F378333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 272 | 175 | 271 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_11809581|Ga0105243_118095812 |
| Length | 148 |
| Sequence | MSRTRSVPLYRLAHGRTGDKGNRSNISVIAWHPALWPLLVEQVTEVRVAEQFAHRRPAQVTRHLLPQLQAMNFVLDEVLDGGVNDALNLDSHGKALAFHLLDLEIAVPEALQAHLAGSDDDVSQPRPTTGDGMDASHPLIDCEGCESG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 124 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 130 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 133 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 134 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 135 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 136 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 137 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 159 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 167 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 168 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 169 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 170 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 173 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 174 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 175 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.24 |
| Nodule | 0 |
| Rhizoplane | 2.94 |
| Rhizosphere | 76.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000134 | 3300002705 | Bacteria | 53987 |
| 2 | JGI25154J39366_1000151 | 3300002738 | Bacteria | 53987 |
| 3 | JGI25157J39369_1000173 | 3300002741 | Bacteria | 54214 |
| 4 | rootH1_10018602 | 3300003323 | Bacteria | 2534 |
| 5 | Ga0055524_1000378 | 3300003775 | Bacteria | 38772 |
| 6 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 7 | Ga0055531_10037713 | 3300003794 | Bacteria | 1464 |
| 8 | Ga0065704_10085452 | 3300005289 | Bacteria | 3221 |
| 9 | Ga0065712_10346758 | 3300005290 | Bacteria | 793 |
| 10 | Ga0070676_10632968 | 3300005328 | Bacteria | 775 |
| 11 | Ga0070676_10950109 | 3300005328 | Bacteria | 643 |
| 12 | Ga0070690_100019412 | 3300005330 | Bacteria | 4125 |
| 13 | Ga0070670_100258260 | 3300005331 | Bacteria | 1518 |
| 14 | Ga0070670_100398520 | 3300005331 | Bacteria | 1215 |
| 15 | Ga0070670_100615446 | 3300005331 | Bacteria | 973 |
| 16 | Ga0070677_10237931 | 3300005333 | Bacteria | 897 |
| 17 | Ga0070677_10625852 | 3300005333 | Bacteria | 599 |
| 18 | Ga0068869_100031701 | 3300005334 | Bacteria | 3719 |
| 19 | Ga0068869_100093638 | 3300005334 | Bacteria | 2264 |
| 20 | Ga0070666_10009513 | 3300005335 | Bacteria | 6061 |
| 21 | Ga0068868_100001502 | 3300005338 | Bacteria | 16064 |
| 22 | Ga0070689_100229738 | 3300005340 | Bacteria | 1525 |
| 23 | Ga0070687_101430400 | 3300005343 | Bacteria | 518 |
| 24 | Ga0070668_100332055 | 3300005347 | Bacteria | 1282 |
| 25 | Ga0070669_100014437 | 3300005353 | Bacteria | 5621 |
| 26 | Ga0070669_100024776 | 3300005353 | Bacteria | 4306 |
| 27 | Ga0070675_100002597 | 3300005354 | Bacteria | 13545 |
| 28 | Ga0070675_100098428 | 3300005354 | Bacteria | 2460 |
| 29 | Ga0070675_100721390 | 3300005354 | Bacteria | 909 |
| 30 | Ga0070671_100002077 | 3300005355 | Bacteria | 15425 |
| 31 | Ga0070671_100994697 | 3300005355 | Bacteria | 735 |
| 32 | Ga0070674_100225201 | 3300005356 | Bacteria | 1461 |
| 33 | Ga0070674_100466729 | 3300005356 | Bacteria | 1045 |
| 34 | Ga0070674_100687097 | 3300005356 | Bacteria | 874 |
| 35 | Ga0070673_100006268 | 3300005364 | Bacteria | 7715 |
| 36 | Ga0070659_101465573 | 3300005366 | Bacteria | 608 |
| 37 | Ga0070667_100005638 | 3300005367 | Bacteria | 10455 |
| 38 | Ga0070667_100444023 | 3300005367 | Bacteria | 1185 |
| 39 | Ga0070667_100686599 | 3300005367 | Bacteria | 947 |
| 40 | Ga0070705_101275468 | 3300005440 | Bacteria | 608 |
| 41 | Ga0070678_100166993 | 3300005456 | Bacteria | 1789 |
| 42 | Ga0070678_100294196 | 3300005456 | Bacteria | 1378 |
| 43 | Ga0070678_100763173 | 3300005456 | Bacteria | 876 |
| 44 | Ga0070678_100986874 | 3300005456 | Bacteria | 773 |
| 45 | Ga0070662_100199025 | 3300005457 | Bacteria | 1588 |
| 46 | Ga0068867_100122357 | 3300005459 | Bacteria | 2012 |
| 47 | Ga0068867_100141819 | 3300005459 | Bacteria | 1879 |
| 48 | Ga0070685_10039792 | 3300005466 | Bacteria | 2673 |
| 49 | Ga0070672_100026283 | 3300005543 | Bacteria | 4329 |
| 50 | Ga0070672_100091214 | 3300005543 | Bacteria | 2458 |
| 51 | Ga0070672_100269491 | 3300005543 | Bacteria | 1437 |
| 52 | Ga0070686_100425939 | 3300005544 | Bacteria | 1015 |
| 53 | Ga0068856_101692018 | 3300005614 | Bacteria | 645 |
| 54 | Ga0068852_100567270 | 3300005616 | Bacteria | 1137 |
| 55 | Ga0068859_100018677 | 3300005617 | Bacteria | 6967 |
| 56 | Ga0068859_101317235 | 3300005617 | Bacteria | 796 |
| 57 | Ga0068864_100000242 | 3300005618 | Bacteria | 48756 |
| 58 | Ga0068864_100545030 | 3300005618 | Bacteria | 1120 |
| 59 | Ga0068866_10011789 | 3300005718 | Bacteria | 3793 |
| 60 | Ga0068861_100002558 | 3300005719 | Bacteria | 11892 |
| 61 | Ga0068861_100251368 | 3300005719 | Bacteria | 1508 |
| 62 | Ga0068851_10078465 | 3300005834 | Bacteria | 1721 |
| 63 | Ga0068851_10328894 | 3300005834 | Bacteria | 885 |
| 64 | Ga0068863_100034069 | 3300005841 | Bacteria | 4851 |
| 65 | Ga0068863_100240128 | 3300005841 | Bacteria | 1749 |
| 66 | Ga0068858_100001331 | 3300005842 | Bacteria | 25503 |
| 67 | Ga0068860_100002228 | 3300005843 | Bacteria | 20406 |
| 68 | Ga0068862_100015591 | 3300005844 | Bacteria | 6312 |
| 69 | Ga0075368_10023015 | 3300006042 | Bacteria | 2376 |
| 70 | Ga0075363_100047337 | 3300006048 | Bacteria | 2283 |
| 71 | Ga0075364_10007284 | 3300006051 | Bacteria | 6564 |
| 72 | Ga0075364_10012748 | 3300006051 | Bacteria | 5155 |
| 73 | Ga0075364_10017599 | 3300006051 | Bacteria | 4469 |
| 74 | Ga0075362_10346401 | 3300006177 | Bacteria | 743 |
| 75 | Ga0075367_10000951 | 3300006178 | Bacteria | 11789 |
| 76 | Ga0075366_10284661 | 3300006195 | Bacteria | 1010 |
| 77 | Ga0075366_11033705 | 3300006195 | Bacteria | 513 |
| 78 | Ga0097621_100002600 | 3300006237 | Bacteria | 12373 |
| 79 | Ga0097621_100293284 | 3300006237 | Bacteria | 1435 |
| 80 | Ga0075370_10003269 | 3300006353 | Bacteria | 7683 |
| 81 | Ga0075370_10032152 | 3300006353 | Bacteria | 2932 |
| 82 | Ga0068871_100076606 | 3300006358 | Bacteria | 2763 |
| 83 | Ga0068871_100901416 | 3300006358 | Bacteria | 819 |
| 84 | Ga0075428_100409283 | 3300006844 | Bacteria | 1453 |
| 85 | Ga0075430_100466689 | 3300006846 | Bacteria | 1042 |
| 86 | Ga0068865_100008657 | 3300006881 | Bacteria | 6295 |
| 87 | Ga0068865_100110542 | 3300006881 | Bacteria | 2027 |
| 88 | Ga0097620_100018677 | 3300006931 | Bacteria | 6967 |
| 89 | Ga0097620_100353352 | 3300006931 | Bacteria | 1565 |
| 90 | Ga0097620_101317240 | 3300006931 | Bacteria | 796 |
| 91 | Ga0075435_101487484 | 3300007076 | Bacteria | 594 |
| 92 | Ga0111539_10008212 | 3300009094 | Bacteria | 13285 |
| 93 | Ga0105243_11809581 | 3300009148 | Bacteria | 642 |
| 94 | Ga0105242_10155075 | 3300009176 | Bacteria | 2000 |
| 95 | Ga0105242_11571753 | 3300009176 | Bacteria | 690 |
| 96 | Ga0105242_12344626 | 3300009176 | Bacteria | 580 |
| 97 | Ga0105242_12864157 | 3300009176 | Bacteria | 533 |
| 98 | Ga0105248_10007436 | 3300009177 | Bacteria | 12018 |
| 99 | Ga0105248_10085812 | 3300009177 | Bacteria | 3542 |
| 100 | Ga0105249_10014093 | 3300009553 | Bacteria | 7068 |
| 101 | Ga0105249_10109511 | 3300009553 | Bacteria | 2609 |
| 102 | Ga0105246_12289136 | 3300011119 | Bacteria | 528 |
| 103 | Ga0157374_10303384 | 3300013296 | Bacteria | 1580 |
| 104 | Ga0157378_10096900 | 3300013297 | Bacteria | 2688 |
| 105 | Ga0157378_10300326 | 3300013297 | Bacteria | 1554 |
| 106 | Ga0163162_10149294 | 3300013306 | Bacteria | 2454 |
| 107 | Ga0163162_10209672 | 3300013306 | Bacteria | 2078 |
| 108 | Ga0157375_10004176 | 3300013308 | Bacteria | 12534 |
| 109 | Ga0157375_11260297 | 3300013308 | Bacteria | 868 |
| 110 | Ga0163163_10018823 | 3300014325 | Bacteria | 6475 |
| 111 | Ga0157380_10291204 | 3300014326 | Bacteria | 1499 |
| 112 | Ga0157380_10503860 | 3300014326 | Bacteria | 1177 |
| 113 | Ga0157380_10906158 | 3300014326 | Bacteria | 908 |
| 114 | Ga0157380_10984263 | 3300014326 | Bacteria | 876 |
| 115 | Ga0157380_11479393 | 3300014326 | Bacteria | 732 |
| 116 | Ga0157379_10012032 | 3300014968 | Bacteria | 7559 |
| 117 | Ga0157379_10090063 | 3300014968 | Bacteria | 2752 |
| 118 | Ga0157379_12565010 | 3300014968 | Bacteria | 510 |
| 119 | Ga0157376_10046754 | 3300014969 | Bacteria | 3571 |
| 120 | Ga0163161_10124614 | 3300017792 | Bacteria | 1939 |
| 121 | Ga0209565_1033477 | 3300025263 | Bacteria | 989 |
| 122 | Ga0207666_1010836 | 3300025271 | Bacteria | 1253 |
| 123 | Ga0209675_1023414 | 3300025291 | Bacteria | 1600 |
| 124 | Ga0209050_1000376 | 3300025298 | Bacteria | 84318 |
| 125 | Ga0209050_1023829 | 3300025298 | Bacteria | 2139 |
| 126 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 127 | Ga0209256_1103613 | 3300025299 | Bacteria | 584 |
| 128 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 129 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 130 | Ga0207656_10374949 | 3300025321 | Bacteria | 713 |
| 131 | Ga0207682_10425689 | 3300025893 | Bacteria | 628 |
| 132 | Ga0207680_10007701 | 3300025903 | Bacteria | 5264 |
| 133 | Ga0207645_10545794 | 3300025907 | Bacteria | 786 |
| 134 | Ga0207643_10202514 | 3300025908 | Bacteria | 1209 |
| 135 | Ga0207643_10625857 | 3300025908 | Bacteria | 694 |
| 136 | Ga0207705_10403012 | 3300025909 | Bacteria | 1058 |
| 137 | Ga0207681_10122088 | 3300025923 | Bacteria | 1912 |
| 138 | Ga0207650_10267721 | 3300025925 | Bacteria | 1388 |
| 139 | Ga0207659_10000312 | 3300025926 | Bacteria | 29506 |
| 140 | Ga0207659_10484875 | 3300025926 | Bacteria | 1045 |
| 141 | Ga0207644_10000437 | 3300025931 | Bacteria | 26946 |
| 142 | Ga0207706_10077613 | 3300025933 | Bacteria | 2921 |
| 143 | Ga0207706_10300207 | 3300025933 | Bacteria | 1399 |
| 144 | Ga0207686_10199569 | 3300025934 | Bacteria | 1432 |
| 145 | Ga0207686_11145474 | 3300025934 | Bacteria | 635 |
| 146 | Ga0207686_11328898 | 3300025934 | Bacteria | 591 |
| 147 | Ga0207670_10748535 | 3300025936 | Bacteria | 811 |
| 148 | Ga0207669_10054368 | 3300025937 | Bacteria | 2418 |
| 149 | Ga0207669_10181358 | 3300025937 | Bacteria | 1510 |
| 150 | Ga0207669_10204467 | 3300025937 | Bacteria | 1436 |
| 151 | Ga0207669_10304869 | 3300025937 | Bacteria | 1212 |
| 152 | Ga0207669_10457927 | 3300025937 | Bacteria | 1012 |
| 153 | Ga0207669_10786084 | 3300025937 | Bacteria | 788 |
| 154 | Ga0207704_10004113 | 3300025938 | Bacteria | 6628 |
| 155 | Ga0207704_10030094 | 3300025938 | Bacteria | 3040 |
| 156 | Ga0207691_10070554 | 3300025940 | Bacteria | 3154 |
| 157 | Ga0207691_10128614 | 3300025940 | Bacteria | 2239 |
| 158 | Ga0207691_10244625 | 3300025940 | Bacteria | 1550 |
| 159 | Ga0207711_10001682 | 3300025941 | Bacteria | 20373 |
| 160 | Ga0207711_10421332 | 3300025941 | Bacteria | 1242 |
| 161 | Ga0207689_10008999 | 3300025942 | Bacteria | 8648 |
| 162 | Ga0207689_10593565 | 3300025942 | Bacteria | 931 |
| 163 | Ga0207679_10147577 | 3300025945 | Bacteria | 1910 |
| 164 | Ga0207651_10006315 | 3300025960 | Bacteria | 6187 |
| 165 | Ga0207712_10082827 | 3300025961 | Bacteria | 2340 |
| 166 | Ga0207712_10833640 | 3300025961 | Bacteria | 812 |
| 167 | Ga0207658_10001772 | 3300025986 | Bacteria | 16204 |
| 168 | Ga0207658_10207443 | 3300025986 | Bacteria | 1640 |
| 169 | Ga0207677_10001268 | 3300026023 | Bacteria | 13594 |
| 170 | Ga0207703_10001047 | 3300026035 | Bacteria | 26351 |
| 171 | Ga0207639_11458081 | 3300026041 | Bacteria | 642 |
| 172 | Ga0207708_10052682 | 3300026075 | Bacteria | 3100 |
| 173 | Ga0207641_10032392 | 3300026088 | Bacteria | 4339 |
| 174 | Ga0207641_10368583 | 3300026088 | Bacteria | 1373 |
| 175 | Ga0207648_10000432 | 3300026089 | Bacteria | 46265 |
| 176 | Ga0207648_10042573 | 3300026089 | Bacteria | 3985 |
| 177 | Ga0207648_10399267 | 3300026089 | Bacteria | 1245 |
| 178 | Ga0207676_10000733 | 3300026095 | Bacteria | 25719 |
| 179 | Ga0207674_10619788 | 3300026116 | Bacteria | 1045 |
| 180 | Ga0207675_100002706 | 3300026118 | Bacteria | 17462 |
| 181 | Ga0207683_10008866 | 3300026121 | Bacteria | 8577 |
| 182 | Ga0207683_10033784 | 3300026121 | Bacteria | 4445 |
| 183 | Ga0207683_10551548 | 3300026121 | Bacteria | 1066 |
| 184 | Ga0207698_10382984 | 3300026142 | Bacteria | 1339 |
| 185 | Ga0207698_10800094 | 3300026142 | Bacteria | 945 |
| 186 | Ga0268265_10027073 | 3300028380 | Bacteria | 4087 |
| 187 | Ga0268265_10412674 | 3300028380 | Bacteria | 1251 |
| 188 | Ga0307515_10000063 | 3300028794 | Bacteria | 245504 |
| 189 | Ga0307515_10076294 | 3300028794 | Bacteria | 4450 |
| 190 | Ga0307408_100041537 | 3300031548 | Bacteria | 3261 |
| 191 | Ga0307408_100759050 | 3300031548 | Bacteria | 877 |
| 192 | Ga0307405_10099052 | 3300031731 | Bacteria | 1950 |
| 193 | Ga0307413_10043251 | 3300031824 | Bacteria | 2653 |
| 194 | Ga0307410_10120407 | 3300031852 | Bacteria | 1913 |
| 195 | Ga0307410_10274424 | 3300031852 | Bacteria | 1320 |
| 196 | Ga0307406_10125174 | 3300031901 | Bacteria | 1794 |
| 197 | Ga0307406_10608569 | 3300031901 | Bacteria | 902 |
| 198 | Ga0307412_10006718 | 3300031911 | Bacteria | 6522 |
| 199 | Ga0307416_100254336 | 3300032002 | Bacteria | 1712 |
| 200 | Ga0307416_100433808 | 3300032002 | Bacteria | 1362 |
| 201 | Ga0307414_10003801 | 3300032004 | Bacteria | 8116 |
| 202 | Ga0307414_10731423 | 3300032004 | Bacteria | 898 |
| 203 | Ga0307411_10099387 | 3300032005 | Bacteria | 2053 |
| 204 | Ga0307411_10841395 | 3300032005 | Bacteria | 811 |
| 205 | Ga0307415_100032823 | 3300032126 | Bacteria | 3363 |
| 206 | Ga0373931_0401521 | 3300035691 | Bacteria | 868 |
| 207 | Ga0395905_0005330 | 3300037471 | Bacteria | 13142 |
| 208 | Ga0436365_0830171 | 3300039437 | Bacteria | 1008 |
| 209 | Ga0439436_0188246 | 3300041404 | Bacteria | 588 |
| 210 | Ga0451795_1286545 | 3300041456 | Bacteria | 577 |
| 211 | Ga0451804_1128707 | 3300041463 | Bacteria | 628 |
| 212 | Ga0451807_0988537 | 3300041486 | Bacteria | 652 |
| 213 | Ga0439448_0187718 | 3300042005 | Bacteria | 723 |
| 214 | Ga0439450_062130 | 3300042008 | Bacteria | 904 |
| 215 | Ga0439444_0117400 | 3300042437 | Bacteria | 618 |
| 216 | Ga0439464_0091045 | 3300042439 | Bacteria | 919 |
| 217 | Ga0439460_0010234 | 3300042461 | Bacteria | 2396 |
| 218 | Ga0466965_0131813 | 3300044683 | Bacteria | 1297 |
| 219 | Ga0453684_0082944 | 3300044712 | Bacteria | 3992 |
| 220 | Ga0453684_0835519 | 3300044712 | Bacteria | 991 |
| 221 | Ga0453684_0860458 | 3300044712 | Bacteria | 974 |
| 222 | Ga0451576_0153294 | 3300045051 | Bacteria | 2403 |
| 223 | Ga0495638_0593700 | 3300046460 | Bacteria | 545 |
| 224 | Ga0495650_0021120 | 3300046471 | Bacteria | 3155 |
| 225 | Ga0495639_0760671 | 3300046475 | Bacteria | 502 |
| 226 | Ga0495642_0379739 | 3300046528 | Bacteria | 622 |
| 227 | Ga0495586_0081793 | 3300046535 | Bacteria | 1775 |
| 228 | Ga0495621_0001506 | 3300046539 | Bacteria | 6044 |
| 229 | Ga0495621_0093582 | 3300046539 | Bacteria | 1136 |
| 230 | Ga0495621_0416220 | 3300046539 | Bacteria | 572 |
| 231 | Ga0495633_0000959 | 3300046558 | Bacteria | 23887 |
| 232 | Ga0495625_0519222 | 3300046660 | Bacteria | 726 |
| 233 | Ga0495658_0123913 | 3300046683 | Bacteria | 1566 |
| 234 | Ga0495658_0990241 | 3300046683 | Bacteria | 537 |
| 235 | Ga0495636_0016121 | 3300047318 | Bacteria | 2982 |
| 236 | Ga0495636_0262696 | 3300047318 | Bacteria | 801 |
| 237 | Ga0495681_0358307 | 3300047470 | Bacteria | 553 |
| 238 | Ga0495602_0787449 | 3300048088 | Bacteria | 639 |
| 239 | Ga0496101_0120793 | 3300048904 | Bacteria | 1981 |
| 240 | Ga0496109_0136979 | 3300048912 | Bacteria | 2288 |
| 241 | Ga0496110_1345441 | 3300048913 | Bacteria | 623 |
| 242 | Ga0496114_0032014 | 3300048917 | Bacteria | 4327 |
| 243 | Ga0496114_1436334 | 3300048917 | Bacteria | 577 |
| 244 | Ga0496121_0011668 | 3300048924 | Bacteria | 9713 |
| 245 | Ga0496122_0021978 | 3300048925 | Bacteria | 5686 |
| 246 | Ga0496122_0234064 | 3300048925 | Bacteria | 1042 |
| 247 | Ga0496123_0012770 | 3300048926 | Bacteria | 7122 |
| 248 | Ga0496123_0520419 | 3300048926 | Bacteria | 516 |
| 249 | Ga0496124_0113885 | 3300048927 | Bacteria | 2173 |
| 250 | Ga0496124_0116246 | 3300048927 | Bacteria | 2145 |
| 251 | Ga0496124_0340658 | 3300048927 | Bacteria | 1065 |
| 252 | Ga0496125_0005741 | 3300048928 | Bacteria | 13653 |
| 253 | Ga0496125_0009307 | 3300048928 | Bacteria | 10132 |
| 254 | Ga0496126_0033237 | 3300048929 | Bacteria | 4853 |
| 255 | Ga0501071_1073953 | 3300049587 | Bacteria | 622 |
| 256 | Ga0501227_073211 | 3300049665 | Bacteria | 891 |
| 257 | Ga0501080_0815334 | 3300049742 | Bacteria | 818 |
| 258 | nmdc:mga03683_100519_c1 | 3300050489 | Bacteria | 1271 |
| 259 | nmdc:mga03683_594422_c1 | 3300050489 | Bacteria | 541 |
| 260 | nmdc:mga00v17_181984_c1 | 3300050491 | Bacteria | 1356 |
| 261 | nmdc:mga00v17_4569_c1 | 3300050491 | Bacteria | 7214 |
| 262 | nmdc:mga00v17_8686_c1 | 3300050491 | Bacteria | 5471 |
| 263 | nmdc:mga0k408_227540_c1 | 3300050493 | Bacteria | 1113 |
| 264 | nmdc:mga0k408_29506_c1 | 3300050493 | Bacteria | 3123 |
| 265 | nmdc:mga04h51_64412_c1 | 3300050495 | Bacteria | 1264 |
| 266 | nmdc:mga07m45_1772_c1 | 3300050496 | Bacteria | 9949 |
| 267 | nmdc:mga07m45_4747_c1 | 3300050496 | Bacteria | 6678 |
| 268 | nmdc:mga0sz30_19094_c1 | 3300050516 | Bacteria | 1440 |
| 269 | Ga0500559_0134936 | 3300053136 | Bacteria | 1154 |
| 270 | Ga0500619_000043 | 3300053154 | Bacteria | 39112 |
| 271 | Ga0500636_0305556 | 3300053177 | Bacteria | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_12344626 | Ga0105242_123446262 | 109 |
| 2 | 3300048917 | Ga0496114_1436334 | Ga0496114_1436334_15_392 | 113 |
| 3 | iso_pu_bacteria | 8048746797 | 8048748249 | 114 |
| 4 | 3300006844 | Ga0075428_100409283 | Ga0075428_1004092832 | 115 |
| 5 | 3300009094 | Ga0111539_10008212 | Ga0111539_100082125 | 115 |
| 6 | 3300048927 | Ga0496124_0340658 | Ga0496124_0340658_631_1008 | 115 |
| 7 | 3300014326 | Ga0157380_10984263 | Ga0157380_109842631 | 116 |
| 8 | 3300042005 | Ga0439448_0187718 | Ga0439448_0187718_54_446 | 116 |
| 9 | 3300048927 | Ga0496124_0116246 | Ga0496124_0116246_459_827 | 116 |
| 10 | 3300050491 | nmdc:mga00v17_8686_c1 | nmdc:mga00v17_8686_c1_5077_5460 | 116 |
| 11 | 3300005328 | Ga0070676_10632968 | Ga0070676_106329682 | 118 |
| 12 | 3300005328 | Ga0070676_10950109 | Ga0070676_109501092 | 118 |
| 13 | 3300005331 | Ga0070670_100258260 | Ga0070670_1002582602 | 118 |
| 14 | 3300005333 | Ga0070677_10237931 | Ga0070677_102379312 | 118 |
| 15 | 3300005343 | Ga0070687_101430400 | Ga0070687_1014304001 | 118 |
| 16 | 3300005354 | Ga0070675_100098428 | Ga0070675_1000984284 | 118 |
| 17 | 3300005366 | Ga0070659_101465573 | Ga0070659_1014655731 | 118 |
| 18 | 3300005367 | Ga0070667_100686599 | Ga0070667_1006865991 | 118 |
| 19 | 3300005456 | Ga0070678_100763173 | Ga0070678_1007631731 | 118 |
| 20 | 3300005456 | Ga0070678_100986874 | Ga0070678_1009868742 | 118 |
| 21 | 3300005543 | Ga0070672_100269491 | Ga0070672_1002694912 | 118 |
| 22 | 3300005614 | Ga0068856_101692018 | Ga0068856_1016920182 | 118 |
| 23 | 3300005618 | Ga0068864_100545030 | Ga0068864_1005450302 | 118 |
| 24 | 3300005834 | Ga0068851_10328894 | Ga0068851_103288942 | 118 |
| 25 | 3300005841 | Ga0068863_100240128 | Ga0068863_1002401282 | 118 |
| 26 | 3300006195 | Ga0075366_11033705 | Ga0075366_110337051 | 118 |
| 27 | 3300006237 | Ga0097621_100293284 | Ga0097621_1002932842 | 118 |
| 28 | 3300006353 | Ga0075370_10003269 | Ga0075370_100032697 | 118 |
| 29 | 3300006358 | Ga0068871_100901416 | Ga0068871_1009014162 | 118 |
| 30 | 3300009176 | Ga0105242_10155075 | Ga0105242_101550753 | 118 |
| 31 | 3300009177 | Ga0105248_10085812 | Ga0105248_100858122 | 118 |
| 32 | 3300011119 | Ga0105246_12289136 | Ga0105246_122891362 | 118 |
| 33 | 3300014969 | Ga0157376_10046754 | Ga0157376_100467545 | 118 |
| 34 | 3300025909 | Ga0207705_10403012 | Ga0207705_104030122 | 118 |
| 35 | 3300025934 | Ga0207686_10199569 | Ga0207686_101995692 | 118 |
| 36 | 3300025937 | Ga0207669_10054368 | Ga0207669_100543682 | 118 |
| 37 | 3300025937 | Ga0207669_10457927 | Ga0207669_104579272 | 118 |
| 38 | 3300025940 | Ga0207691_10070554 | Ga0207691_100705542 | 118 |
| 39 | 3300025941 | Ga0207711_10421332 | Ga0207711_104213322 | 118 |
| 40 | 3300025945 | Ga0207679_10147577 | Ga0207679_101475772 | 118 |
| 41 | 3300026088 | Ga0207641_10368583 | Ga0207641_103685832 | 118 |
| 42 | 3300026089 | Ga0207648_10399267 | Ga0207648_103992672 | 118 |
| 43 | 3300026121 | Ga0207683_10551548 | Ga0207683_105515482 | 118 |
| 44 | 3300028794 | Ga0307515_10000063 | Ga0307515_10000063228 | 118 |
| 45 | 3300031548 | Ga0307408_100041537 | Ga0307408_1000415373 | 118 |
| 46 | 3300031548 | Ga0307408_100759050 | Ga0307408_1007590502 | 118 |
| 47 | 3300031731 | Ga0307405_10099052 | Ga0307405_100990523 | 118 |
| 48 | 3300031824 | Ga0307413_10043251 | Ga0307413_100432512 | 118 |
| 49 | 3300031852 | Ga0307410_10120407 | Ga0307410_101204072 | 118 |
| 50 | 3300031852 | Ga0307410_10274424 | Ga0307410_102744242 | 118 |
| 51 | 3300031901 | Ga0307406_10125174 | Ga0307406_101251742 | 118 |
| 52 | 3300031901 | Ga0307406_10608569 | Ga0307406_106085692 | 118 |
| 53 | 3300031911 | Ga0307412_10006718 | Ga0307412_100067185 | 118 |
| 54 | 3300032002 | Ga0307416_100254336 | Ga0307416_1002543362 | 118 |
| 55 | 3300032002 | Ga0307416_100433808 | Ga0307416_1004338082 | 118 |
| 56 | 3300032004 | Ga0307414_10731423 | Ga0307414_107314232 | 118 |
| 57 | 3300032005 | Ga0307411_10841395 | Ga0307411_108413952 | 118 |
| 58 | 3300032126 | Ga0307415_100032823 | Ga0307415_1000328234 | 118 |
| 59 | 3300039437 | Ga0436365_0830171 | Ga0436365_0830171_63_440 | 118 |
| 60 | 3300041463 | Ga0451804_1128707 | Ga0451804_1128707_80_475 | 118 |
| 61 | 3300044712 | Ga0453684_0835519 | Ga0453684_0835519_15_401 | 118 |
| 62 | 3300045051 | Ga0451576_0153294 | Ga0451576_0153294_1235_1621 | 118 |
| 63 | 3300046475 | Ga0495639_0760671 | Ga0495639_0760671_53_415 | 118 |
| 64 | 3300046528 | Ga0495642_0379739 | Ga0495642_0379739_54_437 | 118 |
| 65 | 3300046539 | Ga0495621_0093582 | Ga0495621_0093582_238_630 | 118 |
| 66 | 3300046683 | Ga0495658_0123913 | Ga0495658_0123913_898_1290 | 118 |
| 67 | 3300046683 | Ga0495658_0990241 | Ga0495658_0990241_14_376 | 118 |
| 68 | 3300047318 | Ga0495636_0016121 | Ga0495636_0016121_2398_2772 | 118 |
| 69 | 3300047470 | Ga0495681_0358307 | Ga0495681_0358307_121_513 | 118 |
| 70 | 3300048917 | Ga0496114_0032014 | Ga0496114_0032014_37_417 | 118 |
| 71 | 3300048924 | Ga0496121_0011668 | Ga0496121_0011668_1312_1683 | 118 |
| 72 | 3300048928 | Ga0496125_0005741 | Ga0496125_0005741_271_642 | 118 |
| 73 | 3300050489 | nmdc:mga03683_594422_c1 | nmdc:mga03683_594422_c1_89_472 | 118 |
| 74 | 3300050496 | nmdc:mga07m45_1772_c1 | nmdc:mga07m45_1772_c1_8738_9136 | 118 |
| 75 | 3300005290 | Ga0065712_10346758 | Ga0065712_103467582 | 119 |
| 76 | 3300005330 | Ga0070690_100019412 | Ga0070690_1000194126 | 119 |
| 77 | 3300005331 | Ga0070670_100398520 | Ga0070670_1003985202 | 119 |
| 78 | 3300005334 | Ga0068869_100031701 | Ga0068869_1000317014 | 119 |
| 79 | 3300005335 | Ga0070666_10009513 | Ga0070666_100095133 | 119 |
| 80 | 3300005338 | Ga0068868_100001502 | Ga0068868_10000150211 | 119 |
| 81 | 3300005340 | Ga0070689_100229738 | Ga0070689_1002297382 | 119 |
| 82 | 3300005347 | Ga0070668_100332055 | Ga0070668_1003320552 | 119 |
| 83 | 3300005354 | Ga0070675_100002597 | Ga0070675_1000025972 | 119 |
| 84 | 3300005355 | Ga0070671_100002077 | Ga0070671_10000207712 | 119 |
| 85 | 3300005364 | Ga0070673_100006268 | Ga0070673_1000062682 | 119 |
| 86 | 3300005367 | Ga0070667_100005638 | Ga0070667_1000056386 | 119 |
| 87 | 3300005456 | Ga0070678_100294196 | Ga0070678_1002941962 | 119 |
| 88 | 3300005457 | Ga0070662_100199025 | Ga0070662_1001990252 | 119 |
| 89 | 3300005459 | Ga0068867_100122357 | Ga0068867_1001223572 | 119 |
| 90 | 3300005466 | Ga0070685_10039792 | Ga0070685_100397922 | 119 |
| 91 | 3300005543 | Ga0070672_100026283 | Ga0070672_1000262837 | 119 |
| 92 | 3300005544 | Ga0070686_100425939 | Ga0070686_1004259392 | 119 |
| 93 | 3300005617 | Ga0068859_100018677 | Ga0068859_1000186772 | 119 |
| 94 | 3300005617 | Ga0068859_101317235 | Ga0068859_1013172352 | 119 |
| 95 | 3300005618 | Ga0068864_100000242 | Ga0068864_10000024216 | 119 |
| 96 | 3300005719 | Ga0068861_100251368 | Ga0068861_1002513682 | 119 |
| 97 | 3300005834 | Ga0068851_10078465 | Ga0068851_100784653 | 119 |
| 98 | 3300005841 | Ga0068863_100034069 | Ga0068863_1000340696 | 119 |
| 99 | 3300005842 | Ga0068858_100001331 | Ga0068858_10000133113 | 119 |
| 100 | 3300006237 | Ga0097621_100002600 | Ga0097621_1000026004 | 119 |
| 101 | 3300006353 | Ga0075370_10032152 | Ga0075370_100321523 | 119 |
| 102 | 3300006358 | Ga0068871_100076606 | Ga0068871_1000766063 | 119 |
| 103 | 3300006881 | Ga0068865_100110542 | Ga0068865_1001105422 | 119 |
| 104 | 3300006931 | Ga0097620_100018677 | Ga0097620_1000186772 | 119 |
| 105 | 3300006931 | Ga0097620_101317240 | Ga0097620_1013172402 | 119 |
| 106 | 3300009148 | Ga0105243_11809581 | Ga0105243_118095812 | 119 |
| 107 | 3300009176 | Ga0105242_12864157 | Ga0105242_128641571 | 119 |
| 108 | 3300009177 | Ga0105248_10007436 | Ga0105248_100074363 | 119 |
| 109 | 3300009553 | Ga0105249_10109511 | Ga0105249_101095114 | 119 |
| 110 | 3300013296 | Ga0157374_10303384 | Ga0157374_103033842 | 119 |
| 111 | 3300013297 | Ga0157378_10300326 | Ga0157378_103003262 | 119 |
| 112 | 3300013306 | Ga0163162_10149294 | Ga0163162_101492942 | 119 |
| 113 | 3300013308 | Ga0157375_10004176 | Ga0157375_100041764 | 119 |
| 114 | 3300013308 | Ga0157375_11260297 | Ga0157375_112602971 | 119 |
| 115 | 3300014325 | Ga0163163_10018823 | Ga0163163_100188236 | 119 |
| 116 | 3300014326 | Ga0157380_10291204 | Ga0157380_102912042 | 119 |
| 117 | 3300014326 | Ga0157380_11479393 | Ga0157380_114793932 | 119 |
| 118 | 3300014968 | Ga0157379_10012032 | Ga0157379_100120328 | 119 |
| 119 | 3300014968 | Ga0157379_12565010 | Ga0157379_125650101 | 119 |
| 120 | 3300017792 | Ga0163161_10124614 | Ga0163161_101246143 | 119 |
| 121 | 3300025271 | Ga0207666_1010836 | Ga0207666_10108362 | 119 |
| 122 | 3300025321 | Ga0207656_10374949 | Ga0207656_103749491 | 119 |
| 123 | 3300025903 | Ga0207680_10007701 | Ga0207680_100077014 | 119 |
| 124 | 3300025908 | Ga0207643_10625857 | Ga0207643_106258572 | 119 |
| 125 | 3300025925 | Ga0207650_10267721 | Ga0207650_102677212 | 119 |
| 126 | 3300025926 | Ga0207659_10000312 | Ga0207659_1000031213 | 119 |
| 127 | 3300025931 | Ga0207644_10000437 | Ga0207644_1000043716 | 119 |
| 128 | 3300025933 | Ga0207706_10300207 | Ga0207706_103002072 | 119 |
| 129 | 3300025934 | Ga0207686_11145474 | Ga0207686_111454741 | 119 |
| 130 | 3300025936 | Ga0207670_10748535 | Ga0207670_107485351 | 119 |
| 131 | 3300025937 | Ga0207669_10786084 | Ga0207669_107860842 | 119 |
| 132 | 3300025938 | Ga0207704_10030094 | Ga0207704_100300942 | 119 |
| 133 | 3300025940 | Ga0207691_10128614 | Ga0207691_101286142 | 119 |
| 134 | 3300025941 | Ga0207711_10001682 | Ga0207711_1000168210 | 119 |
| 135 | 3300025942 | Ga0207689_10008999 | Ga0207689_100089994 | 119 |
| 136 | 3300025960 | Ga0207651_10006315 | Ga0207651_100063152 | 119 |
| 137 | 3300025961 | Ga0207712_10833640 | Ga0207712_108336402 | 119 |
| 138 | 3300025986 | Ga0207658_10001772 | Ga0207658_100017727 | 119 |
| 139 | 3300026023 | Ga0207677_10001268 | Ga0207677_100012689 | 119 |
| 140 | 3300026035 | Ga0207703_10001047 | Ga0207703_1000104716 | 119 |
| 141 | 3300026041 | Ga0207639_11458081 | Ga0207639_114580811 | 119 |
| 142 | 3300026075 | Ga0207708_10052682 | Ga0207708_100526825 | 119 |
| 143 | 3300026088 | Ga0207641_10032392 | Ga0207641_100323926 | 119 |
| 144 | 3300026089 | Ga0207648_10042573 | Ga0207648_100425734 | 119 |
| 145 | 3300026095 | Ga0207676_10000733 | Ga0207676_1000073314 | 119 |
| 146 | 3300026121 | Ga0207683_10008866 | Ga0207683_100088664 | 119 |
| 147 | 3300026142 | Ga0207698_10800094 | Ga0207698_108000942 | 119 |
| 148 | 3300028380 | Ga0268265_10412674 | Ga0268265_104126742 | 119 |
| 149 | 3300028794 | Ga0307515_10076294 | Ga0307515_100762945 | 119 |
| 150 | 3300032004 | Ga0307414_10003801 | Ga0307414_100038016 | 119 |
| 151 | 3300032005 | Ga0307411_10099387 | Ga0307411_100993872 | 119 |
| 152 | 3300041456 | Ga0451795_1286545 | Ga0451795_1286545_13_399 | 119 |
| 153 | 3300046460 | Ga0495638_0593700 | Ga0495638_0593700_34_396 | 119 |
| 154 | 3300046471 | Ga0495650_0021120 | Ga0495650_0021120_2462_2824 | 119 |
| 155 | 3300046539 | Ga0495621_0416220 | Ga0495621_0416220_13_420 | 119 |
| 156 | 3300046558 | Ga0495633_0000959 | Ga0495633_0000959_11824_12207 | 119 |
| 157 | 3300046660 | Ga0495625_0519222 | Ga0495625_0519222_263_625 | 119 |
| 158 | 3300048904 | Ga0496101_0120793 | Ga0496101_0120793_1441_1806 | 119 |
| 159 | 3300048912 | Ga0496109_0136979 | Ga0496109_0136979_1207_1572 | 119 |
| 160 | 3300048913 | Ga0496110_1345441 | Ga0496110_1345441_188_553 | 119 |
| 161 | 3300048925 | Ga0496122_0234064 | Ga0496122_0234064_634_1020 | 119 |
| 162 | 3300049587 | Ga0501071_1073953 | Ga0501071_1073953_22_387 | 119 |
| 163 | 3300049665 | Ga0501227_073211 | Ga0501227_073211_332_739 | 119 |
| 164 | 3300050493 | nmdc:mga0k408_227540_c1 | nmdc:mga0k408_227540_c1_58_471 | 119 |
| 165 | 3300053154 | Ga0500619_000043 | Ga0500619_000043_21783_22157 | 119 |
| 166 | 3300053177 | Ga0500636_0305556 | Ga0500636_0305556_291_653 | 119 |
| 167 | 3300002705 | JGI25156J39149_1000134 | JGI25156J39149_100013451 | 120 |
| 168 | 3300002738 | JGI25154J39366_1000151 | JGI25154J39366_10001518 | 120 |
| 169 | 3300002741 | JGI25157J39369_1000173 | JGI25157J39369_10001739 | 120 |
| 170 | 3300003323 | rootH1_10018602 | rootH1_100186023 | 120 |
| 171 | 3300003775 | Ga0055524_1000378 | Ga0055524_100037811 | 120 |
| 172 | 3300003792 | Ga0055540_1000011 | Ga0055540_1000011155 | 120 |
| 173 | 3300003794 | Ga0055531_10037713 | Ga0055531_100377132 | 120 |
| 174 | 3300005289 | Ga0065704_10085452 | Ga0065704_100854522 | 120 |
| 175 | 3300005331 | Ga0070670_100615446 | Ga0070670_1006154462 | 120 |
| 176 | 3300005333 | Ga0070677_10625852 | Ga0070677_106258521 | 120 |
| 177 | 3300005334 | Ga0068869_100093638 | Ga0068869_1000936383 | 120 |
| 178 | 3300005353 | Ga0070669_100014437 | Ga0070669_1000144372 | 120 |
| 179 | 3300005353 | Ga0070669_100024776 | Ga0070669_1000247764 | 120 |
| 180 | 3300005354 | Ga0070675_100721390 | Ga0070675_1007213902 | 120 |
| 181 | 3300005355 | Ga0070671_100994697 | Ga0070671_1009946971 | 120 |
| 182 | 3300005356 | Ga0070674_100225201 | Ga0070674_1002252012 | 120 |
| 183 | 3300005356 | Ga0070674_100466729 | Ga0070674_1004667292 | 120 |
| 184 | 3300005356 | Ga0070674_100687097 | Ga0070674_1006870972 | 120 |
| 185 | 3300005367 | Ga0070667_100444023 | Ga0070667_1004440232 | 120 |
| 186 | 3300005440 | Ga0070705_101275468 | Ga0070705_1012754681 | 120 |
| 187 | 3300005456 | Ga0070678_100166993 | Ga0070678_1001669932 | 120 |
| 188 | 3300005459 | Ga0068867_100141819 | Ga0068867_1001418192 | 120 |
| 189 | 3300005543 | Ga0070672_100091214 | Ga0070672_1000912143 | 120 |
| 190 | 3300005616 | Ga0068852_100567270 | Ga0068852_1005672702 | 120 |
| 191 | 3300005718 | Ga0068866_10011789 | Ga0068866_100117892 | 120 |
| 192 | 3300005719 | Ga0068861_100002558 | Ga0068861_1000025586 | 120 |
| 193 | 3300005843 | Ga0068860_100002228 | Ga0068860_1000022283 | 120 |
| 194 | 3300005844 | Ga0068862_100015591 | Ga0068862_1000155913 | 120 |
| 195 | 3300006042 | Ga0075368_10023015 | Ga0075368_100230153 | 120 |
| 196 | 3300006048 | Ga0075363_100047337 | Ga0075363_1000473372 | 120 |
| 197 | 3300006051 | Ga0075364_10007284 | Ga0075364_100072844 | 120 |
| 198 | 3300006051 | Ga0075364_10012748 | Ga0075364_100127484 | 120 |
| 199 | 3300006051 | Ga0075364_10017599 | Ga0075364_100175994 | 120 |
| 200 | 3300006177 | Ga0075362_10346401 | Ga0075362_103464012 | 120 |
| 201 | 3300006178 | Ga0075367_10000951 | Ga0075367_100009516 | 120 |
| 202 | 3300006195 | Ga0075366_10284661 | Ga0075366_102846612 | 120 |
| 203 | 3300006846 | Ga0075430_100466689 | Ga0075430_1004666891 | 120 |
| 204 | 3300006881 | Ga0068865_100008657 | Ga0068865_1000086572 | 120 |
| 205 | 3300006931 | Ga0097620_100353352 | Ga0097620_1003533522 | 120 |
| 206 | 3300007076 | Ga0075435_101487484 | Ga0075435_1014874842 | 120 |
| 207 | 3300009176 | Ga0105242_11571753 | Ga0105242_115717531 | 120 |
| 208 | 3300009553 | Ga0105249_10014093 | Ga0105249_100140938 | 120 |
| 209 | 3300013297 | Ga0157378_10096900 | Ga0157378_100969003 | 120 |
| 210 | 3300013306 | Ga0163162_10209672 | Ga0163162_102096722 | 120 |
| 211 | 3300014326 | Ga0157380_10503860 | Ga0157380_105038602 | 120 |
| 212 | 3300014326 | Ga0157380_10906158 | Ga0157380_109061582 | 120 |
| 213 | 3300014968 | Ga0157379_10090063 | Ga0157379_100900633 | 120 |
| 214 | 3300025263 | Ga0209565_1033477 | Ga0209565_10334771 | 120 |
| 215 | 3300025291 | Ga0209675_1023414 | Ga0209675_10234142 | 120 |
| 216 | 3300025298 | Ga0209050_1000376 | Ga0209050_100037632 | 120 |
| 217 | 3300025298 | Ga0209050_1023829 | Ga0209050_10238293 | 120 |
| 218 | 3300025299 | Ga0209256_1000092 | Ga0209256_1000092189 | 120 |
| 219 | 3300025299 | Ga0209256_1103613 | Ga0209256_11036132 | 120 |
| 220 | 3300025303 | Ga0209051_1000020 | Ga0209051_1000020155 | 120 |
| 221 | 3300025304 | Ga0209257_1000085 | Ga0209257_1000085155 | 120 |
| 222 | 3300025893 | Ga0207682_10425689 | Ga0207682_104256892 | 120 |
| 223 | 3300025907 | Ga0207645_10545794 | Ga0207645_105457942 | 120 |
| 224 | 3300025908 | Ga0207643_10202514 | Ga0207643_102025142 | 120 |
| 225 | 3300025923 | Ga0207681_10122088 | Ga0207681_101220883 | 120 |
| 226 | 3300025926 | Ga0207659_10484875 | Ga0207659_104848752 | 120 |
| 227 | 3300025933 | Ga0207706_10077613 | Ga0207706_100776132 | 120 |
| 228 | 3300025934 | Ga0207686_11328898 | Ga0207686_113288982 | 120 |
| 229 | 3300025937 | Ga0207669_10181358 | Ga0207669_101813582 | 120 |
| 230 | 3300025937 | Ga0207669_10204467 | Ga0207669_102044672 | 120 |
| 231 | 3300025937 | Ga0207669_10304869 | Ga0207669_103048692 | 120 |
| 232 | 3300025938 | Ga0207704_10004113 | Ga0207704_100041139 | 120 |
| 233 | 3300025940 | Ga0207691_10244625 | Ga0207691_102446252 | 120 |
| 234 | 3300025942 | Ga0207689_10593565 | Ga0207689_105935652 | 120 |
| 235 | 3300025961 | Ga0207712_10082827 | Ga0207712_100828272 | 120 |
| 236 | 3300025986 | Ga0207658_10207443 | Ga0207658_102074432 | 120 |
| 237 | 3300026089 | Ga0207648_10000432 | Ga0207648_1000043245 | 120 |
| 238 | 3300026116 | Ga0207674_10619788 | Ga0207674_106197882 | 120 |
| 239 | 3300026118 | Ga0207675_100002706 | Ga0207675_10000270619 | 120 |
| 240 | 3300026121 | Ga0207683_10033784 | Ga0207683_100337847 | 120 |
| 241 | 3300026142 | Ga0207698_10382984 | Ga0207698_103829842 | 120 |
| 242 | 3300028380 | Ga0268265_10027073 | Ga0268265_100270734 | 120 |
| 243 | 3300035691 | Ga0373931_0401521 | Ga0373931_0401521_332_727 | 120 |
| 244 | 3300037471 | Ga0395905_0005330 | Ga0395905_0005330_2466_2849 | 120 |
| 245 | 3300041404 | Ga0439436_0188246 | Ga0439436_0188246_133_543 | 120 |
| 246 | 3300041486 | Ga0451807_0988537 | Ga0451807_0988537_207_584 | 120 |
| 247 | 3300042008 | Ga0439450_062130 | Ga0439450_062130_90_509 | 120 |
| 248 | 3300042437 | Ga0439444_0117400 | Ga0439444_0117400_131_550 | 120 |
| 249 | 3300042439 | Ga0439464_0091045 | Ga0439464_0091045_326_745 | 120 |
| 250 | 3300042461 | Ga0439460_0010234 | Ga0439460_0010234_184_603 | 120 |
| 251 | 3300044683 | Ga0466965_0131813 | Ga0466965_0131813_184_558 | 120 |
| 252 | 3300044712 | Ga0453684_0082944 | Ga0453684_0082944_2545_2919 | 120 |
| 253 | 3300044712 | Ga0453684_0860458 | Ga0453684_0860458_398_787 | 120 |
| 254 | 3300046535 | Ga0495586_0081793 | Ga0495586_0081793_795_1193 | 120 |
| 255 | 3300046539 | Ga0495621_0001506 | Ga0495621_0001506_4071_4457 | 120 |
| 256 | 3300047318 | Ga0495636_0262696 | Ga0495636_0262696_354_722 | 120 |
| 257 | 3300048088 | Ga0495602_0787449 | Ga0495602_0787449_128_526 | 120 |
| 258 | 3300048925 | Ga0496122_0021978 | Ga0496122_0021978_2072_2455 | 120 |
| 259 | 3300048926 | Ga0496123_0012770 | Ga0496123_0012770_2536_2919 | 120 |
| 260 | 3300048926 | Ga0496123_0520419 | Ga0496123_0520419_27_503 | 120 |
| 261 | 3300048927 | Ga0496124_0113885 | Ga0496124_0113885_1702_2085 | 120 |
| 262 | 3300048928 | Ga0496125_0009307 | Ga0496125_0009307_4147_4530 | 120 |
| 263 | 3300048929 | Ga0496126_0033237 | Ga0496126_0033237_3015_3398 | 120 |
| 264 | 3300049742 | Ga0501080_0815334 | Ga0501080_0815334_376_750 | 120 |
| 265 | 3300050489 | nmdc:mga03683_100519_c1 | nmdc:mga03683_100519_c1_740_1147 | 120 |
| 266 | 3300050491 | nmdc:mga00v17_181984_c1 | nmdc:mga00v17_181984_c1_405_812 | 120 |
| 267 | 3300050491 | nmdc:mga00v17_4569_c1 | nmdc:mga00v17_4569_c1_3213_3587 | 120 |
| 268 | 3300050493 | nmdc:mga0k408_29506_c1 | nmdc:mga0k408_29506_c1_893_1300 | 120 |
| 269 | 3300050495 | nmdc:mga04h51_64412_c1 | nmdc:mga04h51_64412_c1_142_549 | 120 |
| 270 | 3300050496 | nmdc:mga07m45_4747_c1 | nmdc:mga07m45_4747_c1_3885_4292 | 120 |
| 271 | 3300050516 | nmdc:mga0sz30_19094_c1 | nmdc:mga0sz30_19094_c1_53_460 | 120 |
| 272 | 3300053136 | Ga0500559_0134936 | Ga0500559_0134936_597_977 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8d5c-assembly1.cif.gz_H | anti-hiv-1 gp120-scd4 complex antibody cg10 fab in complex with b41-scd4 | 0.7445 | 59 | 80 |
| 3gbn-assembly1.cif.gz_H | crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin | 0.7041 | 59 | 80 |
| 7ycy-assembly1.cif.gz_D | sars-cov-2 omicron 1-rbd up spike trimer complexed with three xg005 molecules | 0.6826 | 59 | 82 |
| 6gq8-assembly1.cif.gz_D | superoxide reductase from nanoarchaeum equitans | 0.6506 | 8 | 31 |
| 7c5z-assembly1.cif.gz_A | crystal structure of spring viremia of carp virus phosphoprotein central domain | 0.6168 | 13 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55CI7_27_128_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8762 | 43 | 77 | 3.30.70.330 |
| af_A0A0R0GDH2_2_170_3.30.70.2890 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;XS domain | 0.8353 | 45 | 77 | 3.30.70.2890 |
| af_D3ZRG8_1481_1608_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8219 | 43 | 77 | 3.30.70.330 |
| af_Q6K925_297_397_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8185 | 45 | 77 | 3.30.70.330 |
| af_A0A1D6KWK9_191_358_3.30.70.2890 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;XS domain | 0.8151 | 42 | 77 | 3.30.70.2890 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7A0F2-F1-model_v4 | Beta-lactamase | 0.9858 | 2 | 119 |
|
| AF-A0A351ZU22-F1-model_v4 | Uncharacterized protein | 0.9738 | 8 | 76 |
|
| AF-A0A0K8NZT1-F1-model_v4 | Small uncharacterized protein Bpro_4170 | 0.9699 | 1 | 120 |
|
| AF-A0A7Z0MET8-F1-model_v4 | Beta-lactamase | 0.967 | 1 | 110 |
|
| AF-A0A519EEN4-F1-model_v4 | Beta-lactamase | 0.9624 | 4 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar