F378300

General Info

Members Datasets Scaffolds Average Seq Length
272 193 258 378

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000232|Ga0105251_1000023257
Length 442
Sequence LNEAEQLMRMLAYGQVHFTSSRLRAFAPLRAPILFILAPPRLRASAPPSEPQQKDRTMSLIQDLITAFKGAEPRVPLARGGGSPWFFADRGGSRAPFAYDTAVRRAYLENPVAQRAVRLVAEGIAGAPLLPTDPALAALIAATSAGQALTETLASHLLLHGNAFVQVLKDARGRPVELFALRPERMRVVADADGWPSAWTYTVAGRPVTIPIEDETGAPNLIHIRHFHPADDHYGAGCLIAAEQAVAIHNAAADWNRQILENSARPSGALVYDTGDGGTLTADQFDRLREELGRTFAGAANAGRPLLLEGGLKWQAMALSPADMDFATLKAAAARDIALAFGVPPMLLGLPGDATYANYREANRALWRLTLLPLAAKLLGALAEGLSPWFGDAKLQVDFDRVPALAEDRERLWAQVSAADFLDPAEKRAMLGLPDKVERNKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
6 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
9 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
10 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
11 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
12 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
13 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
185 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
189 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
190 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
193 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.53
Nodule 0.37
Rhizoplane 4.78
Rhizosphere 61.03
Stem 0
Stem Tuber 0
Unclassified 10.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_802780 2162886007 Bacteria 22516
2 JGI25153J46596_10000032 3300003215 Bacteria 196732
3 Ga0055526_1000606 3300003771 Bacteria 27941
4 Ga0055537_1003845 3300003773 Bacteria 4491
5 Ga0055524_1000154 3300003775 Bacteria 80540
6 Ga0055530_10000235 3300003791 Bacteria 49659
7 Ga0055531_10000361 3300003794 Bacteria 44091
8 Ga0055531_10003354 3300003794 Bacteria 10235
9 Ga0065165_1001318 3300005262 Bacteria 27669
10 Ga0065165_1009630 3300005262 Bacteria 4299
11 Ga0065704_10000316 3300005289 Bacteria 45883
12 Ga0065704_10014515 3300005289 Bacteria 2231
13 Ga0065707_10107262 3300005295 Bacteria 2562
14 Ga0070658_10179555 3300005327 Bacteria 1781
15 Ga0070683_100050570 3300005329 Bacteria 3848
16 Ga0070680_100002866 3300005336 Bacteria 12801
17 Ga0070660_100283681 3300005339 Bacteria 1355
18 Ga0070661_100000042 3300005344 Bacteria 99327
19 Ga0070692_10033690 3300005345 Bacteria 2582
20 Ga0070668_100088564 3300005347 Bacteria 2437
21 Ga0070669_100000897 3300005353 Bacteria 21671
22 Ga0070669_100001229 3300005353 Bacteria 18600
23 Ga0070671_100003120 3300005355 Bacteria 12907
24 Ga0070659_100010932 3300005366 Bacteria 6699
25 Ga0070667_100019809 3300005367 Bacteria 5582
26 Ga0070667_100301991 3300005367 Bacteria 1442
27 Ga0070663_100033663 3300005455 Bacteria 3542
28 Ga0070662_100003148 3300005457 Bacteria 10250
29 Ga0070679_100000002 3300005530 Bacteria 312066
30 Ga0068853_100018009 3300005539 Bacteria 5839
31 Ga0070665_100118434 3300005548 Bacteria 2650
32 Ga0070665_100119600 3300005548 Bacteria 2636
33 Ga0070665_100124864 3300005548 Bacteria 2576
34 Ga0068855_100326885 3300005563 Bacteria 1693
35 Ga0068864_100004270 3300005618 Bacteria 11754
36 Ga0068863_100000115 3300005841 Bacteria 85274
37 Ga0068863_100011726 3300005841 Bacteria 8477
38 Ga0068863_100052340 3300005841 Bacteria 3870
39 Ga0068863_100144380 3300005841 Bacteria 2276
40 Ga0068858_100007649 3300005842 Bacteria 10438
41 Ga0068858_100035549 3300005842 Bacteria 4621
42 Ga0068858_100042409 3300005842 Bacteria 4219
43 Ga0068858_100057121 3300005842 Bacteria 3607
44 Ga0068860_100000319 3300005843 Bacteria 65229
45 Ga0068860_100035621 3300005843 Bacteria 4772
46 Ga0068862_100198847 3300005844 Bacteria 1806
47 Ga0068862_100328450 3300005844 Bacteria 1414
48 Ga0075368_10002911 3300006042 Bacteria 5656
49 Ga0075363_100005993 3300006048 Bacteria 5480
50 Ga0075362_10003563 3300006177 Bacteria 5466
51 Ga0075367_10049864 3300006178 Bacteria 2469
52 Ga0075369_10071803 3300006186 Bacteria 1524
53 Ga0075370_10014848 3300006353 Bacteria 4160
54 Ga0075433_10032679 3300006852 Bacteria 4458
55 Ga0079104_1007806 3300006946 Bacteria 3821
56 Ga0105251_10000232 3300009011 Bacteria 56006
57 Ga0105240_10371551 3300009093 Bacteria 1617
58 Ga0105240_10481061 3300009093 Bacteria 1384
59 Ga0105248_10038177 3300009177 Bacteria 5374
60 Ga0105237_10031561 3300009545 Bacteria 5368
61 Ga0105249_10065834 3300009553 Bacteria 3335
62 Ga0163162_10036534 3300013306 Bacteria 4897
63 Ga0163162_10128763 3300013306 Bacteria 2639
64 Ga0183363_1007 3300015690 Bacteria 315687
65 Ga0213873_10000024 3300021358 Bacteria 92932
66 Ga0213874_10029667 3300021377 Bacteria 1571
67 Ga0213876_10000105 3300021384 Bacteria 92932
68 Ga0207425_1000025 3300025245 Bacteria 321872
69 Ga0209129_1007182 3300025258 Bacteria 3385
70 Ga0209565_1000007 3300025263 Bacteria 784361
71 Ga0209565_1000044 3300025263 Bacteria 229969
72 Ga0209673_1002047 3300025273 Bacteria 15276
73 Ga0209675_1013132 3300025291 Bacteria 2616
74 Ga0209676_1009270 3300025292 Bacteria 4265
75 Ga0209025_1000176 3300025294 Bacteria 158186
76 Ga0209564_1000886 3300025295 Bacteria 39513
77 Ga0209564_1014955 3300025295 Bacteria 3190
78 Ga0209758_1000002 3300025297 Bacteria 1400310
79 Ga0209050_1000001 3300025298 Bacteria 3563507
80 Ga0209050_1000071 3300025298 Bacteria 295478
81 Ga0209050_1000350 3300025298 Bacteria 88878
82 Ga0209050_1001670 3300025298 Bacteria 22344
83 Ga0209050_1004285 3300025298 Bacteria 9768
84 Ga0209050_1010766 3300025298 Bacteria 4453
85 Ga0209256_1000008 3300025299 Bacteria 975723
86 Ga0207426_1015559 3300025302 Bacteria 2756
87 Ga0209051_1000919 3300025303 Bacteria 29216
88 Ga0209257_1000027 3300025304 Bacteria 703541
89 Ga0209257_1002786 3300025304 Bacteria 16497
90 Ga0209257_1002907 3300025304 Bacteria 15827
91 Ga0209257_1012097 3300025304 Bacteria 4046
92 Ga0207713_1001029 3300025735 Bacteria 24264
93 Ga0207705_10012322 3300025909 Bacteria 6177
94 Ga0207671_10009010 3300025914 Bacteria 8393
95 Ga0207660_10004400 3300025917 Bacteria 9185
96 Ga0207657_10012945 3300025919 Bacteria 8202
97 Ga0207657_10023092 3300025919 Bacteria 5800
98 Ga0207649_10000047 3300025920 Bacteria 110856
99 Ga0207652_10000001 3300025921 Bacteria 1006643
100 Ga0207652_10000002 3300025921 Bacteria 878035
101 Ga0207681_10000992 3300025923 Bacteria 18549
102 Ga0207681_10002110 3300025923 Bacteria 12736
103 Ga0207644_10000275 3300025931 Bacteria 34149
104 Ga0207690_10047744 3300025932 Bacteria 2843
105 Ga0207706_10001226 3300025933 Bacteria 25940
106 Ga0207691_10027121 3300025940 Bacteria 5374
107 Ga0207711_10003741 3300025941 Bacteria 13116
108 Ga0207711_10080350 3300025941 Bacteria 2848
109 Ga0207689_10125214 3300025942 Bacteria 2114
110 Ga0207668_10003960 3300025972 Bacteria 8729
111 Ga0207668_10065827 3300025972 Bacteria 2566
112 Ga0207658_10006441 3300025986 Bacteria 8013
113 Ga0207703_10004429 3300026035 Bacteria 11536
114 Ga0207703_10022684 3300026035 Bacteria 4929
115 Ga0207703_10367388 3300026035 Bacteria 1328
116 Ga0207639_10063592 3300026041 Bacteria 2858
117 Ga0207639_10104921 3300026041 Bacteria 2292
118 Ga0207678_10213040 3300026067 Bacteria 1653
119 Ga0207641_10000440 3300026088 Bacteria 47606
120 Ga0207641_10010204 3300026088 Bacteria 7725
121 Ga0207641_10018264 3300026088 Bacteria 5748
122 Ga0207641_10022519 3300026088 Bacteria 5185
123 Ga0207641_10055841 3300026088 Bacteria 3354
124 Ga0207674_10034400 3300026116 Bacteria 5297
125 Ga0207698_10064726 3300026142 Bacteria 2867
126 Ga0209983_1008367 3300027665 Bacteria 2115
127 Ga0209813_10000138 3300027866 Bacteria 25302
128 Ga0268266_10092678 3300028379 Bacteria 2651
129 Ga0268266_10182941 3300028379 Bacteria 1909
130 Ga0268265_10041245 3300028380 Bacteria 3414
131 Ga0268264_10000714 3300028381 Bacteria 38177
132 Ga0268264_10006581 3300028381 Bacteria 9783
133 Ga0268264_10039852 3300028381 Bacteria 3881
134 Ga0268256_1018277 3300030500 Bacteria 1950
135 Ga0307413_10034804 3300031824 Bacteria 2882
136 Ga0307413_10202490 3300031824 Bacteria 1435
137 Ga0307406_10095637 3300031901 Bacteria 2010
138 Ga0307412_10029440 3300031911 Bacteria 3446
139 Ga0307412_10038153 3300031911 Bacteria 3091
140 Ga0307414_10026556 3300032004 Bacteria 3728
141 Ga0307414_10065707 3300032004 Bacteria 2589
142 Ga0307414_10095435 3300032004 Bacteria 2222
143 Ga0307411_10084583 3300032005 Bacteria 2195
144 Ga0373931_0026600 3300035691 Bacteria 2946
145 Ga0395899_0047836 3300037312 Bacteria 3183
146 Ga0395900_0025021 3300037418 Bacteria 6110
147 Ga0395905_0001293 3300037471 Bacteria 30747
148 Ga0395901_0000889 3300038443 Bacteria 32885
149 Ga0395901_0028735 3300038443 Bacteria 5721
150 Ga0395901_0130605 3300038443 Bacteria 2639
151 Ga0436365_0753794 3300039437 Bacteria 1491
152 Ga0436365_1119321 3300039437 Bacteria 66778
153 Ga0436363_1667982 3300039450 Bacteria 1795
154 Ga0436362_0837799 3300039453 Bacteria 65721
155 Ga0439461_0000216 3300041410 Bacteria 8235
156 Ga0439465_0003731 3300041413 Bacteria 4965
157 Ga0439431_0000304 3300041997 Bacteria 10130
158 Ga0439442_004360 3300042002 Bacteria 2808
159 Ga0439432_002069 3300042006 Bacteria 7580
160 Ga0439432_025005 3300042006 Bacteria 1961
161 Ga0439449_0077327 3300042007 Bacteria 1227
162 Ga0439457_014580 3300042014 Bacteria 1758
163 Ga0439462_0000978 3300042015 Bacteria 6094
164 Ga0439434_0004044 3300042435 Bacteria 4281
165 Ga0451576_0000024 3300045051 Bacteria 470499
166 Ga0451576_0004329 3300045051 Bacteria 18539
167 Ga0495596_0000153 3300046500 Bacteria 47822
168 Ga0495596_0007367 3300046500 Bacteria 4967
169 Ga0495607_0059223 3300046501 Bacteria 2185
170 Ga0495583_0025261 3300046506 Bacteria 2971
171 Ga0495606_0006535 3300046507 Bacteria 10723
172 Ga0495606_0043263 3300046507 Bacteria 3005
173 Ga0495610_0000015 3300046512 Bacteria 391489
174 Ga0495610_0001472 3300046512 Bacteria 20775
175 Ga0495610_0001997 3300046512 Bacteria 17425
176 Ga0495632_0001085 3300046519 Bacteria 23323
177 Ga0495632_0008546 3300046519 Bacteria 6266
178 Ga0495643_0000080 3300046522 Bacteria 161872
179 Ga0495609_0019666 3300046538 Bacteria 3122
180 Ga0495621_0027014 3300046539 Bacteria 1940
181 Ga0495668_0142483 3300046616 Bacteria 1312
182 Ga0495625_0005379 3300046660 Bacteria 11710
183 Ga0495615_0000088 3300048090 Bacteria 27165
184 Ga0495615_0000943 3300048090 Bacteria 4133
185 Ga0495626_0014633 3300048091 Bacteria 4039
186 Ga0496101_0028876 3300048904 Bacteria 3876
187 Ga0496102_0059423 3300048905 Bacteria 3496
188 Ga0496103_0058428 3300048906 Bacteria 2396
189 Ga0496104_0052781 3300048907 Bacteria 3840
190 Ga0496104_0106849 3300048907 Bacteria 2682
191 Ga0496105_0000242 3300048908 Bacteria 36794
192 Ga0496107_0000222 3300048910 Bacteria 30025
193 Ga0496110_0130316 3300048913 Bacteria 2270
194 Ga0496111_0182207 3300048914 Bacteria 1561
195 Ga0496113_0004590 3300048916 Bacteria 8516
196 Ga0496114_0033466 3300048917 Bacteria 4235
197 Ga0496115_0000527 3300048918 Bacteria 29744
198 Ga0496116_0000045 3300048919 Bacteria 324307
199 Ga0496121_0000017 3300048924 Bacteria 546415
200 Ga0496121_0000276 3300048924 Bacteria 107058
201 Ga0496121_0000885 3300048924 Bacteria 54051
202 Ga0496121_0005907 3300048924 Bacteria 15492
203 Ga0496122_0023866 3300048925 Bacteria 5371
204 Ga0496123_0001199 3300048926 Bacteria 37943
205 Ga0496123_0002684 3300048926 Bacteria 21413
206 Ga0496123_0091377 3300048926 Bacteria 1805
207 Ga0496123_0102037 3300048926 Bacteria 1666
208 Ga0496124_0000648 3300048927 Bacteria 57426
209 Ga0496124_0011834 3300048927 Bacteria 8688
210 Ga0496124_0013223 3300048927 Bacteria 8072
211 Ga0496124_0045756 3300048927 Bacteria 3751
212 Ga0496125_0008859 3300048928 Bacteria 10457
213 Ga0496126_0000568 3300048929 Bacteria 70707
214 Ga0496126_0003221 3300048929 Bacteria 20886
215 Ga0496126_0047221 3300048929 Bacteria 3943
216 Ga0495682_0025968 3300049460 Bacteria 2178
217 Ga0501033_0100691 3300049570 Bacteria 2108
218 Ga0501034_0010498 3300049571 Bacteria 9644
219 Ga0501034_0048357 3300049571 Bacteria 4293
220 Ga0501034_0125153 3300049571 Bacteria 2556
221 Ga0501036_0311347 3300049572 Bacteria 1316
222 Ga0501043_0155104 3300049579 Bacteria 1791
223 Ga0501043_0246292 3300049579 Bacteria 1377
224 Ga0501047_0045197 3300049581 Bacteria 4257
225 Ga0501070_0239397 3300049586 Bacteria 1486
226 Ga0501071_0019503 3300049587 Bacteria 4706
227 Ga0501071_0094629 3300049587 Bacteria 2198
228 Ga0501083_0050576 3300049744 Bacteria 2797
229 Ga0501083_0139121 3300049744 Bacteria 1590
230 Ga0501044_0007477 3300049823 Bacteria 12015
231 Ga0501044_0012629 3300049823 Bacteria 9145
232 Ga0501044_0188247 3300049823 Bacteria 2028
233 nmdc:mga03683_193_c1 3300050489 Bacteria 20052
234 nmdc:mga03683_33335_c1 3300050489 Bacteria 2077
235 nmdc:mga03n38_12295_c1 3300050490 Bacteria 3216
236 nmdc:mga0yw44_13153_c1 3300050492 Bacteria 4346
237 nmdc:mga04h51_1297_c1 3300050495 Bacteria 5773
238 nmdc:mga07m45_64_c1 3300050496 Bacteria 41841
239 nmdc:mga07m45_8239_c1 3300050496 Bacteria 5347
240 nmdc:mga05p37_243174_c1 3300050507 Bacteria 2162
241 nmdc:mga0a205_7060_c1 3300050515 Bacteria 10146
242 nmdc:mga0sz30_9578_c1 3300050516 Bacteria 3692
243 Ga0500643_000039 3300053087 Bacteria 169629
244 Ga0500643_004423 3300053087 Bacteria 6359
245 Ga0500566_0003990 3300053094 Bacteria 8811
246 Ga0500641_0004908 3300053096 Bacteria 4736
247 Ga0500556_0010549 3300053104 Bacteria 2715
248 Ga0500594_0005564 3300053118 Bacteria 2796
249 Ga0500595_000319 3300053119 Bacteria 31631
250 Ga0500608_000327 3300053122 Bacteria 18285
251 Ga0500618_000537 3300053125 Bacteria 23548
252 Ga0500626_070938 3300053128 Bacteria 1551
253 Ga0500658_0020877 3300053134 Bacteria 2476
254 Ga0500559_0003099 3300053136 Bacteria 8278
255 Ga0500564_000452 3300053138 Bacteria 11955
256 Ga0500567_017705 3300053723 Bacteria 3433
257 Ga0500625_000001 3300053729 Bacteria 395993
258 Ga0500645_005667 3300053730 Bacteria 4562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100328450 Ga0068862_1003284502 326
2 3300009553 Ga0105249_10065834 Ga0105249_100658345 338
3 3300038443 Ga0395901_0130605 Ga0395901_0130605_732_1781 343
4 3300005329 Ga0070683_100050570 Ga0070683_1000505702 351
5 3300005548 Ga0070665_100119600 Ga0070665_1001196003 351
6 3300013306 Ga0163162_10128763 Ga0163162_101287632 351
7 3300028379 Ga0268266_10092678 Ga0268266_100926782 351
8 3300031911 Ga0307412_10029440 Ga0307412_100294403 351
9 iso_pu_bacteria 8057101203 8057101512 355
10 3300025941 Ga0207711_10003741 Ga0207711_100037417 357
11 3300053125 Ga0500618_000537 Ga0500618_000537_12199_13383 357
12 3300053087 Ga0500643_000039 Ga0500643_000039_167681_168823 358
13 iso_pu_bacteria 2599185359 2600228082 358
14 iso_pu_bacteria 2818991466 2819715110 358
15 iso_pu_bacteria 2879163058 2879164328 358
16 iso_pu_bacteria 2928526807 2928531126 358
17 iso_pu_bacteria 2928968154 2928972302 358
18 3300049460 Ga0495682_0025968 Ga0495682_0025968_277_1476 359
19 iso_pu_bacteria 2643221622 2644127793 359
20 3300037471 Ga0395905_0001293 Ga0395905_0001293_6046_7170 361
21 3300038443 Ga0395901_0000889 Ga0395901_0000889_14900_16024 361
22 3300048906 Ga0496103_0058428 Ga0496103_0058428_129_1214 361
23 3300009093 Ga0105240_10371551 Ga0105240_103715512 362
24 3300009545 Ga0105237_10031561 Ga0105237_100315613 362
25 3300015690 Ga0183363_1007 Ga0183363_1007212 362
26 3300025909 Ga0207705_10012322 Ga0207705_100123225 362
27 3300025914 Ga0207671_10009010 Ga0207671_100090107 362
28 3300026116 Ga0207674_10034400 Ga0207674_100344002 362
29 3300031911 Ga0307412_10038153 Ga0307412_100381532 362
30 3300046539 Ga0495621_0027014 Ga0495621_0027014_107_1219 362
31 3300048926 Ga0496123_0091377 Ga0496123_0091377_341_1441 362
32 3300048926 Ga0496123_0102037 Ga0496123_0102037_80_1180 362
33 3300048927 Ga0496124_0000648 Ga0496124_0000648_23314_24414 362
34 3300048927 Ga0496124_0045756 Ga0496124_0045756_400_1500 362
35 3300048929 Ga0496126_0047221 Ga0496126_0047221_2803_3903 362
36 3300003215 JGI25153J46596_10000032 JGI25153J46596_10000032123 363
37 3300003771 Ga0055526_1000606 Ga0055526_100060625 363
38 3300003773 Ga0055537_1003845 Ga0055537_10038451 363
39 3300003775 Ga0055524_1000154 Ga0055524_100015464 363
40 3300003794 Ga0055531_10003354 Ga0055531_100033542 363
41 3300005262 Ga0065165_1001318 Ga0065165_100131815 363
42 3300005262 Ga0065165_1009630 Ga0065165_10096306 363
43 3300005345 Ga0070692_10033690 Ga0070692_100336905 363
44 3300005366 Ga0070659_100010932 Ga0070659_1000109325 363
45 3300005457 Ga0070662_100003148 Ga0070662_1000031482 363
46 3300005548 Ga0070665_100118434 Ga0070665_1001184343 363
47 3300005842 Ga0068858_100007649 Ga0068858_1000076492 363
48 3300005844 Ga0068862_100198847 Ga0068862_1001988472 363
49 3300006048 Ga0075363_100005993 Ga0075363_1000059935 363
50 3300006852 Ga0075433_10032679 Ga0075433_100326793 363
51 3300009093 Ga0105240_10481061 Ga0105240_104810612 363
52 3300025245 Ga0207425_1000025 Ga0207425_1000025207 363
53 3300025258 Ga0209129_1007182 Ga0209129_10071823 363
54 3300025263 Ga0209565_1000007 Ga0209565_1000007591 363
55 3300025273 Ga0209673_1002047 Ga0209673_10020479 363
56 3300025291 Ga0209675_1013132 Ga0209675_10131322 363
57 3300025292 Ga0209676_1009270 Ga0209676_10092705 363
58 3300025294 Ga0209025_1000176 Ga0209025_100017636 363
59 3300025295 Ga0209564_1000886 Ga0209564_100088616 363
60 3300025297 Ga0209758_1000002 Ga0209758_1000002291 363
61 3300025298 Ga0209050_1000001 Ga0209050_1000001203 363
62 3300025298 Ga0209050_1000350 Ga0209050_10003509 363
63 3300025298 Ga0209050_1010766 Ga0209050_10107665 363
64 3300025299 Ga0209256_1000008 Ga0209256_1000008433 363
65 3300025303 Ga0209051_1000919 Ga0209051_10009198 363
66 3300025304 Ga0209257_1002786 Ga0209257_10027865 363
67 3300025304 Ga0209257_1002907 Ga0209257_10029075 363
68 3300025304 Ga0209257_1012097 Ga0209257_10120976 363
69 3300025919 Ga0207657_10023092 Ga0207657_100230923 363
70 3300025932 Ga0207690_10047744 Ga0207690_100477445 363
71 3300025933 Ga0207706_10001226 Ga0207706_1000122628 363
72 3300025940 Ga0207691_10027121 Ga0207691_100271214 363
73 3300025942 Ga0207689_10125214 Ga0207689_101252143 363
74 3300026035 Ga0207703_10004429 Ga0207703_100044292 363
75 3300026088 Ga0207641_10055841 Ga0207641_100558413 363
76 3300028380 Ga0268265_10041245 Ga0268265_100412452 363
77 3300041410 Ga0439461_0000216 Ga0439461_0000216_64_1170 363
78 3300041413 Ga0439465_0003731 Ga0439465_0003731_3804_4910 363
79 3300041997 Ga0439431_0000304 Ga0439431_0000304_3579_4685 363
80 3300042002 Ga0439442_004360 Ga0439442_004360_1513_2619 363
81 3300042006 Ga0439432_002069 Ga0439432_002069_4346_5452 363
82 3300042006 Ga0439432_025005 Ga0439432_025005_431_1537 363
83 3300042007 Ga0439449_0077327 Ga0439449_0077327_64_1170 363
84 3300042014 Ga0439457_014580 Ga0439457_014580_171_1277 363
85 3300042015 Ga0439462_0000978 Ga0439462_0000978_3400_4506 363
86 3300042435 Ga0439434_0004044 Ga0439434_0004044_654_1760 363
87 3300050515 nmdc:mga0a205_7060_c1 nmdc:mga0a205_7060_c1_5718_6830 363
88 3300053087 Ga0500643_004423 Ga0500643_004423_2457_3563 363
89 3300053104 Ga0500556_0010549 Ga0500556_0010549_1565_2671 363
90 3300053134 Ga0500658_0020877 Ga0500658_0020877_1069_2175 363
91 3300053730 Ga0500645_005667 Ga0500645_005667_1633_2739 363
92 3300003791 Ga0055530_10000235 Ga0055530_1000023534 364
93 3300003794 Ga0055531_10000361 Ga0055531_1000036134 364
94 3300005327 Ga0070658_10179555 Ga0070658_101795553 364
95 3300005339 Ga0070660_100283681 Ga0070660_1002836811 364
96 3300005539 Ga0068853_100018009 Ga0068853_1000180095 364
97 3300005841 Ga0068863_100144380 Ga0068863_1001443803 364
98 3300021358 Ga0213873_10000024 Ga0213873_100000244 364
99 3300021384 Ga0213876_10000105 Ga0213876_100001054 364
100 3300025263 Ga0209565_1000044 Ga0209565_1000044156 364
101 3300025295 Ga0209564_1014955 Ga0209564_10149552 364
102 3300025298 Ga0209050_1000071 Ga0209050_1000071157 364
103 3300025298 Ga0209050_1004285 Ga0209050_10042855 364
104 3300025302 Ga0207426_1015559 Ga0207426_10155593 364
105 3300025304 Ga0209257_1000027 Ga0209257_1000027146 364
106 3300025919 Ga0207657_10012945 Ga0207657_100129454 364
107 3300026041 Ga0207639_10063592 Ga0207639_100635924 364
108 3300026041 Ga0207639_10104921 Ga0207639_101049212 364
109 3300026088 Ga0207641_10022519 Ga0207641_100225193 364
110 3300039437 Ga0436365_0753794 Ga0436365_0753794_263_1435 364
111 3300039437 Ga0436365_1119321 Ga0436365_1119321_63964_65142 364
112 3300039453 Ga0436362_0837799 Ga0436362_0837799_62906_64084 364
113 3300048918 Ga0496115_0000527 Ga0496115_0000527_5334_6449 364
114 3300049570 Ga0501033_0100691 Ga0501033_0100691_223_1395 364
115 3300049571 Ga0501034_0048357 Ga0501034_0048357_1013_2185 364
116 3300049572 Ga0501036_0311347 Ga0501036_0311347_32_1204 364
117 3300049579 Ga0501043_0155104 Ga0501043_0155104_514_1686 364
118 3300049579 Ga0501043_0246292 Ga0501043_0246292_159_1331 364
119 3300049581 Ga0501047_0045197 Ga0501047_0045197_977_2149 364
120 3300049586 Ga0501070_0239397 Ga0501070_0239397_35_1207 364
121 3300049587 Ga0501071_0094629 Ga0501071_0094629_626_1738 364
122 3300049744 Ga0501083_0050576 Ga0501083_0050576_1406_2575 364
123 3300049744 Ga0501083_0139121 Ga0501083_0139121_377_1549 364
124 3300049823 Ga0501044_0007477 Ga0501044_0007477_1306_2478 364
125 3300050507 nmdc:mga05p37_243174_c1 nmdc:mga05p37_243174_c1_500_1612 364
126 3300053094 Ga0500566_0003990 Ga0500566_0003990_4971_6080 364
127 3300053119 Ga0500595_000319 Ga0500595_000319_16382_17491 364
128 3300037418 Ga0395900_0025021 Ga0395900_0025021_3546_4721 365
129 3300038443 Ga0395901_0028735 Ga0395901_0028735_2486_3661 365
130 3300045051 Ga0451576_0004329 Ga0451576_0004329_14877_16007 365
131 3300048924 Ga0496121_0000885 Ga0496121_0000885_31790_32965 365
132 3300053128 Ga0500626_070938 Ga0500626_070938_375_1520 365
133 3300005842 Ga0068858_100042409 Ga0068858_1000424095 366
134 3300049571 Ga0501034_0125153 Ga0501034_0125153_1132_2313 366
135 3300049823 Ga0501044_0188247 Ga0501044_0188247_819_2000 366
136 3300026067 Ga0207678_10213040 Ga0207678_102130401 368
137 3300046506 Ga0495583_0025261 Ga0495583_0025261_1842_2954 368
138 3300005344 Ga0070661_100000042 Ga0070661_10000004258 369
139 3300025920 Ga0207649_10000047 Ga0207649_1000004762 369
140 3300049571 Ga0501034_0010498 Ga0501034_0010498_2438_3718 369
141 3300049587 Ga0501071_0019503 Ga0501071_0019503_103_1383 369
142 3300005336 Ga0070680_100002866 Ga0070680_10000286610 370
143 3300005367 Ga0070667_100301991 Ga0070667_1003019912 370
144 3300005455 Ga0070663_100033663 Ga0070663_1000336632 370
145 3300005530 Ga0070679_100000002 Ga0070679_10000000283 370
146 3300005563 Ga0068855_100326885 Ga0068855_1003268852 370
147 3300021377 Ga0213874_10029667 Ga0213874_100296672 370
148 3300025917 Ga0207660_10004400 Ga0207660_1000440010 370
149 3300025921 Ga0207652_10000001 Ga0207652_10000001411 370
150 3300025921 Ga0207652_10000002 Ga0207652_10000002317 370
151 3300031824 Ga0307413_10034804 Ga0307413_100348044 370
152 3300031901 Ga0307406_10095637 Ga0307406_100956372 370
153 3300032004 Ga0307414_10065707 Ga0307414_100657072 370
154 3300032005 Ga0307411_10084583 Ga0307411_100845831 370
155 3300037312 Ga0395899_0047836 Ga0395899_0047836_476_1624 370
156 3300039450 Ga0436363_1667982 Ga0436363_1667982_539_1696 370
157 3300053096 Ga0500641_0004908 Ga0500641_0004908_408_1556 371
158 iso_pu_bacteria 2882806704 2882809493 373
159 3300045051 Ga0451576_0000024 Ga0451576_0000024_353380_354549 374
160 3300053136 Ga0500559_0003099 Ga0500559_0003099_1591_2718 374
161 iso_pu_bacteria 2643221588 2643950941 374
162 iso_pu_bacteria 2848297114 2848298642 374
163 iso_pu_bacteria 3000865235 3000867859 374
164 3300005355 Ga0070671_100003120 Ga0070671_1000031202 375
165 3300005841 Ga0068863_100052340 Ga0068863_1000523405 375
166 3300005843 Ga0068860_100035621 Ga0068860_1000356214 375
167 3300025931 Ga0207644_10000275 Ga0207644_1000027536 375
168 3300026035 Ga0207703_10367388 Ga0207703_103673882 375
169 3300026088 Ga0207641_10018264 Ga0207641_100182648 375
170 3300028381 Ga0268264_10039852 Ga0268264_100398524 375
171 3300005548 Ga0070665_100124864 Ga0070665_1001248643 376
172 3300005842 Ga0068858_100035549 Ga0068858_1000355493 376
173 3300026035 Ga0207703_10022684 Ga0207703_100226844 376
174 3300028379 Ga0268266_10182941 Ga0268266_101829411 376
175 3300031824 Ga0307413_10202490 Ga0307413_102024901 376
176 3300032004 Ga0307414_10095435 Ga0307414_100954352 376
177 3300005618 Ga0068864_100004270 Ga0068864_1000042705 378
178 3300005841 Ga0068863_100000115 Ga0068863_10000011539 378
179 3300005843 Ga0068860_100000319 Ga0068860_10000031934 378
180 3300006353 Ga0075370_10014848 Ga0075370_100148484 378
181 3300025941 Ga0207711_10080350 Ga0207711_100803501 378
182 3300026088 Ga0207641_10000440 Ga0207641_1000044017 378
183 3300028381 Ga0268264_10000714 Ga0268264_100007148 378
184 3300032004 Ga0307414_10026556 Ga0307414_100265562 378
185 3300048090 Ga0495615_0000943 Ga0495615_0000943_318_1484 378
186 3300048907 Ga0496104_0052781 Ga0496104_0052781_2136_3287 378
187 3300048908 Ga0496105_0000242 Ga0496105_0000242_31688_32839 378
188 3300048924 Ga0496121_0000276 Ga0496121_0000276_34782_35936 378
189 3300050489 nmdc:mga03683_33335_c1 nmdc:mga03683_33335_c1_519_1673 378
190 3300050496 nmdc:mga07m45_8239_c1 nmdc:mga07m45_8239_c1_671_1834 378
191 3300053118 Ga0500594_0005564 Ga0500594_0005564_610_1773 378
192 3300053122 Ga0500608_000327 Ga0500608_000327_12095_13258 378
193 3300053138 Ga0500564_000452 Ga0500564_000452_8376_9539 378
194 3300053723 Ga0500567_017705 Ga0500567_017705_1901_3064 378
195 3300053729 Ga0500625_000001 Ga0500625_000001_212832_213995 378
196 iso_pu_bacteria 8054302542 8054305430 378
197 iso_pu_bacteria 2896184354 2896185995 380
198 3300006042 Ga0075368_10002911 Ga0075368_100029112 381
199 3300006177 Ga0075362_10003563 Ga0075362_100035635 381
200 3300006178 Ga0075367_10049864 Ga0075367_100498642 381
201 3300006186 Ga0075369_10071803 Ga0075369_100718032 381
202 3300006946 Ga0079104_1007806 Ga0079104_10078061 381
203 3300027866 Ga0209813_10000138 Ga0209813_1000013819 381
204 3300050489 nmdc:mga03683_193_c1 nmdc:mga03683_193_c1_10993_12141 381
205 3300050490 nmdc:mga03n38_12295_c1 nmdc:mga03n38_12295_c1_1808_2956 381
206 3300050492 nmdc:mga0yw44_13153_c1 nmdc:mga0yw44_13153_c1_2287_3435 381
207 3300050495 nmdc:mga04h51_1297_c1 nmdc:mga04h51_1297_c1_4296_5444 381
208 3300050496 nmdc:mga07m45_64_c1 nmdc:mga07m45_64_c1_11921_13069 381
209 3300050516 nmdc:mga0sz30_9578_c1 nmdc:mga0sz30_9578_c1_737_1885 381
210 iso_pu_bacteria 2919138771 2919143177 381
211 3300046512 Ga0495610_0000015 Ga0495610_0000015_273349_274503 382
212 3300046519 Ga0495632_0001085 Ga0495632_0001085_17152_18306 382
213 3300046616 Ga0495668_0142483 Ga0495668_0142483_77_1240 382
214 3300048090 Ga0495615_0000088 Ga0495615_0000088_2265_3413 382
215 3300048917 Ga0496114_0033466 Ga0496114_0033466_2906_4153 382
216 3300048924 Ga0496121_0000017 Ga0496121_0000017_344474_345640 382
217 3300048925 Ga0496122_0023866 Ga0496122_0023866_2295_3443 382
218 3300048926 Ga0496123_0001199 Ga0496123_0001199_34523_35671 382
219 3300048929 Ga0496126_0003221 Ga0496126_0003221_13567_14814 382
220 3300005289 Ga0065704_10014515 Ga0065704_100145152 384
221 3300005347 Ga0070668_100088564 Ga0070668_1000885644 384
222 3300025972 Ga0207668_10065827 Ga0207668_100658274 384
223 3300026142 Ga0207698_10064726 Ga0207698_100647263 384
224 3300030500 Ga0268256_1018277 Ga0268256_10182773 384
225 3300046512 Ga0495610_0001997 Ga0495610_0001997_12393_13553 384
226 3300046522 Ga0495643_0000080 Ga0495643_0000080_127177_128337 384
227 2162886007 SwRhRL2b_contig_802780 SwRhRL2b_0434.00005490 385
228 3300005289 Ga0065704_10000316 Ga0065704_1000031617 385
229 3300005295 Ga0065707_10107262 Ga0065707_101072623 385
230 3300005353 Ga0070669_100000897 Ga0070669_10000089722 385
231 3300005353 Ga0070669_100001229 Ga0070669_10000122913 385
232 3300005367 Ga0070667_100019809 Ga0070667_1000198094 385
233 3300005841 Ga0068863_100011726 Ga0068863_1000117269 385
234 3300005842 Ga0068858_100057121 Ga0068858_1000571213 385
235 3300009011 Ga0105251_10000232 Ga0105251_1000023257 385
236 3300009177 Ga0105248_10038177 Ga0105248_100381771 385
237 3300013306 Ga0163162_10036534 Ga0163162_100365343 385
238 3300025298 Ga0209050_1001670 Ga0209050_100167022 385
239 3300025735 Ga0207713_1001029 Ga0207713_10010297 385
240 3300025923 Ga0207681_10000992 Ga0207681_100009928 385
241 3300025923 Ga0207681_10002110 Ga0207681_100021103 385
242 3300025972 Ga0207668_10003960 Ga0207668_100039606 385
243 3300025986 Ga0207658_10006441 Ga0207658_100064417 385
244 3300026088 Ga0207641_10010204 Ga0207641_1001020412 385
245 3300027665 Ga0209983_1008367 Ga0209983_10083672 385
246 3300028381 Ga0268264_10006581 Ga0268264_1000658112 385
247 3300035691 Ga0373931_0026600 Ga0373931_0026600_155_1330 385
248 3300046500 Ga0495596_0000153 Ga0495596_0000153_41189_42352 385
249 3300046500 Ga0495596_0007367 Ga0495596_0007367_2559_3734 385
250 3300046501 Ga0495607_0059223 Ga0495607_0059223_845_2002 385
251 3300046507 Ga0495606_0006535 Ga0495606_0006535_3551_4708 385
252 3300046507 Ga0495606_0043263 Ga0495606_0043263_1021_2196 385
253 3300046512 Ga0495610_0001472 Ga0495610_0001472_974_2149 385
254 3300046519 Ga0495632_0008546 Ga0495632_0008546_4899_6062 385
255 3300046538 Ga0495609_0019666 Ga0495609_0019666_588_1751 385
256 3300046660 Ga0495625_0005379 Ga0495625_0005379_3130_4293 385
257 3300048091 Ga0495626_0014633 Ga0495626_0014633_1958_3133 385
258 3300048904 Ga0496101_0028876 Ga0496101_0028876_2424_3605 385
259 3300048905 Ga0496102_0059423 Ga0496102_0059423_539_1720 385
260 3300048907 Ga0496104_0106849 Ga0496104_0106849_957_2138 385
261 3300048910 Ga0496107_0000222 Ga0496107_0000222_10938_12119 385
262 3300048913 Ga0496110_0130316 Ga0496110_0130316_503_1684 385
263 3300048914 Ga0496111_0182207 Ga0496111_0182207_201_1382 385
264 3300048916 Ga0496113_0004590 Ga0496113_0004590_2623_3804 385
265 3300048919 Ga0496116_0000045 Ga0496116_0000045_190706_191869 385
266 3300048924 Ga0496121_0005907 Ga0496121_0005907_6073_7236 385
267 3300048926 Ga0496123_0002684 Ga0496123_0002684_3678_4841 385
268 3300048927 Ga0496124_0011834 Ga0496124_0011834_4511_5674 385
269 3300048927 Ga0496124_0013223 Ga0496124_0013223_3726_4889 385
270 3300048928 Ga0496125_0008859 Ga0496125_0008859_398_1561 385
271 3300048929 Ga0496126_0000568 Ga0496126_0000568_55190_56353 385
272 3300049823 Ga0501044_0012629 Ga0501044_0012629_6024_7202 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04860

Phage_portal

Phage portal protein

111

432

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6toa-assembly1.cif.gz_B neck of empty gta particle computed with c6 symmetry 0.7802 34 379
6toa-assembly1.cif.gz_A neck of empty gta particle computed with c6 symmetry 0.7787 30 379
6te8-assembly1.cif.gz_A neck of native gta particle computed with c12 symmetry 0.7787 34 379
6tba-assembly1.cif.gz_1A virion of native gene transfer agent (gta) particle 0.7513 2 379
6tba-assembly1.cif.gz_1A virion of native gene transfer agent (gta) particle 0.7494 2 379
ID Description Score Start End Superfamily
af_A0A1D6H393_88_333_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6741 129 153 2.120.10.80
3kdrB02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2; 0.5833 71 188 3.40.140.120
1fouG02 Mainly Beta;Beta Barrel;Upper collar protein gp10 (connector protein) fold;Upper collar protein gp10 (connector protein) 0.5309 96 169 2.40.500.10
4cqnD03 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.5058 106 150 2.20.28.290
3zjvA04 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.4879 105 175 2.20.28.290
ID Description Score Start End GO Terms
AF-A0A654C1K9-F1-model_v4 Portal protein 0.8775 47 377
AF-A0A0Q4XLY1-F1-model_v4 Portal protein 0.8771 267 380
AF-A0A0Q4XLY1-F1-model_v4 Portal protein 0.8702 267 380
AF-A0A3A1PD86-F1-model_v4 Phage portal protein 0.8701 35 385
AF-A0A7C7CBU9-F1-model_v4 Phage portal protein 0.8689 41 377

Feature Viewer

pLDDT pTM Quality
78.84 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map