F378148

General Info

Members Datasets Scaffolds Average Seq Length
272 171 545 254

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10165557|Ga0070691_101655572
Length 291
Sequence MGGADVEVSVCRTGWQGGREMAIDDKDIFIKRIKIISMFSLKGKNAVITGAGSGIGRAVALLLAKQGARVYAVDLNEGQALDTVKEIEAAGGAGSAHAVDVSKQEEVVKVFAAMPKVDIVVNSAGVSHVGTVETTPEADFERLYNVNVKGVYNSLYAAVPLMKKSGGGVIINMSSIAALVGIPDRFAYSMTKGAVTAMTLSVAKDYIKDGIRCNCISPARVHTPFVDGFLKKNYPGKEQEMFDKLSKTQPIGRMAKPEEIAGLILYLCSDEASFITGCDYPIDGGFVKLNN

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
169 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
170 2818991444 Filimonas endophytica 3197 Isolate Unclassified
171 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0.37
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 0
Rhizoplane 1.47
Rhizosphere 82.72
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10165557 3300005341 Unclassified 1142
2 rootH1_10060220 3300003316 Bacteria 5204
3 rootH1_10074120 3300003316 Bacteria 5396
4 rootH1_10074120 3300003323 Bacteria 1861
5 rootH2_10000031 3300003320 Bacteria 18276
6 rootH2_10007492 3300003320 Bacteria 31313
7 rootH2_10048257 3300003320 Bacteria 13727
8 rootH2_10245220 3300003320 Unclassified 1667
9 rootL2_10297671 3300003322 Bacteria 1399
10 rootH1_10080608 3300003323 Bacteria 1645
11 rootH1_10092001 3300003323 Bacteria 14085
12 Ga0065704_10101210 3300005289 Bacteria 2246
13 Ga0065707_10088541 3300005295 Bacteria 4629
14 Ga0065707_10188119 3300005295 Bacteria 1377
15 Ga0070683_100025005 3300005329 Bacteria 5356
16 Ga0070690_100205498 3300005330 Bacteria 1372
17 Ga0070670_100020270 3300005331 Bacteria 5713
18 Ga0070670_100032620 3300005331 Bacteria 4486
19 Ga0070670_100035816 3300005331 Bacteria 4272
20 Ga0068869_100137424 3300005334 Bacteria 1884
21 Ga0070666_10139386 3300005335 Bacteria 1689
22 Ga0070682_100020469 3300005337 Bacteria 3892
23 Ga0068868_100019295 3300005338 Bacteria 5108
24 Ga0068868_100154416 3300005338 Bacteria 1892
25 Ga0070660_100018715 3300005339 Bacteria 5066
26 Ga0070660_100127780 3300005339 Bacteria 2032
27 Ga0070691_10010204 3300005341 Bacteria 4283
28 Ga0070661_100038728 3300005344 Bacteria 3471
29 Ga0070675_100439360 3300005354 Bacteria 1169
30 Ga0070671_100050911 3300005355 Bacteria 3445
31 Ga0070674_100561153 3300005356 Bacteria 959
32 Ga0070673_100013763 3300005364 Bacteria 5611
33 Ga0070673_100524841 3300005364 Bacteria 1073
34 Ga0070673_100525186 3300005364 Unclassified 1073
35 Ga0070659_100028075 3300005366 Bacteria 4342
36 Ga0070709_10193545 3300005434 Bacteria 1436
37 Ga0070713_100044903 3300005436 Bacteria 3619
38 Ga0070700_100086954 3300005441 Bacteria 2031
39 Ga0070694_100210129 3300005444 Bacteria 1455
40 Ga0070662_100021170 3300005457 Bacteria 4438
41 Ga0070681_10138109 3300005458 Bacteria 2367
42 Ga0070681_10250066 3300005458 Bacteria 1685
43 Ga0068867_100165678 3300005459 Bacteria 1746
44 Ga0070685_10035119 3300005466 Bacteria 2827
45 Ga0070684_100115144 3300005535 Bacteria 2414
46 Ga0068853_100002017 3300005539 Bacteria 15010
47 Ga0068853_100012828 3300005539 Bacteria 6826
48 Ga0070665_100000013 3300005548 Bacteria 484927
49 Ga0068855_100044591 3300005563 Bacteria 5248
50 Ga0070664_100139184 3300005564 Bacteria 2136
51 Ga0068857_100003190 3300005577 Bacteria 13597
52 Ga0068857_100042788 3300005577 Bacteria 4019
53 Ga0068857_100116168 3300005577 Bacteria 2407
54 Ga0068856_100199537 3300005614 Bacteria 2015
55 Ga0068852_100005618 3300005616 Bacteria 8995
56 Ga0068852_100041718 3300005616 Bacteria 3880
57 Ga0068852_100736948 3300005616 Bacteria 997
58 Ga0068859_100032535 3300005617 Bacteria 5238
59 Ga0068859_100066384 3300005617 Bacteria 3643
60 Ga0068864_100049109 3300005618 Bacteria 3629
61 Ga0068864_100059667 3300005618 Bacteria 3301
62 Ga0068851_10072334 3300005834 Unclassified 1786
63 Ga0068863_100306382 3300005841 Bacteria 1541
64 Ga0068858_100009660 3300005842 Bacteria 9192
65 Ga0068860_100000138 3300005843 Bacteria 119368
66 Ga0068860_100026962 3300005843 Bacteria 5537
67 Ga0068860_100031075 3300005843 Bacteria 5135
68 Ga0068860_100036841 3300005843 Bacteria 4684
69 Ga0068860_100052154 3300005843 Bacteria 3891
70 Ga0068862_100019860 3300005844 Bacteria 5610
71 Ga0070717_10444726 3300006028 Bacteria 1168
72 Ga0075365_10084371 3300006038 Bacteria 2156
73 Ga0075368_10084981 3300006042 Bacteria 1290
74 Ga0075363_100206719 3300006048 Bacteria 1123
75 Ga0075364_10008301 3300006051 Bacteria 6202
76 Ga0070716_100347998 3300006173 Bacteria 1048
77 Ga0075362_10001697 3300006177 Bacteria 7142
78 Ga0075367_10016899 3300006178 Bacteria 3993
79 Ga0075366_10037550 3300006195 Bacteria 2861
80 Ga0097621_100012954 3300006237 Bacteria 6197
81 Ga0097621_100254219 3300006237 Unclassified 1539
82 Ga0075370_10118433 3300006353 Bacteria 1540
83 Ga0068871_100167314 3300006358 Bacteria 1883
84 Ga0075428_100001033 3300006844 Bacteria 29496
85 Ga0075430_100035653 3300006846 Bacteria 4220
86 Ga0068865_100004777 3300006881 Bacteria 8191
87 Ga0068865_100819160 3300006881 Bacteria 804
88 Ga0097620_100032535 3300006931 Bacteria 5238
89 Ga0097620_100066384 3300006931 Bacteria 3643
90 Ga0105240_10000039 3300009093 Bacteria 270117
91 Ga0105240_10000165 3300009093 Bacteria 134738
92 Ga0105240_10000288 3300009093 Bacteria 98146
93 Ga0105240_10000289 3300009093 Bacteria 98095
94 Ga0105240_10029879 3300009093 Bacteria 7092
95 Ga0105240_10060142 3300009093 Bacteria 4737
96 Ga0105240_10149555 3300009093 Bacteria 2783
97 Ga0111539_10112787 3300009094 Bacteria 3189
98 Ga0105241_10002727 3300009174 Bacteria 13232
99 Ga0105241_10016163 3300009174 Bacteria 5469
100 Ga0105241_10209610 3300009174 Unclassified 1632
101 Ga0105237_10002779 3300009545 Bacteria 21256
102 Ga0105237_10005376 3300009545 Bacteria 14479
103 Ga0105237_10007977 3300009545 Bacteria 11530
104 Ga0105237_10010349 3300009545 Bacteria 9932
105 Ga0105237_10080271 3300009545 Bacteria 3252
106 Ga0105237_10151113 3300009545 Bacteria 2319
107 Ga0105238_10003436 3300009551 Bacteria 15777
108 Ga0105238_10007190 3300009551 Bacteria 11139
109 Ga0105249_10051001 3300009553 Bacteria 3773
110 Ga0105249_10290993 3300009553 Bacteria 1635
111 Ga0105249_10682068 3300009553 Bacteria 1087
112 Ga0105249_11029372 3300009553 Bacteria 893
113 Ga0105239_10002099 3300010375 Bacteria 25805
114 Ga0105239_10002738 3300010375 Bacteria 22132
115 Ga0105239_10009562 3300010375 Bacteria 10908
116 Ga0105239_10010711 3300010375 Bacteria 10243
117 Ga0105239_10034185 3300010375 Bacteria 5581
118 Ga0105239_10678927 3300010375 Bacteria 1177
119 Ga0105239_10717139 3300010375 Bacteria 1144
120 Ga0105246_10299675 3300011119 Unclassified 1297
121 Ga0157373_10000005 3300013100 Bacteria 262158
122 Ga0157373_10019198 3300013100 Bacteria 4977
123 Ga0157373_10025872 3300013100 Bacteria 4241
124 Ga0157371_10025312 3300013102 Bacteria 4326
125 Ga0157371_10172110 3300013102 Bacteria 1548
126 Ga0157370_10014888 3300013104 Bacteria 7935
127 Ga0157370_10149638 3300013104 Bacteria 2173
128 Ga0157370_10607144 3300013104 Bacteria 1001
129 Ga0157369_10018091 3300013105 Bacteria 7904
130 Ga0157369_10027143 3300013105 Bacteria 6349
131 Ga0157374_10023239 3300013296 Bacteria 5542
132 Ga0157378_10002980 3300013297 Bacteria 15036
133 Ga0157378_10080123 3300013297 Bacteria 2950
134 Ga0157378_10540890 3300013297 Bacteria 1169
135 Ga0157378_10962021 3300013297 Bacteria 887
136 Ga0163162_10001554 3300013306 Bacteria 21463
137 Ga0163162_10821658 3300013306 Unclassified 1046
138 Ga0157372_10001950 3300013307 Bacteria 22402
139 Ga0157372_10025566 3300013307 Bacteria 6422
140 Ga0157372_10034375 3300013307 Bacteria 5572
141 Ga0157372_10061278 3300013307 Bacteria 4212
142 Ga0157372_10093998 3300013307 Bacteria 3413
143 Ga0163163_10224129 3300014325 Bacteria 1929
144 Ga0182008_10000037 3300014497 Bacteria 129884
145 Ga0157377_10160472 3300014745 Bacteria 1398
146 Ga0157377_10487620 3300014745 Unclassified 859
147 Ga0209026_1000246 3300025250 Bacteria 69164
148 Ga0209026_1022816 3300025250 Bacteria 957
149 Ga0207642_10081165 3300025899 Bacteria 1575
150 Ga0207680_10380350 3300025903 Bacteria 995
151 Ga0207647_10025730 3300025904 Bacteria 3860
152 Ga0207654_10018822 3300025911 Bacteria 3631
153 Ga0207654_10231109 3300025911 Bacteria 1232
154 Ga0207707_10040526 3300025912 Bacteria 4068
155 Ga0207695_10000027 3300025913 Bacteria 612456
156 Ga0207695_10000058 3300025913 Bacteria 366582
157 Ga0207695_10000247 3300025913 Bacteria 140966
158 Ga0207695_10001063 3300025913 Bacteria 48025
159 Ga0207695_10049551 3300025913 Unclassified 4426
160 Ga0207695_10067106 3300025913 Bacteria 3681
161 Ga0207695_10081502 3300025913 Bacteria 3274
162 Ga0207671_10000456 3300025914 Bacteria 56238
163 Ga0207671_10004433 3300025914 Bacteria 13436
164 Ga0207671_10016536 3300025914 Bacteria 5729
165 Ga0207671_10019770 3300025914 Bacteria 5141
166 Ga0207671_10040493 3300025914 Bacteria 3449
167 Ga0207657_10003056 3300025919 Bacteria 17905
168 Ga0207649_10031708 3300025920 Unclassified 3144
169 Ga0207681_10248362 3300025923 Bacteria 1388
170 Ga0207694_10010098 3300025924 Bacteria 7114
171 Ga0207694_10091278 3300025924 Bacteria 2404
172 Ga0207694_10287565 3300025924 Bacteria 1351
173 Ga0207650_10027259 3300025925 Bacteria 4088
174 Ga0207650_10069007 3300025925 Bacteria 2655
175 Ga0207650_10159901 3300025925 Bacteria 1784
176 Ga0207644_10326127 3300025931 Unclassified 1242
177 Ga0207706_10002652 3300025933 Bacteria 17429
178 Ga0207689_10112632 3300025942 Bacteria 2236
179 Ga0207667_10009316 3300025949 Bacteria 11581
180 Ga0207651_10119406 3300025960 Bacteria 1996
181 Ga0207712_10490203 3300025961 Bacteria 1049
182 Ga0207712_10570329 3300025961 Bacteria 975
183 Ga0207658_10100116 3300025986 Bacteria 2268
184 Ga0207658_10553662 3300025986 Bacteria 1029
185 Ga0207677_10007479 3300026023 Bacteria 6048
186 Ga0207677_10013772 3300026023 Bacteria 4697
187 Ga0207702_10136370 3300026078 Unclassified 2215
188 Ga0207641_10028898 3300026088 Bacteria 4583
189 Ga0207641_10163088 3300026088 Bacteria 2028
190 Ga0207648_10196408 3300026089 Bacteria 1789
191 Ga0207676_10058950 3300026095 Bacteria 3030
192 Ga0207676_10120729 3300026095 Bacteria 2210
193 Ga0207674_10065198 3300026116 Bacteria 3672
194 Ga0207698_10029428 3300026142 Bacteria 3934
195 Ga0207698_10378494 3300026142 Bacteria 1346
196 Ga0207698_10394110 3300026142 Unclassified 1321
197 Ga0268266_10000024 3300028379 Bacteria 490820
198 Ga0268264_10000109 3300028381 Bacteria 208477
199 Ga0268264_10009666 3300028381 Bacteria 7989
200 Ga0268264_10017536 3300028381 Bacteria 5864
201 Ga0268264_10019657 3300028381 Bacteria 5517
202 Ga0268264_10039743 3300028381 Bacteria 3887
203 Ga0307511_10005234 3300030521 Bacteria 13209
204 Ga0265762_1009338 3300030760 Bacteria 1748
205 Ga0265327_10025168 3300031251 Bacteria 3477
206 Ga0265313_10018352 3300031595 Bacteria 3930
207 Ga0307516_10001627 3300031730 Bacteria 30950
208 Ga0307516_10085047 3300031730 Bacteria 3001
209 Ga0307412_10000283 3300031911 Bacteria 32305
210 Ga0307409_100085152 3300031995 Bacteria 2569
211 Ga0307414_10000046 3300032004 Bacteria 133496
212 Ga0307414_10189661 3300032004 Bacteria 1662
213 Ga0307510_10148137 3300033180 Bacteria 1973
214 Ga0373933_0132586 3300035724 Bacteria 1568
215 Ga0373937_0004060 3300036401 Bacteria 12404
216 Ga0373925_0039829 3300037068 Bacteria 3477
217 Ga0395905_0020188 3300037471 Bacteria 6311
218 Ga0436365_0429683 3300039437 Bacteria 3783
219 Ga0436365_0999976 3300039437 Bacteria 2389
220 Ga0436361_0064318 3300039447 Bacteria 949
221 Ga0451793_0876513 3300041452 Bacteria 873
222 Ga0439445_0000001 3300042004 Bacteria 97032
223 Ga0439449_0077663 3300042007 Bacteria 1224
224 Ga0439457_000119 3300042014 Bacteria 19152
225 Ga0439435_0034770 3300042436 Bacteria 1387
226 Ga0466969_0046868 3300044656 Bacteria 2142
227 Ga0466972_0074152 3300044658 Bacteria 1621
228 Ga0466961_0209862 3300044693 Unclassified 1202
229 Ga0466964_0014450 3300044706 Bacteria 3004
230 Ga0466971_0036857 3300044719 Unclassified 2193
231 Ga0466968_0023970 3300044735 Bacteria 2491
232 Ga0466970_0000038 3300044765 Bacteria 47830
233 Ga0466957_0000084 3300044842 Bacteria 37711
234 Ga0466960_0115989 3300044901 Bacteria 1397
235 Ga0466959_0125701 3300045049 Unclassified 1820
236 Ga0466958_0130664 3300045836 Unclassified 1577
237 Ga0495627_032882 3300046453 Bacteria 1629
238 Ga0495606_0004987 3300046507 Bacteria 12946
239 Ga0495608_0055590 3300046511 Bacteria 2616
240 Ga0495643_0024420 3300046522 Bacteria 3429
241 Ga0495643_0074757 3300046522 Bacteria 1774
242 Ga0495648_0002880 3300046524 Bacteria 15492
243 Ga0495609_0000025 3300046538 Bacteria 256898
244 Ga0495633_0000562 3300046558 Bacteria 36317
245 Ga0495649_0047364 3300046694 Bacteria 2338
246 Ga0495687_000014 3300047443 Bacteria 366896
247 Ga0495686_0000034 3300047472 Bacteria 325038
248 Ga0495686_0000386 3300047472 Bacteria 70225
249 Ga0496106_0630800 3300048909 Bacteria 857
250 Ga0496113_0120820 3300048916 Unclassified 2048
251 Ga0496115_0121908 3300048918 Bacteria 2146
252 Ga0496124_0094839 3300048927 Bacteria 2426
253 Ga0501241_000020 3300049758 Bacteria 83005
254 nmdc:mga03683_3836_c1 3300050489 Bacteria 4909
255 nmdc:mga03n38_64615_c1 3300050490 Bacteria 1675
256 nmdc:mga0yw44_192518_c1 3300050492 Bacteria 1345
257 nmdc:mga0yw44_37531_c1 3300050492 Bacteria 2861
258 nmdc:mga0k408_157930_c1 3300050493 Bacteria 1351
259 nmdc:mga0k408_37414_c1 3300050493 Bacteria 2786
260 nmdc:mga06z11_9545_c1 3300050494 Bacteria 4093
261 nmdc:mga07m45_207542_c1 3300050496 Bacteria 1140
262 nmdc:mga09592_672365_c1 3300050508 Bacteria 883
263 nmdc:mga06r32_118662_c1 3300050510 Bacteria 2608
264 Ga0495595_0175009 3300053084 Bacteria 1063
265 Ga0500644_0029889 3300053088 Bacteria 1718
266 Ga0500644_0032181 3300053088 Unclassified 1674
267 Ga0500583_0004525 3300053092 Bacteria 4546
268 Ga0500642_0011527 3300053130 Bacteria 3166
269 Ga0500622_0005110 3300053156 Bacteria 7968
270 2738698314 2738541273 Bacteria 4048577
271 2739252640 2738543014 Bacteria 4048139
272 2819586644 2818991444 Bacteria 6968812
273 8055636585 8055632911 Bacteria 5283357
274 Ga0070691_10165557
275 rootH1_10060220
276 rootH1_10074120
277 rootH2_10000031
278 rootH2_10007492
279 rootH2_10048257
280 rootH2_10245220
281 rootL2_10297671
282 rootH1_10080608
283 rootH1_10092001
284 Ga0065704_10101210
285 Ga0065707_10088541
286 Ga0065707_10188119
287 Ga0070683_100025005
288 Ga0070690_100205498
289 Ga0070670_100020270
290 Ga0070670_100032620
291 Ga0070670_100035816
292 Ga0068869_100137424
293 Ga0070666_10139386
294 Ga0070682_100020469
295 Ga0068868_100019295
296 Ga0068868_100154416
297 Ga0070660_100018715
298 Ga0070660_100127780
299 Ga0070691_10010204
300 Ga0070661_100038728
301 Ga0070675_100439360
302 Ga0070671_100050911
303 Ga0070674_100561153
304 Ga0070673_100013763
305 Ga0070673_100524841
306 Ga0070673_100525186
307 Ga0070659_100028075
308 Ga0070709_10193545
309 Ga0070713_100044903
310 Ga0070700_100086954
311 Ga0070694_100210129
312 Ga0070662_100021170
313 Ga0070681_10138109
314 Ga0070681_10250066
315 Ga0068867_100165678
316 Ga0070685_10035119
317 Ga0070684_100115144
318 Ga0068853_100002017
319 Ga0068853_100012828
320 Ga0070665_100000013
321 Ga0068855_100044591
322 Ga0070664_100139184
323 Ga0068857_100003190
324 Ga0068857_100042788
325 Ga0068857_100116168
326 Ga0068856_100199537
327 Ga0068852_100005618
328 Ga0068852_100041718
329 Ga0068852_100736948
330 Ga0068859_100032535
331 Ga0068859_100066384
332 Ga0068864_100049109
333 Ga0068864_100059667
334 Ga0068851_10072334
335 Ga0068863_100306382
336 Ga0068858_100009660
337 Ga0068860_100000138
338 Ga0068860_100026962
339 Ga0068860_100031075
340 Ga0068860_100036841
341 Ga0068860_100052154
342 Ga0068862_100019860
343 Ga0070717_10444726
344 Ga0075365_10084371
345 Ga0075368_10084981
346 Ga0075363_100206719
347 Ga0075364_10008301
348 Ga0070716_100347998
349 Ga0075362_10001697
350 Ga0075367_10016899
351 Ga0075366_10037550
352 Ga0097621_100012954
353 Ga0097621_100254219
354 Ga0075370_10118433
355 Ga0068871_100167314
356 Ga0075428_100001033
357 Ga0075430_100035653
358 Ga0068865_100004777
359 Ga0068865_100819160
360 Ga0097620_100032535
361 Ga0097620_100066384
362 Ga0105240_10000039
363 Ga0105240_10000165
364 Ga0105240_10000288
365 Ga0105240_10000289
366 Ga0105240_10029879
367 Ga0105240_10060142
368 Ga0105240_10149555
369 Ga0111539_10112787
370 Ga0105241_10002727
371 Ga0105241_10016163
372 Ga0105241_10209610
373 Ga0105237_10002779
374 Ga0105237_10005376
375 Ga0105237_10007977
376 Ga0105237_10010349
377 Ga0105237_10080271
378 Ga0105237_10151113
379 Ga0105238_10003436
380 Ga0105238_10007190
381 Ga0105249_10051001
382 Ga0105249_10290993
383 Ga0105249_10682068
384 Ga0105249_11029372
385 Ga0105239_10002099
386 Ga0105239_10002738
387 Ga0105239_10009562
388 Ga0105239_10010711
389 Ga0105239_10034185
390 Ga0105239_10678927
391 Ga0105239_10717139
392 Ga0105246_10299675
393 Ga0157373_10000005
394 Ga0157373_10019198
395 Ga0157373_10025872
396 Ga0157371_10025312
397 Ga0157371_10172110
398 Ga0157370_10014888
399 Ga0157370_10149638
400 Ga0157370_10607144
401 Ga0157369_10018091
402 Ga0157369_10027143
403 Ga0157374_10023239
404 Ga0157378_10002980
405 Ga0157378_10080123
406 Ga0157378_10540890
407 Ga0157378_10962021
408 Ga0163162_10001554
409 Ga0163162_10821658
410 Ga0157372_10001950
411 Ga0157372_10025566
412 Ga0157372_10034375
413 Ga0157372_10061278
414 Ga0157372_10093998
415 Ga0163163_10224129
416 Ga0182008_10000037
417 Ga0157377_10160472
418 Ga0157377_10487620
419 Ga0209026_1000246
420 Ga0209026_1022816
421 Ga0207642_10081165
422 Ga0207680_10380350
423 Ga0207647_10025730
424 Ga0207654_10018822
425 Ga0207654_10231109
426 Ga0207707_10040526
427 Ga0207695_10000027
428 Ga0207695_10000058
429 Ga0207695_10000247
430 Ga0207695_10001063
431 Ga0207695_10049551
432 Ga0207695_10067106
433 Ga0207695_10081502
434 Ga0207671_10000456
435 Ga0207671_10004433
436 Ga0207671_10016536
437 Ga0207671_10019770
438 Ga0207671_10040493
439 Ga0207657_10003056
440 Ga0207649_10031708
441 Ga0207681_10248362
442 Ga0207694_10010098
443 Ga0207694_10091278
444 Ga0207694_10287565
445 Ga0207650_10027259
446 Ga0207650_10069007
447 Ga0207650_10159901
448 Ga0207644_10326127
449 Ga0207706_10002652
450 Ga0207689_10112632
451 Ga0207667_10009316
452 Ga0207651_10119406
453 Ga0207712_10490203
454 Ga0207712_10570329
455 Ga0207658_10100116
456 Ga0207658_10553662
457 Ga0207677_10007479
458 Ga0207677_10013772
459 Ga0207702_10136370
460 Ga0207641_10028898
461 Ga0207641_10163088
462 Ga0207648_10196408
463 Ga0207676_10058950
464 Ga0207676_10120729
465 Ga0207674_10065198
466 Ga0207698_10029428
467 Ga0207698_10378494
468 Ga0207698_10394110
469 Ga0268266_10000024
470 Ga0268264_10000109
471 Ga0268264_10009666
472 Ga0268264_10017536
473 Ga0268264_10019657
474 Ga0268264_10039743
475 Ga0307511_10005234
476 Ga0265762_1009338
477 Ga0265327_10025168
478 Ga0265313_10018352
479 Ga0307516_10001627
480 Ga0307516_10085047
481 Ga0307412_10000283
482 Ga0307409_100085152
483 Ga0307414_10000046
484 Ga0307414_10189661
485 Ga0307510_10148137
486 Ga0373933_0132586
487 Ga0373937_0004060
488 Ga0373925_0039829
489 Ga0395905_0020188
490 Ga0436365_0429683
491 Ga0436365_0999976
492 Ga0436361_0064318
493 Ga0451793_0876513
494 Ga0439445_0000001
495 Ga0439449_0077663
496 Ga0439457_000119
497 Ga0439435_0034770
498 Ga0466969_0046868
499 Ga0466972_0074152
500 Ga0466961_0209862
501 Ga0466964_0014450
502 Ga0466971_0036857
503 Ga0466968_0023970
504 Ga0466970_0000038
505 Ga0466957_0000084
506 Ga0466960_0115989
507 Ga0466959_0125701
508 Ga0466958_0130664
509 Ga0495627_032882
510 Ga0495606_0004987
511 Ga0495608_0055590
512 Ga0495643_0024420
513 Ga0495643_0074757
514 Ga0495648_0002880
515 Ga0495609_0000025
516 Ga0495633_0000562
517 Ga0495649_0047364
518 Ga0495687_000014
519 Ga0495686_0000034
520 Ga0495686_0000386
521 Ga0496106_0630800
522 Ga0496113_0120820
523 Ga0496115_0121908
524 Ga0496124_0094839
525 Ga0501241_000020
526 nmdc:mga03683_3836_c1
527 nmdc:mga03n38_64615_c1
528 nmdc:mga0yw44_192518_c1
529 nmdc:mga0yw44_37531_c1
530 nmdc:mga0k408_157930_c1
531 nmdc:mga0k408_37414_c1
532 nmdc:mga06z11_9545_c1
533 nmdc:mga07m45_207542_c1
534 nmdc:mga09592_672365_c1
535 nmdc:mga06r32_118662_c1
536 Ga0495595_0175009
537 Ga0500644_0029889
538 Ga0500644_0032181
539 Ga0500583_0004525
540 Ga0500642_0011527
541 Ga0500622_0005110
542 2738698314
543 2739252640
544 2819586644
545 8055636585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

233

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

287

0.95

PF08659

KR

KR domain

45

207

0.89

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

46

174

0.8

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

46

248

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

47

196

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9614 4 252
4dqx-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9581 1 249
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9575 3 250
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9571 1 253
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9569 4 250
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9594 4 250 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 4 184 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 90 189 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 4 251 3.40.50.720
3ai1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.954 2 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y2DK82-F1-model_v4 SDR family oxidoreductase 0.9931 101 256 GO:0016491
AF-A0A2V7UPC8-F1-model_v4 Short-chain dehydrogenase 0.9862 1 252 GO:0016491
AF-A0A1G9SIE7-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9857 2 256 GO:0016491
AF-A0A382VJQ9-F1-model_v4 Short-chain dehydrogenase 0.9853 2 255 GO:0016491
AF-A0A3N5NYA9-F1-model_v4 SDR family oxidoreductase 0.985 51 253 GO:0016491

Map