 Bacteria 4669
118 Ga0207682_10003822 3300025893 Bacteria 6463
119 Ga0207682_10109179 3300025893 Bacteria 1217
120 Ga0207642_10225787 3300025899 Bacteria 1049
121 Ga0207688_10090453 3300025901 Bacteria 1757
122 Ga0207680_10132817 3300025903 Bacteria 1642
123 Ga0207645_10033943 3300025907 Bacteria 3278
124 Ga0207643_10025990 3300025908 Bacteria 3239
125 Ga0207705_10030389 3300025909 Bacteria 3855
126 Ga0207660_10021819 3300025917 Bacteria 4309
127 Ga0207652_10016331 3300025921 Bacteria 6060
128 Ga0207681_10006927 3300025923 Bacteria 6954
129 Ga0207650_10001027 3300025925 Bacteria 20954
130 Ga0207659_10001133 3300025926 Bacteria 15808
131 Ga0207644_10001139 3300025931 Bacteria 17037
132 Ga0207706_10186523 3300025933 Bacteria 1821
133 Ga0207686_10003308 3300025934 Bacteria 8670
134 Ga0207709_10000138 3300025935 Bacteria 104006
135 Ga0207669_10012321 3300025937 Bacteria 4200
136 Ga0207669_10157002 3300025937 Bacteria 1601
137 Ga0207691_10001104 3300025940 Bacteria 26843
138 Ga0207691_10060045 3300025940 Bacteria 3456
139 Ga0207691_10140768 3300025940 Bacteria 2126
140 Ga0207691_10149335 3300025940 Bacteria 2055
141 Ga0207651_10003576 3300025960 Bacteria 7641
142 Ga0207668_10103073 3300025972 Bacteria 2124
143 Ga0207668_10308892 3300025972 Bacteria 1308
144 Ga0207658_10078622 3300025986 Bacteria 2521
145 Ga0207677_10006244 3300026023 Bacteria 6517
146 Ga0207678_10096916 3300026067 Bacteria 2520
147 Ga0207702_10035976 3300026078 Bacteria 4141
148 Ga0207648_10009096 3300026089 Bacteria 9549
149 Ga0207648_10022265 3300026089 Bacteria 5694
150 Ga0207648_10211329 3300026089 Bacteria 1722
151 Ga0207676_10029847 3300026095 Bacteria 4086
152 Ga0207683_10011073 3300026121 Bacteria 7684
153 Ga0207683_10032188 3300026121 Bacteria 4555
154 Ga0207683_10084982 3300026121 Bacteria 2813
155 Ga0209281_1000005 3300027111 Bacteria 1242284
156 Ga0268266_10324363 3300028379 Bacteria 1442
157 Ga0307515_10204116 3300028794 Bacteria 1843
158 Ga0265324_10017219 3300029957 Bacteria 2630
159 Ga0265327_10066955 3300031251 Bacteria 1811
160 Ga0307412_10000061 3300031911 Bacteria 126274
161 Ga0307414_10113135 3300032004 Bacteria 2071
162 Ga0373927_0040780 3300035695 Bacteria 3012
163 Ga0373937_0254911 3300036401 Bacteria 1654
164 Ga0395900_0017268 3300037418 Bacteria 7365
165 Ga0395898_0059920 3300037466 Bacteria 3701
166 Ga0395905_0087569 3300037471 Bacteria 2919
167 Ga0395905_0397690 3300037471 Bacteria 1272
168 Ga0395901_0117737 3300038443 Bacteria 2791
169 Ga0436365_0244431 3300039437 Bacteria 1728
170 Ga0436361_1128018 3300039447 Bacteria 39370
171 Ga0439439_0017016 3300041406 Bacteria 1784
172 Ga0439466_0003999 3300041411 Bacteria 5688
173 Ga0439465_0002674 3300041413 Bacteria 5828
174 Ga0439431_0000597 3300041997 Bacteria 7625
175 Ga0439433_0000364 3300041999 Bacteria 8025
176 Ga0439442_019325 3300042002 Bacteria 1410
177 Ga0439445_0000303 3300042004 Bacteria 9578
178 Ga0439432_005717 3300042006 Bacteria 4467
179 Ga0439449_0005014 3300042007 Bacteria 5092
180 Ga0439449_0006098 3300042007 Bacteria 4606
181 Ga0439452_000914 3300042010 Bacteria 13457
182 Ga0439452_037751 3300042010 Bacteria 1150
183 Ga0439462_0003728 3300042015 Bacteria 3680
184 Ga0450923_006034 3300042125 Bacteria 1986
185 Ga0439434_0007048 3300042435 Bacteria 3284
186 Ga0451577_0084692 3300042876 Bacteria 2828
187 Ga0466969_0170916 3300044656 Bacteria 997
188 Ga0466965_0047950 3300044683 Bacteria 2115
189 Ga0453684_0009647 3300044712 Bacteria 16822
190 Ga0453684_0022482 3300044712 Bacteria 9348
191 Ga0453684_0329577 3300044712 Bacteria 1726
192 Ga0451576_0020911 3300045051 Bacteria 7122
193 Ga0495607_0000050 3300046501 Bacteria 120052
194 Ga0495643_0031816 3300046522 Bacteria 2933
195 Ga0495652_0045643 3300046529 Bacteria 3765
196 Ga0495654_0021662 3300046530 Bacteria 3342
197 Ga0495646_0000288 3300046680 Bacteria 25753
198 Ga0495602_0046249 3300048088 Bacteria 3933
199 Ga0495626_0032402 3300048091 Bacteria 2510
200 Ga0496116_0012137 3300048919 Bacteria 7055
201 Ga0496117_0031805 3300048920 Bacteria 4023
202 Ga0496118_0012576 3300048921 Bacteria 8105
203 Ga0496119_0065783 3300048922 Bacteria 2145
204 Ga0496119_0108474 3300048922 Bacteria 1545
205 Ga0496121_0008364 3300048924 Bacteria 12209
206 Ga0496121_0268529 3300048924 Bacteria 1174
207 Ga0496121_0437785 3300048924 Bacteria 846
208 Ga0496122_0000063 3300048925 Bacteria 241378
209 Ga0496122_0002003 3300048925 Bacteria 30327
210 Ga0496122_0006874 3300048925 Bacteria 12878
211 Ga0496122_0073350 3300048925 Bacteria 2427
212 Ga0496123_0000045 3300048926 Bacteria 249294
213 Ga0496123_0000730 3300048926 Bacteria 53397
214 Ga0496123_0034858 3300048926 Bacteria 3597
215 Ga0496124_0034831 3300048927 Bacteria 4411
216 Ga0496124_0082523 3300048927 Bacteria 2638
217 Ga0496125_0000051 3300048928 Bacteria 285754
218 Ga0496125_0005169 3300048928 Bacteria 14676
219 Ga0496125_0005281 3300048928 Bacteria 14459
220 Ga0496126_0047899 3300048929 Bacteria 3911
221 Ga0496126_0124816 3300048929 Bacteria 2229
222 Ga0501033_0066591 3300049570 Bacteria 2649
223 Ga0501035_0106337 3300049822 Bacteria 2460
224 Ga0501044_0000250 3300049823 Bacteria 68405
225 Ga0501044_0042904 3300049823 Bacteria 4701
226 Ga0501044_0608409 3300049823 Bacteria 985
227 nmdc:mga00v17_449_c1 3300050491 Bacteria 23134
228 nmdc:mga0k408_31921_c1 3300050493 Bacteria 3009
229 Ga0500646_0012729 3300053090 Bacteria 2174
230 Ga0500566_0152021 3300053094 Bacteria 1216
231 Ga0500593_055821 3300053117 Bacteria 1744
232 Ga0500559_0004803 3300053136 Bacteria 6321
233 Ga0500559_0073709 3300053136 Bacteria 1541
234 Ga0500634_0128083 3300053161 Bacteria 1223
235 Ga0500661_008848 3300055283 Bacteria 1851
236 2599902841 2599185292 Bacteria 6290804
237 2643861676 2643221569 Bacteria 6064337
238 2643983294 2643221594 Bacteria 5811388
239 2644059584 2643221609 Bacteria 6756331
240 2644074726 2643221611 Bacteria 6820941
241 2644123560 2643221621 Bacteria 6212786
242 2722884254 2721755523 Bacteria 6430384
243 2739241114 2738543012 Bacteria 7115078
244 2739611100 2739367655 Bacteria 4051151
245 2809033180 2808606395 Bacteria 6020352
246 2816471808 2816332133 Bacteria 7249298
247 2819599743 2818991446 Bacteria 7757362
248 2831271660 2831265667 Bacteria 7184833
249 2838055573 2838054893 Bacteria 7451788
250 2839140763 2839138175 Bacteria 6549354
251 2842721515 2842718218 Bacteria 4560148
252 2842734187 2842733646 Bacteria 5716726
253 2842749552 2842747753 Bacteria 5578255
254 2855736671 2855730933 Bacteria 7047938
255 2855773608 2855767633 Bacteria 7049357
256 2857538307 2857537821 Bacteria 5248181
257 2857577840 2857576091 Bacteria 5465855
258 2858952149 2858950400 Bacteria 6783797
259 2881103828 2881101125 Bacteria 4590519
260 2881929938 2881927736 Bacteria 3993927
261 2881930649 2881927736 Bacteria 3993927
262 2885194734 2885192300 Bacteria 5882526
263 2894024178 2894023352 Bacteria 5167372
264 2899927624 2899924645 Bacteria 7487985
265 2904549796 2904541872 Bacteria 8915136
266 2928042099 2928037797 Bacteria 7273642
267 2928049663 2928044640 Bacteria 7271509
268 2928051663 2928051484 Bacteria 7773759
269 2928065646 2928064002 Bacteria 7419480
270 2928120443 2928115317 Bacteria 6477646
271 2929161763 2929160207 Bacteria 9075316
272 2941482574
273 Ga0070676_10022366
274 SwRhRL2b_contig_1418626
275 JGI25151J46595_10006322
276 rootH2_10114082
277 rootH1_10093045
278 JGI25161J50226_1004375
279 Ga0055535_1000142
280 Ga0055542_1000022
281 Ga0055526_1015128
282 Ga0055537_1006109
283 Ga0055524_1013259
284 Ga0055536_1003239
285 Ga0055536_1003639
286 Ga0055528_1016552
287 Ga0055530_10002217
288 Ga0055540_1009523
289 Ga0055540_1012381
290 Ga0055531_10019846
291 Ga0055543_1004842
292 Ga0065165_1032933
293 Ga0065704_10071587
294 Ga0065707_10099318
295 Ga0070658_10316331
296 Ga0070670_100004735
297 Ga0070670_100084354
298 Ga0070670_100194609
299 Ga0070677_10021941
300 Ga0070677_10028887
301 Ga0070677_10095163
302 Ga0068869_100511465
303 Ga0070680_100003976
304 Ga0068868_100027173
305 Ga0070668_100632476
306 Ga0070669_100014745
307 Ga0070675_100002569
308 Ga0070675_100024403
309 Ga0070675_100129438
310 Ga0070671_100018623
311 Ga0070671_100184349
312 Ga0070674_100001349
313 Ga0070674_100312114
314 Ga0070673_100007977
315 Ga0070673_100171617
316 Ga0070673_100549234
317 Ga0070667_100062013
318 Ga0070678_100035321
319 Ga0070678_100083594
320 Ga0070678_100375064
321 Ga0070662_100496168
322 Ga0070681_10025766
323 Ga0068867_100004766
324 Ga0070679_100006292
325 Ga0070672_100005395
326 Ga0070672_100140683
327 Ga0070665_100661061
328 Ga0068854_100168633
329 Ga0068856_100139130
330 Ga0068852_100243290
331 Ga0068864_100368503
332 Ga0068851_10056605
333 Ga0068860_100022346
334 Ga0075364_10009014
335 Ga0075364_10030314
336 Ga0075366_10003019
337 Ga0097621_100044380
338 Ga0068871_100016997
339 Ga0068865_100137056
340 Ga0079104_1000004
341 Ga0114129_10639802
342 Ga0105243_10002650
343 Ga0105243_10047100
344 Ga0105242_10004151
345 Ga0105242_10173086
346 Ga0157370_10109932
347 Ga0157369_10387935
348 Ga0163162_10228603
349 Ga0157375_10029431
350 Ga0157375_10716686
351 Ga0157375_10971294
352 Ga0157380_10106387
353 Ga0182008_10006578
354 Ga0182008_10032408
355 Ga0157376_10296609
356 Ga0163161_10004415
357 Ga0163161_10034620
358 Ga0213872_10003578
359 Ga0209436_110411
360 Ga0209672_100388
361 Ga0209147_100982
362 Ga0209258_100009
363 Ga0207425_1008223
364 Ga0209148_1000007
365 Ga0209129_1007753
366 Ga0209565_1000355
367 Ga0209565_1001175
368 Ga0209673_1000615
369 Ga0209673_1000806
370 Ga0209130_1000157
371 Ga0209675_1000504
372 Ga0209676_1000028
373 Ga0209676_1000098
374 Ga0209676_1000275
375 Ga0209676_1004275
376 Ga0209025_1000272
377 Ga0209025_1002963
378 Ga0209564_1000198
379 Ga0209758_1014917
380 Ga0209050_1000002
381 Ga0209050_1000122
382 Ga0209256_1000088
383 Ga0207426_1000038
384 Ga0209051_1000015
385 Ga0209051_1000098
386 Ga0209051_1000168
387 Ga0209051_1000179
388 Ga0209257_1000002
389 Ga0207697_10007997
390 Ga0207682_10003822
391 Ga0207682_10109179
392 Ga0207642_10225787
393 Ga0207688_10090453
394 Ga0207680_10132817
395 Ga0207645_10033943
396 Ga0207643_10025990
397 Ga0207705_10030389
398 Ga0207660_10021819
399 Ga0207652_10016331
400 Ga0207681_10006927
401 Ga0207650_10001027
402 Ga0207659_10001133
403 Ga0207644_10001139
404 Ga0207706_10186523
405 Ga0207686_10003308
406 Ga0207709_10000138
407 Ga0207669_10012321
408 Ga0207669_10157002
409 Ga0207691_10001104
410 Ga0207691_10060045
411 Ga0207691_10140768
412 Ga0207691_10149335
413 Ga0207651_10003576
414 Ga0207668_10103073
415 Ga0207668_10308892
416 Ga0207658_10078622
417 Ga0207677_10006244
418 Ga0207678_10096916
419 Ga0207702_10035976
420 Ga0207648_10009096
421 Ga0207648_10022265
422 Ga0207648_10211329
423 Ga0207676_10029847
424 Ga0207683_10011073
425 Ga0207683_10032188
426 Ga0207683_10084982
427 Ga0209281_1000005
428 Ga0268266_10324363
429 Ga0307515_10204116
430 Ga0265324_10017219
431 Ga0265327_10066955
432 Ga0307412_10000061
433 Ga0307414_10113135
434 Ga0373927_0040780
435 Ga0373937_0254911
436 Ga0395900_0017268
437 Ga0395898_0059920
438 Ga0395905_0087569
439 Ga0395905_0397690
440 Ga0395901_0117737
441 Ga0436365_0244431
442 Ga0436361_1128018
443 Ga0439439_0017016
444 Ga0439466_0003999
445 Ga0439465_0002674
446 Ga0439431_0000597
447 Ga0439433_0000364
448 Ga0439442_019325
449 Ga0439445_0000303
450 Ga0439432_005717
451 Ga0439449_0005014
452 Ga0439449_0006098
453 Ga0439452_000914
454 Ga0439452_037751
455 Ga0439462_0003728
456 Ga0450923_006034
457 Ga0439434_0007048
458 Ga0451577_0084692
459 Ga0466969_0170916
460 Ga0466965_0047950
461 Ga0453684_0009647
462 Ga0453684_0022482
463 Ga0453684_0329577
464 Ga0451576_0020911
465 Ga0495607_0000050
466 Ga0495643_0031816
467 Ga0495652_0045643
468 Ga0495654_0021662
469 Ga0495646_0000288
470 Ga0495602_0046249
471 Ga0495626_0032402
472 Ga0496116_0012137
473 Ga0496117_0031805
474 Ga0496118_0012576
475 Ga0496119_0065783
476 Ga0496119_0108474
477 Ga0496121_0008364
478 Ga0496121_0268529
479 Ga0496121_0437785
480 Ga0496122_0000063
481 Ga0496122_0002003
482 Ga0496122_0006874
483 Ga0496122_0073350
484 Ga0496123_0000045
485 Ga0496123_0000730
486 Ga0496123_0034858
487 Ga0496124_0034831
488 Ga0496124_0082523
489 Ga0496125_0000051
490 Ga0496125_0005169
491 Ga0496125_0005281
492 Ga0496126_0047899
493 Ga0496126_0124816
494 Ga0501033_0066591
495 Ga0501035_0106337
496 Ga0501044_0000250
497 Ga0501044_0042904
498 Ga0501044_0608409
499 nmdc:mga00v17_449_c1
500 nmdc:mga0k408_31921_c1
501 Ga0500646_0012729
502 Ga0500566_0152021
503 Ga0500593_055821
504 Ga0500559_0004803
505 Ga0500559_0073709
506 Ga0500634_0128083
507 Ga0500661_008848
508 2599902841
509 2643861676
510 2643983294
511 2644059584
512 2644074726
513 2644123560
514 2722884254
515 2739241114
516 2739611100
517 2809033180
518 2816471808
519 2819599743
520 2831271660
521 2838055573
522 2839140763
523 2842721515
524 2842734187
525 2842749552
526 2855736671
527 2855773608
528 2857538307
529 2857577840
530 2858952149
531 2881103828
532 2881929938
533 2881930649
534 2885194734
535 2894024178
536 2899927624
537 2904549796
538 2928042099
539 2928049663
540 2928051663
541 2928065646
542 2928120443
543 2929161763
544 2941482574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

21

223

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d03-assembly1.cif.gz_A 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes 0.9421 6 275
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.9409 6 275
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.9289 6 259
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.9244 6 259
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.9208 6 275
ID Description Score Start End Superfamily
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9289 6 259 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.9201 113 238 3.30.750.180
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9018 6 259 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.8995 113 238 3.30.750.180
3ib7A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8953 6 276 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A519M7K2-F1-model_v4 Phosphodiesterase 0.9929 4 230 GO:0004112
AF-A0A519M7K2-F1-model_v4 Phosphodiesterase 0.9885 4 230 GO:0004112
AF-A0A0B6S6W4-F1-model_v4 Metallophosphoesterase 0.9858 6 271 GO:0004115
AF-A0A838JMB9-F1-model_v4 Phosphodiesterase 0.9851 6 271 GO:0004112
AF-A0A1Q9AR10-F1-model_v4 3',5'-cyclic-nucleotide phosphodiesterase 0.9848 141 271

Map