F378333

General Info

Members Datasets Scaffolds Average Seq Length
272 175 271 126

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11809581|Ga0105243_118095812
Length 148
Sequence MSRTRSVPLYRLAHGRTGDKGNRSNISVIAWHPALWPLLVEQVTEVRVAEQFAHRRPAQVTRHLLPQLQAMNFVLDEVLDGGVNDALNLDSHGKALAFHLLDLEIAVPEALQAHLAGSDDDVSQPRPTTGDGMDASHPLIDCEGCESG

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.24
Nodule 0
Rhizoplane 2.94
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000134 3300002705 Bacteria 53987
2 JGI25154J39366_1000151 3300002738 Bacteria 53987
3 JGI25157J39369_1000173 3300002741 Bacteria 54214
4 rootH1_10018602 3300003323 Bacteria 2534
5 Ga0055524_1000378 3300003775 Bacteria 38772
6 Ga0055540_1000011 3300003792 Bacteria 282927
7 Ga0055531_10037713 3300003794 Bacteria 1464
8 Ga0065704_10085452 3300005289 Bacteria 3221
9 Ga0065712_10346758 3300005290 Bacteria 793
10 Ga0070676_10632968 3300005328 Bacteria 775
11 Ga0070676_10950109 3300005328 Bacteria 643
12 Ga0070690_100019412 3300005330 Bacteria 4125
13 Ga0070670_100258260 3300005331 Bacteria 1518
14 Ga0070670_100398520 3300005331 Bacteria 1215
15 Ga0070670_100615446 3300005331 Bacteria 973
16 Ga0070677_10237931 3300005333 Bacteria 897
17 Ga0070677_10625852 3300005333 Bacteria 599
18 Ga0068869_100031701 3300005334 Bacteria 3719
19 Ga0068869_100093638 3300005334 Bacteria 2264
20 Ga0070666_10009513 3300005335 Bacteria 6061
21 Ga0068868_100001502 3300005338 Bacteria 16064
22 Ga0070689_100229738 3300005340 Bacteria 1525
23 Ga0070687_101430400 3300005343 Bacteria 518
24 Ga0070668_100332055 3300005347 Bacteria 1282
25 Ga0070669_100014437 3300005353 Bacteria 5621
26 Ga0070669_100024776 3300005353 Bacteria 4306
27 Ga0070675_100002597 3300005354 Bacteria 13545
28 Ga0070675_100098428 3300005354 Bacteria 2460
29 Ga0070675_100721390 3300005354 Bacteria 909
30 Ga0070671_100002077 3300005355 Bacteria 15425
31 Ga0070671_100994697 3300005355 Bacteria 735
32 Ga0070674_100225201 3300005356 Bacteria 1461
33 Ga0070674_100466729 3300005356 Bacteria 1045
34 Ga0070674_100687097 3300005356 Bacteria 874
35 Ga0070673_100006268 3300005364 Bacteria 7715
36 Ga0070659_101465573 3300005366 Bacteria 608
37 Ga0070667_100005638 3300005367 Bacteria 10455
38 Ga0070667_100444023 3300005367 Bacteria 1185
39 Ga0070667_100686599 3300005367 Bacteria 947
40 Ga0070705_101275468 3300005440 Bacteria 608
41 Ga0070678_100166993 3300005456 Bacteria 1789
42 Ga0070678_100294196 3300005456 Bacteria 1378
43 Ga0070678_100763173 3300005456 Bacteria 876
44 Ga0070678_100986874 3300005456 Bacteria 773
45 Ga0070662_100199025 3300005457 Bacteria 1588
46 Ga0068867_100122357 3300005459 Bacteria 2012
47 Ga0068867_100141819 3300005459 Bacteria 1879
48 Ga0070685_10039792 3300005466 Bacteria 2673
49 Ga0070672_100026283 3300005543 Bacteria 4329
50 Ga0070672_100091214 3300005543 Bacteria 2458
51 Ga0070672_100269491 3300005543 Bacteria 1437
52 Ga0070686_100425939 3300005544 Bacteria 1015
53 Ga0068856_101692018 3300005614 Bacteria 645
54 Ga0068852_100567270 3300005616 Bacteria 1137
55 Ga0068859_100018677 3300005617 Bacteria 6967
56 Ga0068859_101317235 3300005617 Bacteria 796
57 Ga0068864_100000242 3300005618 Bacteria 48756
58 Ga0068864_100545030 3300005618 Bacteria 1120
59 Ga0068866_10011789 3300005718 Bacteria 3793
60 Ga0068861_100002558 3300005719 Bacteria 11892
61 Ga0068861_100251368 3300005719 Bacteria 1508
62 Ga0068851_10078465 3300005834 Bacteria 1721
63 Ga0068851_10328894 3300005834 Bacteria 885
64 Ga0068863_100034069 3300005841 Bacteria 4851
65 Ga0068863_100240128 3300005841 Bacteria 1749
66 Ga0068858_100001331 3300005842 Bacteria 25503
67 Ga0068860_100002228 3300005843 Bacteria 20406
68 Ga0068862_100015591 3300005844 Bacteria 6312
69 Ga0075368_10023015 3300006042 Bacteria 2376
70 Ga0075363_100047337 3300006048 Bacteria 2283
71 Ga0075364_10007284 3300006051 Bacteria 6564
72 Ga0075364_10012748 3300006051 Bacteria 5155
73 Ga0075364_10017599 3300006051 Bacteria 4469
74 Ga0075362_10346401 3300006177 Bacteria 743
75 Ga0075367_10000951 3300006178 Bacteria 11789
76 Ga0075366_10284661 3300006195 Bacteria 1010
77 Ga0075366_11033705 3300006195 Bacteria 513
78 Ga0097621_100002600 3300006237 Bacteria 12373
79 Ga0097621_100293284 3300006237 Bacteria 1435
80 Ga0075370_10003269 3300006353 Bacteria 7683
81 Ga0075370_10032152 3300006353 Bacteria 2932
82 Ga0068871_100076606 3300006358 Bacteria 2763
83 Ga0068871_100901416 3300006358 Bacteria 819
84 Ga0075428_100409283 3300006844 Bacteria 1453
85 Ga0075430_100466689 3300006846 Bacteria 1042
86 Ga0068865_100008657 3300006881 Bacteria 6295
87 Ga0068865_100110542 3300006881 Bacteria 2027
88 Ga0097620_100018677 3300006931 Bacteria 6967
89 Ga0097620_100353352 3300006931 Bacteria 1565
90 Ga0097620_101317240 3300006931 Bacteria 796
91 Ga0075435_101487484 3300007076 Bacteria 594
92 Ga0111539_10008212 3300009094 Bacteria 13285
93 Ga0105243_11809581 3300009148 Bacteria 642
94 Ga0105242_10155075 3300009176 Bacteria 2000
95 Ga0105242_11571753 3300009176 Bacteria 690
96 Ga0105242_12344626 3300009176 Bacteria 580
97 Ga0105242_12864157 3300009176 Bacteria 533
98 Ga0105248_10007436 3300009177 Bacteria 12018
99 Ga0105248_10085812 3300009177 Bacteria 3542
100 Ga0105249_10014093 3300009553 Bacteria 7068
101 Ga0105249_10109511 3300009553 Bacteria 2609
102 Ga0105246_12289136 3300011119 Bacteria 528
103 Ga0157374_10303384 3300013296 Bacteria 1580
104 Ga0157378_10096900 3300013297 Bacteria 2688
105 Ga0157378_10300326 3300013297 Bacteria 1554
106 Ga0163162_10149294 3300013306 Bacteria 2454
107 Ga0163162_10209672 3300013306 Bacteria 2078
108 Ga0157375_10004176 3300013308 Bacteria 12534
109 Ga0157375_11260297 3300013308 Bacteria 868
110 Ga0163163_10018823 3300014325 Bacteria 6475
111 Ga0157380_10291204 3300014326 Bacteria 1499
112 Ga0157380_10503860 3300014326 Bacteria 1177
113 Ga0157380_10906158 3300014326 Bacteria 908
114 Ga0157380_10984263 3300014326 Bacteria 876
115 Ga0157380_11479393 3300014326 Bacteria 732
116 Ga0157379_10012032 3300014968 Bacteria 7559
117 Ga0157379_10090063 3300014968 Bacteria 2752
118 Ga0157379_12565010 3300014968 Bacteria 510
119 Ga0157376_10046754 3300014969 Bacteria 3571
120 Ga0163161_10124614 3300017792 Bacteria 1939
121 Ga0209565_1033477 3300025263 Bacteria 989
122 Ga0207666_1010836 3300025271 Bacteria 1253
123 Ga0209675_1023414 3300025291 Bacteria 1600
124 Ga0209050_1000376 3300025298 Bacteria 84318
125 Ga0209050_1023829 3300025298 Bacteria 2139
126 Ga0209256_1000092 3300025299 Bacteria 210547
127 Ga0209256_1103613 3300025299 Bacteria 584
128 Ga0209051_1000020 3300025303 Bacteria 508628
129 Ga0209257_1000085 3300025304 Bacteria 291117
130 Ga0207656_10374949 3300025321 Bacteria 713
131 Ga0207682_10425689 3300025893 Bacteria 628
132 Ga0207680_10007701 3300025903 Bacteria 5264
133 Ga0207645_10545794 3300025907 Bacteria 786
134 Ga0207643_10202514 3300025908 Bacteria 1209
135 Ga0207643_10625857 3300025908 Bacteria 694
136 Ga0207705_10403012 3300025909 Bacteria 1058
137 Ga0207681_10122088 3300025923 Bacteria 1912
138 Ga0207650_10267721 3300025925 Bacteria 1388
139 Ga0207659_10000312 3300025926 Bacteria 29506
140 Ga0207659_10484875 3300025926 Bacteria 1045
141 Ga0207644_10000437 3300025931 Bacteria 26946
142 Ga0207706_10077613 3300025933 Bacteria 2921
143 Ga0207706_10300207 3300025933 Bacteria 1399
144 Ga0207686_10199569 3300025934 Bacteria 1432
145 Ga0207686_11145474 3300025934 Bacteria 635
146 Ga0207686_11328898 3300025934 Bacteria 591
147 Ga0207670_10748535 3300025936 Bacteria 811
148 Ga0207669_10054368 3300025937 Bacteria 2418
149 Ga0207669_10181358 3300025937 Bacteria 1510
150 Ga0207669_10204467 3300025937 Bacteria 1436
151 Ga0207669_10304869 3300025937 Bacteria 1212
152 Ga0207669_10457927 3300025937 Bacteria 1012
153 Ga0207669_10786084 3300025937 Bacteria 788
154 Ga0207704_10004113 3300025938 Bacteria 6628
155 Ga0207704_10030094 3300025938 Bacteria 3040
156 Ga0207691_10070554 3300025940 Bacteria 3154
157 Ga0207691_10128614 3300025940 Bacteria 2239
158 Ga0207691_10244625 3300025940 Bacteria 1550
159 Ga0207711_10001682 3300025941 Bacteria 20373
160 Ga0207711_10421332 3300025941 Bacteria 1242
161 Ga0207689_10008999 3300025942 Bacteria 8648
162 Ga0207689_10593565 3300025942 Bacteria 931
163 Ga0207679_10147577 3300025945 Bacteria 1910
164 Ga0207651_10006315 3300025960 Bacteria 6187
165 Ga0207712_10082827 3300025961 Bacteria 2340
166 Ga0207712_10833640 3300025961 Bacteria 812
167 Ga0207658_10001772 3300025986 Bacteria 16204
168 Ga0207658_10207443 3300025986 Bacteria 1640
169 Ga0207677_10001268 3300026023 Bacteria 13594
170 Ga0207703_10001047 3300026035 Bacteria 26351
171 Ga0207639_11458081 3300026041 Bacteria 642
172 Ga0207708_10052682 3300026075 Bacteria 3100
173 Ga0207641_10032392 3300026088 Bacteria 4339
174 Ga0207641_10368583 3300026088 Bacteria 1373
175 Ga0207648_10000432 3300026089 Bacteria 46265
176 Ga0207648_10042573 3300026089 Bacteria 3985
177 Ga0207648_10399267 3300026089 Bacteria 1245
178 Ga0207676_10000733 3300026095 Bacteria 25719
179 Ga0207674_10619788 3300026116 Bacteria 1045
180 Ga0207675_100002706 3300026118 Bacteria 17462
181 Ga0207683_10008866 3300026121 Bacteria 8577
182 Ga0207683_10033784 3300026121 Bacteria 4445
183 Ga0207683_10551548 3300026121 Bacteria 1066
184 Ga0207698_10382984 3300026142 Bacteria 1339
185 Ga0207698_10800094 3300026142 Bacteria 945
186 Ga0268265_10027073 3300028380 Bacteria 4087
187 Ga0268265_10412674 3300028380 Bacteria 1251
188 Ga0307515_10000063 3300028794 Bacteria 245504
189 Ga0307515_10076294 3300028794 Bacteria 4450
190 Ga0307408_100041537 3300031548 Bacteria 3261
191 Ga0307408_100759050 3300031548 Bacteria 877
192 Ga0307405_10099052 3300031731 Bacteria 1950
193 Ga0307413_10043251 3300031824 Bacteria 2653
194 Ga0307410_10120407 3300031852 Bacteria 1913
195 Ga0307410_10274424 3300031852 Bacteria 1320
196 Ga0307406_10125174 3300031901 Bacteria 1794
197 Ga0307406_10608569 3300031901 Bacteria 902
198 Ga0307412_10006718 3300031911 Bacteria 6522
199 Ga0307416_100254336 3300032002 Bacteria 1712
200 Ga0307416_100433808 3300032002 Bacteria 1362
201 Ga0307414_10003801 3300032004 Bacteria 8116
202 Ga0307414_10731423 3300032004 Bacteria 898
203 Ga0307411_10099387 3300032005 Bacteria 2053
204 Ga0307411_10841395 3300032005 Bacteria 811
205 Ga0307415_100032823 3300032126 Bacteria 3363
206 Ga0373931_0401521 3300035691 Bacteria 868
207 Ga0395905_0005330 3300037471 Bacteria 13142
208 Ga0436365_0830171 3300039437 Bacteria 1008
209 Ga0439436_0188246 3300041404 Bacteria 588
210 Ga0451795_1286545 3300041456 Bacteria 577
211 Ga0451804_1128707 3300041463 Bacteria 628
212 Ga0451807_0988537 3300041486 Bacteria 652
213 Ga0439448_0187718 3300042005 Bacteria 723
214 Ga0439450_062130 3300042008 Bacteria 904
215 Ga0439444_0117400 3300042437 Bacteria 618
216 Ga0439464_0091045 3300042439 Bacteria 919
217 Ga0439460_0010234 3300042461 Bacteria 2396
218 Ga0466965_0131813 3300044683 Bacteria 1297
219 Ga0453684_0082944 3300044712 Bacteria 3992
220 Ga0453684_0835519 3300044712 Bacteria 991
221 Ga0453684_0860458 3300044712 Bacteria 974
222 Ga0451576_0153294 3300045051 Bacteria 2403
223 Ga0495638_0593700 3300046460 Bacteria 545
224 Ga0495650_0021120 3300046471 Bacteria 3155
225 Ga0495639_0760671 3300046475 Bacteria 502
226 Ga0495642_0379739 3300046528 Bacteria 622
227 Ga0495586_0081793 3300046535 Bacteria 1775
228 Ga0495621_0001506 3300046539 Bacteria 6044
229 Ga0495621_0093582 3300046539 Bacteria 1136
230 Ga0495621_0416220 3300046539 Bacteria 572
231 Ga0495633_0000959 3300046558 Bacteria 23887
232 Ga0495625_0519222 3300046660 Bacteria 726
233 Ga0495658_0123913 3300046683 Bacteria 1566
234 Ga0495658_0990241 3300046683 Bacteria 537
235 Ga0495636_0016121 3300047318 Bacteria 2982
236 Ga0495636_0262696 3300047318 Bacteria 801
237 Ga0495681_0358307 3300047470 Bacteria 553
238 Ga0495602_0787449 3300048088 Bacteria 639
239 Ga0496101_0120793 3300048904 Bacteria 1981
240 Ga0496109_0136979 3300048912 Bacteria 2288
241 Ga0496110_1345441 3300048913 Bacteria 623
242 Ga0496114_0032014 3300048917 Bacteria 4327
243 Ga0496114_1436334 3300048917 Bacteria 577
244 Ga0496121_0011668 3300048924 Bacteria 9713
245 Ga0496122_0021978 3300048925 Bacteria 5686
246 Ga0496122_0234064 3300048925 Bacteria 1042
247 Ga0496123_0012770 3300048926 Bacteria 7122
248 Ga0496123_0520419 3300048926 Bacteria 516
249 Ga0496124_0113885 3300048927 Bacteria 2173
250 Ga0496124_0116246 3300048927 Bacteria 2145
251 Ga0496124_0340658 3300048927 Bacteria 1065
252 Ga0496125_0005741 3300048928 Bacteria 13653
253 Ga0496125_0009307 3300048928 Bacteria 10132
254 Ga0496126_0033237 3300048929 Bacteria 4853
255 Ga0501071_1073953 3300049587 Bacteria 622
256 Ga0501227_073211 3300049665 Bacteria 891
257 Ga0501080_0815334 3300049742 Bacteria 818
258 nmdc:mga03683_100519_c1 3300050489 Bacteria 1271
259 nmdc:mga03683_594422_c1 3300050489 Bacteria 541
260 nmdc:mga00v17_181984_c1 3300050491 Bacteria 1356
261 nmdc:mga00v17_4569_c1 3300050491 Bacteria 7214
262 nmdc:mga00v17_8686_c1 3300050491 Bacteria 5471
263 nmdc:mga0k408_227540_c1 3300050493 Bacteria 1113
264 nmdc:mga0k408_29506_c1 3300050493 Bacteria 3123
265 nmdc:mga04h51_64412_c1 3300050495 Bacteria 1264
266 nmdc:mga07m45_1772_c1 3300050496 Bacteria 9949
267 nmdc:mga07m45_4747_c1 3300050496 Bacteria 6678
268 nmdc:mga0sz30_19094_c1 3300050516 Bacteria 1440
269 Ga0500559_0134936 3300053136 Bacteria 1154
270 Ga0500619_000043 3300053154 Bacteria 39112
271 Ga0500636_0305556 3300053177 Bacteria 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_12344626 Ga0105242_123446262 109
2 3300048917 Ga0496114_1436334 Ga0496114_1436334_15_392 113
3 iso_pu_bacteria 8048746797 8048748249 114
4 3300006844 Ga0075428_100409283 Ga0075428_1004092832 115
5 3300009094 Ga0111539_10008212 Ga0111539_100082125 115
6 3300048927 Ga0496124_0340658 Ga0496124_0340658_631_1008 115
7 3300014326 Ga0157380_10984263 Ga0157380_109842631 116
8 3300042005 Ga0439448_0187718 Ga0439448_0187718_54_446 116
9 3300048927 Ga0496124_0116246 Ga0496124_0116246_459_827 116
10 3300050491 nmdc:mga00v17_8686_c1 nmdc:mga00v17_8686_c1_5077_5460 116
11 3300005328 Ga0070676_10632968 Ga0070676_106329682 118
12 3300005328 Ga0070676_10950109 Ga0070676_109501092 118
13 3300005331 Ga0070670_100258260 Ga0070670_1002582602 118
14 3300005333 Ga0070677_10237931 Ga0070677_102379312 118
15 3300005343 Ga0070687_101430400 Ga0070687_1014304001 118
16 3300005354 Ga0070675_100098428 Ga0070675_1000984284 118
17 3300005366 Ga0070659_101465573 Ga0070659_1014655731 118
18 3300005367 Ga0070667_100686599 Ga0070667_1006865991 118
19 3300005456 Ga0070678_100763173 Ga0070678_1007631731 118
20 3300005456 Ga0070678_100986874 Ga0070678_1009868742 118
21 3300005543 Ga0070672_100269491 Ga0070672_1002694912 118
22 3300005614 Ga0068856_101692018 Ga0068856_1016920182 118
23 3300005618 Ga0068864_100545030 Ga0068864_1005450302 118
24 3300005834 Ga0068851_10328894 Ga0068851_103288942 118
25 3300005841 Ga0068863_100240128 Ga0068863_1002401282 118
26 3300006195 Ga0075366_11033705 Ga0075366_110337051 118
27 3300006237 Ga0097621_100293284 Ga0097621_1002932842 118
28 3300006353 Ga0075370_10003269 Ga0075370_100032697 118
29 3300006358 Ga0068871_100901416 Ga0068871_1009014162 118
30 3300009176 Ga0105242_10155075 Ga0105242_101550753 118
31 3300009177 Ga0105248_10085812 Ga0105248_100858122 118
32 3300011119 Ga0105246_12289136 Ga0105246_122891362 118
33 3300014969 Ga0157376_10046754 Ga0157376_100467545 118
34 3300025909 Ga0207705_10403012 Ga0207705_104030122 118
35 3300025934 Ga0207686_10199569 Ga0207686_101995692 118
36 3300025937 Ga0207669_10054368 Ga0207669_100543682 118
37 3300025937 Ga0207669_10457927 Ga0207669_104579272 118
38 3300025940 Ga0207691_10070554 Ga0207691_100705542 118
39 3300025941 Ga0207711_10421332 Ga0207711_104213322 118
40 3300025945 Ga0207679_10147577 Ga0207679_101475772 118
41 3300026088 Ga0207641_10368583 Ga0207641_103685832 118
42 3300026089 Ga0207648_10399267 Ga0207648_103992672 118
43 3300026121 Ga0207683_10551548 Ga0207683_105515482 118
44 3300028794 Ga0307515_10000063 Ga0307515_10000063228 118
45 3300031548 Ga0307408_100041537 Ga0307408_1000415373 118
46 3300031548 Ga0307408_100759050 Ga0307408_1007590502 118
47 3300031731 Ga0307405_10099052 Ga0307405_100990523 118
48 3300031824 Ga0307413_10043251 Ga0307413_100432512 118
49 3300031852 Ga0307410_10120407 Ga0307410_101204072 118
50 3300031852 Ga0307410_10274424 Ga0307410_102744242 118
51 3300031901 Ga0307406_10125174 Ga0307406_101251742 118
52 3300031901 Ga0307406_10608569 Ga0307406_106085692 118
53 3300031911 Ga0307412_10006718 Ga0307412_100067185 118
54 3300032002 Ga0307416_100254336 Ga0307416_1002543362 118
55 3300032002 Ga0307416_100433808 Ga0307416_1004338082 118
56 3300032004 Ga0307414_10731423 Ga0307414_107314232 118
57 3300032005 Ga0307411_10841395 Ga0307411_108413952 118
58 3300032126 Ga0307415_100032823 Ga0307415_1000328234 118
59 3300039437 Ga0436365_0830171 Ga0436365_0830171_63_440 118
60 3300041463 Ga0451804_1128707 Ga0451804_1128707_80_475 118
61 3300044712 Ga0453684_0835519 Ga0453684_0835519_15_401 118
62 3300045051 Ga0451576_0153294 Ga0451576_0153294_1235_1621 118
63 3300046475 Ga0495639_0760671 Ga0495639_0760671_53_415 118
64 3300046528 Ga0495642_0379739 Ga0495642_0379739_54_437 118
65 3300046539 Ga0495621_0093582 Ga0495621_0093582_238_630 118
66 3300046683 Ga0495658_0123913 Ga0495658_0123913_898_1290 118
67 3300046683 Ga0495658_0990241 Ga0495658_0990241_14_376 118
68 3300047318 Ga0495636_0016121 Ga0495636_0016121_2398_2772 118
69 3300047470 Ga0495681_0358307 Ga0495681_0358307_121_513 118
70 3300048917 Ga0496114_0032014 Ga0496114_0032014_37_417 118
71 3300048924 Ga0496121_0011668 Ga0496121_0011668_1312_1683 118
72 3300048928 Ga0496125_0005741 Ga0496125_0005741_271_642 118
73 3300050489 nmdc:mga03683_594422_c1 nmdc:mga03683_594422_c1_89_472 118
74 3300050496 nmdc:mga07m45_1772_c1 nmdc:mga07m45_1772_c1_8738_9136 118
75 3300005290 Ga0065712_10346758 Ga0065712_103467582 119
76 3300005330 Ga0070690_100019412 Ga0070690_1000194126 119
77 3300005331 Ga0070670_100398520 Ga0070670_1003985202 119
78 3300005334 Ga0068869_100031701 Ga0068869_1000317014 119
79 3300005335 Ga0070666_10009513 Ga0070666_100095133 119
80 3300005338 Ga0068868_100001502 Ga0068868_10000150211 119
81 3300005340 Ga0070689_100229738 Ga0070689_1002297382 119
82 3300005347 Ga0070668_100332055 Ga0070668_1003320552 119
83 3300005354 Ga0070675_100002597 Ga0070675_1000025972 119
84 3300005355 Ga0070671_100002077 Ga0070671_10000207712 119
85 3300005364 Ga0070673_100006268 Ga0070673_1000062682 119
86 3300005367 Ga0070667_100005638 Ga0070667_1000056386 119
87 3300005456 Ga0070678_100294196 Ga0070678_1002941962 119
88 3300005457 Ga0070662_100199025 Ga0070662_1001990252 119
89 3300005459 Ga0068867_100122357 Ga0068867_1001223572 119
90 3300005466 Ga0070685_10039792 Ga0070685_100397922 119
91 3300005543 Ga0070672_100026283 Ga0070672_1000262837 119
92 3300005544 Ga0070686_100425939 Ga0070686_1004259392 119
93 3300005617 Ga0068859_100018677 Ga0068859_1000186772 119
94 3300005617 Ga0068859_101317235 Ga0068859_1013172352 119
95 3300005618 Ga0068864_100000242 Ga0068864_10000024216 119
96 3300005719 Ga0068861_100251368 Ga0068861_1002513682 119
97 3300005834 Ga0068851_10078465 Ga0068851_100784653 119
98 3300005841 Ga0068863_100034069 Ga0068863_1000340696 119
99 3300005842 Ga0068858_100001331 Ga0068858_10000133113 119
100 3300006237 Ga0097621_100002600 Ga0097621_1000026004 119
101 3300006353 Ga0075370_10032152 Ga0075370_100321523 119
102 3300006358 Ga0068871_100076606 Ga0068871_1000766063 119
103 3300006881 Ga0068865_100110542 Ga0068865_1001105422 119
104 3300006931 Ga0097620_100018677 Ga0097620_1000186772 119
105 3300006931 Ga0097620_101317240 Ga0097620_1013172402 119
106 3300009148 Ga0105243_11809581 Ga0105243_118095812 119
107 3300009176 Ga0105242_12864157 Ga0105242_128641571 119
108 3300009177 Ga0105248_10007436 Ga0105248_100074363 119
109 3300009553 Ga0105249_10109511 Ga0105249_101095114 119
110 3300013296 Ga0157374_10303384 Ga0157374_103033842 119
111 3300013297 Ga0157378_10300326 Ga0157378_103003262 119
112 3300013306 Ga0163162_10149294 Ga0163162_101492942 119
113 3300013308 Ga0157375_10004176 Ga0157375_100041764 119
114 3300013308 Ga0157375_11260297 Ga0157375_112602971 119
115 3300014325 Ga0163163_10018823 Ga0163163_100188236 119
116 3300014326 Ga0157380_10291204 Ga0157380_102912042 119
117 3300014326 Ga0157380_11479393 Ga0157380_114793932 119
118 3300014968 Ga0157379_10012032 Ga0157379_100120328 119
119 3300014968 Ga0157379_12565010 Ga0157379_125650101 119
120 3300017792 Ga0163161_10124614 Ga0163161_101246143 119
121 3300025271 Ga0207666_1010836 Ga0207666_10108362 119
122 3300025321 Ga0207656_10374949 Ga0207656_103749491 119
123 3300025903 Ga0207680_10007701 Ga0207680_100077014 119
124 3300025908 Ga0207643_10625857 Ga0207643_106258572 119
125 3300025925 Ga0207650_10267721 Ga0207650_102677212 119
126 3300025926 Ga0207659_10000312 Ga0207659_1000031213 119
127 3300025931 Ga0207644_10000437 Ga0207644_1000043716 119
128 3300025933 Ga0207706_10300207 Ga0207706_103002072 119
129 3300025934 Ga0207686_11145474 Ga0207686_111454741 119
130 3300025936 Ga0207670_10748535 Ga0207670_107485351 119
131 3300025937 Ga0207669_10786084 Ga0207669_107860842 119
132 3300025938 Ga0207704_10030094 Ga0207704_100300942 119
133 3300025940 Ga0207691_10128614 Ga0207691_101286142 119
134 3300025941 Ga0207711_10001682 Ga0207711_1000168210 119
135 3300025942 Ga0207689_10008999 Ga0207689_100089994 119
136 3300025960 Ga0207651_10006315 Ga0207651_100063152 119
137 3300025961 Ga0207712_10833640 Ga0207712_108336402 119
138 3300025986 Ga0207658_10001772 Ga0207658_100017727 119
139 3300026023 Ga0207677_10001268 Ga0207677_100012689 119
140 3300026035 Ga0207703_10001047 Ga0207703_1000104716 119
141 3300026041 Ga0207639_11458081 Ga0207639_114580811 119
142 3300026075 Ga0207708_10052682 Ga0207708_100526825 119
143 3300026088 Ga0207641_10032392 Ga0207641_100323926 119
144 3300026089 Ga0207648_10042573 Ga0207648_100425734 119
145 3300026095 Ga0207676_10000733 Ga0207676_1000073314 119
146 3300026121 Ga0207683_10008866 Ga0207683_100088664 119
147 3300026142 Ga0207698_10800094 Ga0207698_108000942 119
148 3300028380 Ga0268265_10412674 Ga0268265_104126742 119
149 3300028794 Ga0307515_10076294 Ga0307515_100762945 119
150 3300032004 Ga0307414_10003801 Ga0307414_100038016 119
151 3300032005 Ga0307411_10099387 Ga0307411_100993872 119
152 3300041456 Ga0451795_1286545 Ga0451795_1286545_13_399 119
153 3300046460 Ga0495638_0593700 Ga0495638_0593700_34_396 119
154 3300046471 Ga0495650_0021120 Ga0495650_0021120_2462_2824 119
155 3300046539 Ga0495621_0416220 Ga0495621_0416220_13_420 119
156 3300046558 Ga0495633_0000959 Ga0495633_0000959_11824_12207 119
157 3300046660 Ga0495625_0519222 Ga0495625_0519222_263_625 119
158 3300048904 Ga0496101_0120793 Ga0496101_0120793_1441_1806 119
159 3300048912 Ga0496109_0136979 Ga0496109_0136979_1207_1572 119
160 3300048913 Ga0496110_1345441 Ga0496110_1345441_188_553 119
161 3300048925 Ga0496122_0234064 Ga0496122_0234064_634_1020 119
162 3300049587 Ga0501071_1073953 Ga0501071_1073953_22_387 119
163 3300049665 Ga0501227_073211 Ga0501227_073211_332_739 119
164 3300050493 nmdc:mga0k408_227540_c1 nmdc:mga0k408_227540_c1_58_471 119
165 3300053154 Ga0500619_000043 Ga0500619_000043_21783_22157 119
166 3300053177 Ga0500636_0305556 Ga0500636_0305556_291_653 119
167 3300002705 JGI25156J39149_1000134 JGI25156J39149_100013451 120
168 3300002738 JGI25154J39366_1000151 JGI25154J39366_10001518 120
169 3300002741 JGI25157J39369_1000173 JGI25157J39369_10001739 120
170 3300003323 rootH1_10018602 rootH1_100186023 120
171 3300003775 Ga0055524_1000378 Ga0055524_100037811 120
172 3300003792 Ga0055540_1000011 Ga0055540_1000011155 120
173 3300003794 Ga0055531_10037713 Ga0055531_100377132 120
174 3300005289 Ga0065704_10085452 Ga0065704_100854522 120
175 3300005331 Ga0070670_100615446 Ga0070670_1006154462 120
176 3300005333 Ga0070677_10625852 Ga0070677_106258521 120
177 3300005334 Ga0068869_100093638 Ga0068869_1000936383 120
178 3300005353 Ga0070669_100014437 Ga0070669_1000144372 120
179 3300005353 Ga0070669_100024776 Ga0070669_1000247764 120
180 3300005354 Ga0070675_100721390 Ga0070675_1007213902 120
181 3300005355 Ga0070671_100994697 Ga0070671_1009946971 120
182 3300005356 Ga0070674_100225201 Ga0070674_1002252012 120
183 3300005356 Ga0070674_100466729 Ga0070674_1004667292 120
184 3300005356 Ga0070674_100687097 Ga0070674_1006870972 120
185 3300005367 Ga0070667_100444023 Ga0070667_1004440232 120
186 3300005440 Ga0070705_101275468 Ga0070705_1012754681 120
187 3300005456 Ga0070678_100166993 Ga0070678_1001669932 120
188 3300005459 Ga0068867_100141819 Ga0068867_1001418192 120
189 3300005543 Ga0070672_100091214 Ga0070672_1000912143 120
190 3300005616 Ga0068852_100567270 Ga0068852_1005672702 120
191 3300005718 Ga0068866_10011789 Ga0068866_100117892 120
192 3300005719 Ga0068861_100002558 Ga0068861_1000025586 120
193 3300005843 Ga0068860_100002228 Ga0068860_1000022283 120
194 3300005844 Ga0068862_100015591 Ga0068862_1000155913 120
195 3300006042 Ga0075368_10023015 Ga0075368_100230153 120
196 3300006048 Ga0075363_100047337 Ga0075363_1000473372 120
197 3300006051 Ga0075364_10007284 Ga0075364_100072844 120
198 3300006051 Ga0075364_10012748 Ga0075364_100127484 120
199 3300006051 Ga0075364_10017599 Ga0075364_100175994 120
200 3300006177 Ga0075362_10346401 Ga0075362_103464012 120
201 3300006178 Ga0075367_10000951 Ga0075367_100009516 120
202 3300006195 Ga0075366_10284661 Ga0075366_102846612 120
203 3300006846 Ga0075430_100466689 Ga0075430_1004666891 120
204 3300006881 Ga0068865_100008657 Ga0068865_1000086572 120
205 3300006931 Ga0097620_100353352 Ga0097620_1003533522 120
206 3300007076 Ga0075435_101487484 Ga0075435_1014874842 120
207 3300009176 Ga0105242_11571753 Ga0105242_115717531 120
208 3300009553 Ga0105249_10014093 Ga0105249_100140938 120
209 3300013297 Ga0157378_10096900 Ga0157378_100969003 120
210 3300013306 Ga0163162_10209672 Ga0163162_102096722 120
211 3300014326 Ga0157380_10503860 Ga0157380_105038602 120
212 3300014326 Ga0157380_10906158 Ga0157380_109061582 120
213 3300014968 Ga0157379_10090063 Ga0157379_100900633 120
214 3300025263 Ga0209565_1033477 Ga0209565_10334771 120
215 3300025291 Ga0209675_1023414 Ga0209675_10234142 120
216 3300025298 Ga0209050_1000376 Ga0209050_100037632 120
217 3300025298 Ga0209050_1023829 Ga0209050_10238293 120
218 3300025299 Ga0209256_1000092 Ga0209256_1000092189 120
219 3300025299 Ga0209256_1103613 Ga0209256_11036132 120
220 3300025303 Ga0209051_1000020 Ga0209051_1000020155 120
221 3300025304 Ga0209257_1000085 Ga0209257_1000085155 120
222 3300025893 Ga0207682_10425689 Ga0207682_104256892 120
223 3300025907 Ga0207645_10545794 Ga0207645_105457942 120
224 3300025908 Ga0207643_10202514 Ga0207643_102025142 120
225 3300025923 Ga0207681_10122088 Ga0207681_101220883 120
226 3300025926 Ga0207659_10484875 Ga0207659_104848752 120
227 3300025933 Ga0207706_10077613 Ga0207706_100776132 120
228 3300025934 Ga0207686_11328898 Ga0207686_113288982 120
229 3300025937 Ga0207669_10181358 Ga0207669_101813582 120
230 3300025937 Ga0207669_10204467 Ga0207669_102044672 120
231 3300025937 Ga0207669_10304869 Ga0207669_103048692 120
232 3300025938 Ga0207704_10004113 Ga0207704_100041139 120
233 3300025940 Ga0207691_10244625 Ga0207691_102446252 120
234 3300025942 Ga0207689_10593565 Ga0207689_105935652 120
235 3300025961 Ga0207712_10082827 Ga0207712_100828272 120
236 3300025986 Ga0207658_10207443 Ga0207658_102074432 120
237 3300026089 Ga0207648_10000432 Ga0207648_1000043245 120
238 3300026116 Ga0207674_10619788 Ga0207674_106197882 120
239 3300026118 Ga0207675_100002706 Ga0207675_10000270619 120
240 3300026121 Ga0207683_10033784 Ga0207683_100337847 120
241 3300026142 Ga0207698_10382984 Ga0207698_103829842 120
242 3300028380 Ga0268265_10027073 Ga0268265_100270734 120
243 3300035691 Ga0373931_0401521 Ga0373931_0401521_332_727 120
244 3300037471 Ga0395905_0005330 Ga0395905_0005330_2466_2849 120
245 3300041404 Ga0439436_0188246 Ga0439436_0188246_133_543 120
246 3300041486 Ga0451807_0988537 Ga0451807_0988537_207_584 120
247 3300042008 Ga0439450_062130 Ga0439450_062130_90_509 120
248 3300042437 Ga0439444_0117400 Ga0439444_0117400_131_550 120
249 3300042439 Ga0439464_0091045 Ga0439464_0091045_326_745 120
250 3300042461 Ga0439460_0010234 Ga0439460_0010234_184_603 120
251 3300044683 Ga0466965_0131813 Ga0466965_0131813_184_558 120
252 3300044712 Ga0453684_0082944 Ga0453684_0082944_2545_2919 120
253 3300044712 Ga0453684_0860458 Ga0453684_0860458_398_787 120
254 3300046535 Ga0495586_0081793 Ga0495586_0081793_795_1193 120
255 3300046539 Ga0495621_0001506 Ga0495621_0001506_4071_4457 120
256 3300047318 Ga0495636_0262696 Ga0495636_0262696_354_722 120
257 3300048088 Ga0495602_0787449 Ga0495602_0787449_128_526 120
258 3300048925 Ga0496122_0021978 Ga0496122_0021978_2072_2455 120
259 3300048926 Ga0496123_0012770 Ga0496123_0012770_2536_2919 120
260 3300048926 Ga0496123_0520419 Ga0496123_0520419_27_503 120
261 3300048927 Ga0496124_0113885 Ga0496124_0113885_1702_2085 120
262 3300048928 Ga0496125_0009307 Ga0496125_0009307_4147_4530 120
263 3300048929 Ga0496126_0033237 Ga0496126_0033237_3015_3398 120
264 3300049742 Ga0501080_0815334 Ga0501080_0815334_376_750 120
265 3300050489 nmdc:mga03683_100519_c1 nmdc:mga03683_100519_c1_740_1147 120
266 3300050491 nmdc:mga00v17_181984_c1 nmdc:mga00v17_181984_c1_405_812 120
267 3300050491 nmdc:mga00v17_4569_c1 nmdc:mga00v17_4569_c1_3213_3587 120
268 3300050493 nmdc:mga0k408_29506_c1 nmdc:mga0k408_29506_c1_893_1300 120
269 3300050495 nmdc:mga04h51_64412_c1 nmdc:mga04h51_64412_c1_142_549 120
270 3300050496 nmdc:mga07m45_4747_c1 nmdc:mga07m45_4747_c1_3885_4292 120
271 3300050516 nmdc:mga0sz30_19094_c1 nmdc:mga0sz30_19094_c1_53_460 120
272 3300053136 Ga0500559_0134936 Ga0500559_0134936_597_977 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23544

7

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d5c-assembly1.cif.gz_H anti-hiv-1 gp120-scd4 complex antibody cg10 fab in complex with b41-scd4 0.7445 59 80
3gbn-assembly1.cif.gz_H crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin 0.7041 59 80
7ycy-assembly1.cif.gz_D sars-cov-2 omicron 1-rbd up spike trimer complexed with three xg005 molecules 0.6826 59 82
6gq8-assembly1.cif.gz_D superoxide reductase from nanoarchaeum equitans 0.6506 8 31
7c5z-assembly1.cif.gz_A crystal structure of spring viremia of carp virus phosphoprotein central domain 0.6168 13 77
ID Description Score Start End Superfamily
af_Q55CI7_27_128_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8762 43 77 3.30.70.330
af_A0A0R0GDH2_2_170_3.30.70.2890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;XS domain 0.8353 45 77 3.30.70.2890
af_D3ZRG8_1481_1608_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8219 43 77 3.30.70.330
af_Q6K925_297_397_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8185 45 77 3.30.70.330
af_A0A1D6KWK9_191_358_3.30.70.2890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;XS domain 0.8151 42 77 3.30.70.2890
ID Description Score Start End GO Terms
AF-A0A1G7A0F2-F1-model_v4 Beta-lactamase 0.9858 2 119
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.9738 8 76
AF-A0A0K8NZT1-F1-model_v4 Small uncharacterized protein Bpro_4170 0.9699 1 120
AF-A0A7Z0MET8-F1-model_v4 Beta-lactamase 0.967 1 110
AF-A0A519EEN4-F1-model_v4 Beta-lactamase 0.9624 4 119

Feature Viewer

pLDDT pTM Quality
90.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map