F378437

General Info

Members Datasets Scaffolds Average Seq Length
272 185 272 349

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10024060|Ga0207428_100240602
Length 411
Sequence MHQRRPLAQTAMRGAPLVCQDCPESLIQALSTTWQGSQSHWPHARRGRAAGILSVMSEVATAARPGGLIAKTSRRVAVALTISVVVGLLMLTTWASSPASLFLRTIILGLAATTAFALFEVWPRSLPRWXXXXALQVVAVGVFMPVTTVLIYVLSTPRGAPPFWETPGRMDGWTHLTFAGLLLAPWTALAAIVRQKEAFARDQKLAFALERSELERQALDARLHRLQAQVAPHFLFNTLANVQALVDAGSPHASAVLRSLTAYLRAAVPVLHEPAATIERELQLVRPYLELMQMRMPDRLEYAINVDPAALTVRCPPTMVLTLVENAVRHGIDPSEEGGRIDIDVKRLGERCVVRVTDTGAGLRQSGSGPGTGLTTLRERLQLIFGDAARLRLTSGVPRGVAVEIDFPAQT

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 1.1
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100003553 3300005330 Bacteria 8550
2 Ga0070690_100011741 3300005330 Bacteria 5134
3 Ga0070670_100000080 3300005331 Bacteria 92128
4 Ga0070666_10000582 3300005335 Bacteria 22046
5 Ga0070666_10085724 3300005335 Bacteria 2157
6 Ga0070682_100022676 3300005337 Bacteria 3721
7 Ga0070682_100031065 3300005337 Bacteria 3229
8 Ga0068868_100000080 3300005338 Bacteria 57150
9 Ga0068868_100190493 3300005338 Bacteria 1705
10 Ga0070687_100003112 3300005343 Bacteria 6387
11 Ga0070668_100282195 3300005347 Bacteria 1387
12 Ga0070669_100000016 3300005353 Bacteria 196825
13 Ga0070669_100103873 3300005353 Bacteria 2148
14 Ga0070675_100000002 3300005354 Bacteria 435215
15 Ga0070671_100344362 3300005355 Bacteria 1272
16 Ga0070674_100228922 3300005356 Bacteria 1450
17 Ga0070673_100006917 3300005364 Bacteria 7420
18 Ga0070667_100006902 3300005367 Bacteria 9432
19 Ga0070667_100242359 3300005367 Bacteria 1610
20 Ga0070667_100327080 3300005367 Bacteria 1384
21 Ga0070709_10049810 3300005434 Bacteria 2621
22 Ga0070714_100045374 3300005435 Bacteria 3725
23 Ga0070700_100000126 3300005441 Bacteria 46616
24 Ga0070708_100018844 3300005445 Bacteria 5781
25 Ga0070708_100042243 3300005445 Bacteria 4001
26 Ga0070681_10036131 3300005458 Bacteria 4962
27 Ga0070681_10136610 3300005458 Bacteria 2382
28 Ga0070681_10206216 3300005458 Bacteria 1883
29 Ga0068867_100051392 3300005459 Bacteria 3040
30 Ga0070706_100022676 3300005467 Bacteria 5781
31 Ga0070706_100052460 3300005467 Bacteria 3764
32 Ga0070698_100000754 3300005471 Bacteria 34978
33 Ga0070698_100030083 3300005471 Bacteria 5634
34 Ga0070699_100059304 3300005518 Bacteria 3315
35 Ga0070679_100094847 3300005530 Bacteria 2971
36 Ga0070697_100059495 3300005536 Bacteria 3111
37 Ga0068853_100031611 3300005539 Bacteria 4478
38 Ga0068853_100061866 3300005539 Bacteria 3238
39 Ga0070693_100054853 3300005547 Unclassified 2294
40 Ga0070693_100091265 3300005547 Bacteria 1837
41 Ga0070665_100000211 3300005548 Bacteria 100358
42 Ga0070704_100031292 3300005549 Bacteria 3578
43 Ga0070704_100301188 3300005549 Bacteria 1336
44 Ga0068855_100005031 3300005563 Bacteria 16133
45 Ga0068855_100136202 3300005563 Bacteria 2802
46 Ga0070664_100033879 3300005564 Bacteria 4281
47 Ga0068857_100027455 3300005577 Bacteria 5021
48 Ga0068856_100085609 3300005614 Bacteria 3131
49 Ga0070702_100011465 3300005615 Bacteria 4410
50 Ga0068852_100073578 3300005616 Bacteria 3006
51 Ga0068852_100327280 3300005616 Bacteria 1490
52 Ga0068859_100000005 3300005617 Bacteria 430800
53 Ga0068864_100052819 3300005618 Bacteria 3504
54 Ga0068851_10045821 3300005834 Bacteria 2211
55 Ga0068860_100002733 3300005843 Bacteria 18350
56 Ga0068860_100272464 3300005843 Bacteria 1652
57 Ga0081539_10004646 3300005985 Bacteria 14947
58 Ga0070717_10145205 3300006028 Bacteria 2049
59 Ga0075367_10013173 3300006178 Bacteria 4436
60 Ga0097621_100002811 3300006237 Bacteria 11926
61 Ga0097621_100263671 3300006237 Bacteria 1512
62 Ga0068871_100020648 3300006358 Bacteria 5050
63 Ga0075430_100030320 3300006846 Bacteria 4592
64 Ga0075431_100062800 3300006847 Bacteria 3833
65 Ga0075431_100464702 3300006847 Bacteria 1260
66 Ga0075433_10125347 3300006852 Bacteria 2281
67 Ga0075429_100243264 3300006880 Bacteria 1576
68 Ga0068865_100002709 3300006881 Bacteria 10509
69 Ga0075436_100000027 3300006914 Bacteria 97947
70 Ga0075436_100020238 3300006914 Bacteria 4567
71 Ga0075436_100079308 3300006914 Bacteria 2274
72 Ga0097620_100000005 3300006931 Bacteria 430800
73 Ga0075435_100000003 3300007076 Bacteria 124953
74 Ga0075435_100001551 3300007076 Bacteria 14814
75 Ga0075435_100029699 3300007076 Bacteria 4292
76 Ga0075435_100045967 3300007076 Bacteria 3501
77 Ga0105244_10006409 3300009036 Bacteria 7626
78 Ga0105240_10002939 3300009093 Bacteria 26861
79 Ga0105240_10035928 3300009093 Bacteria 6380
80 Ga0105240_10237893 3300009093 Bacteria 2113
81 Ga0111539_10022430 3300009094 Bacteria 7758
82 Ga0111539_10050857 3300009094 Bacteria 4937
83 Ga0105245_10033155 3300009098 Bacteria 4576
84 Ga0114129_10003296 3300009147 Bacteria 22665
85 Ga0114129_10022652 3300009147 Bacteria 8909
86 Ga0114129_10058128 3300009147 Bacteria 5409
87 Ga0114129_10083709 3300009147 Bacteria 4430
88 Ga0114129_10227763 3300009147 Bacteria 2511
89 Ga0105241_10002515 3300009174 Bacteria 13761
90 Ga0105241_10098780 3300009174 Bacteria 2317
91 Ga0105241_10219374 3300009174 Bacteria 1597
92 Ga0105242_10000488 3300009176 Bacteria 31479
93 Ga0105242_10014396 3300009176 Bacteria 6128
94 Ga0105248_10067518 3300009177 Bacteria 4015
95 Ga0105248_10090457 3300009177 Bacteria 3446
96 Ga0105248_10276691 3300009177 Bacteria 1890
97 Ga0105237_10106952 3300009545 Bacteria 2789
98 Ga0105237_10253415 3300009545 Bacteria 1762
99 Ga0105238_10104192 3300009551 Bacteria 2818
100 Ga0105239_10011471 3300010375 Bacteria 9882
101 Ga0105239_10410727 3300010375 Bacteria 1533
102 Ga0105246_10030979 3300011119 Bacteria 3537
103 Ga0157370_10010587 3300013104 Bacteria 9710
104 Ga0157369_10000028 3300013105 Bacteria 213910
105 Ga0157369_10055736 3300013105 Bacteria 4267
106 Ga0157374_10080495 3300013296 Bacteria 3090
107 Ga0163162_10221866 3300013306 Bacteria 2020
108 Ga0157372_10025381 3300013307 Bacteria 6442
109 Ga0157372_10084476 3300013307 Bacteria 3598
110 Ga0157375_10000457 3300013308 Bacteria 37078
111 Ga0157375_10092721 3300013308 Bacteria 3085
112 Ga0163163_10000005 3300014325 Bacteria 369548
113 Ga0157376_10000013 3300014969 Bacteria 304287
114 Ga0157376_10001423 3300014969 Bacteria 15722
115 Ga0157376_10094401 3300014969 Bacteria 2599
116 Ga0207656_10035683 3300025321 Bacteria 2083
117 Ga0207680_10037174 3300025903 Bacteria 2809
118 Ga0207699_10034476 3300025906 Bacteria 2872
119 Ga0207645_10087177 3300025907 Bacteria 2006
120 Ga0207684_10035494 3300025910 Bacteria 4234
121 Ga0207684_10070445 3300025910 Bacteria 2972
122 Ga0207684_10084422 3300025910 Bacteria 2704
123 Ga0207707_10066200 3300025912 Bacteria 3146
124 Ga0207695_10005144 3300025913 Bacteria 17517
125 Ga0207695_10016204 3300025913 Bacteria 8735
126 Ga0207671_10002024 3300025914 Bacteria 22295
127 Ga0207671_10149403 3300025914 Bacteria 1805
128 Ga0207662_10012025 3300025918 Bacteria 4813
129 Ga0207662_10048680 3300025918 Bacteria 2512
130 Ga0207657_10005890 3300025919 Bacteria 12762
131 Ga0207652_10405703 3300025921 Bacteria 1230
132 Ga0207646_10217777 3300025922 Bacteria 1725
133 Ga0207681_10000025 3300025923 Bacteria 203205
134 Ga0207694_10000002 3300025924 Bacteria 1165763
135 Ga0207694_10000003 3300025924 Bacteria 1165533
136 Ga0207694_10073138 3300025924 Bacteria 2681
137 Ga0207650_10000026 3300025925 Bacteria 264152
138 Ga0207659_10000031 3300025926 Bacteria 121432
139 Ga0207659_10158640 3300025926 Bacteria 1774
140 Ga0207687_10104168 3300025927 Bacteria 2094
141 Ga0207690_10129120 3300025932 Bacteria 1847
142 Ga0207706_10025931 3300025933 Bacteria 5249
143 Ga0207686_10031005 3300025934 Bacteria 3171
144 Ga0207686_10049382 3300025934 Bacteria 2611
145 Ga0207670_10026515 3300025936 Bacteria 3652
146 Ga0207704_10092032 3300025938 Bacteria 1994
147 Ga0207665_10131162 3300025939 Bacteria 1779
148 Ga0207691_10010428 3300025940 Bacteria 8916
149 Ga0207711_10029740 3300025941 Bacteria 4608
150 Ga0207711_10045769 3300025941 Bacteria 3739
151 Ga0207667_10002976 3300025949 Bacteria 21053
152 Ga0207667_10159414 3300025949 Bacteria 2321
153 Ga0207651_10038687 3300025960 Bacteria 3137
154 Ga0207640_10005797 3300025981 Bacteria 6735
155 Ga0207658_10008022 3300025986 Bacteria 7194
156 Ga0207658_10204457 3300025986 Bacteria 1651
157 Ga0207677_10002854 3300026023 Bacteria 9117
158 Ga0207677_10165310 3300026023 Bacteria 1724
159 Ga0207703_10031026 3300026035 Bacteria 4225
160 Ga0207703_10109069 3300026035 Bacteria 2358
161 Ga0207639_10009138 3300026041 Bacteria 6831
162 Ga0207639_10315273 3300026041 Bacteria 1387
163 Ga0207708_10000059 3300026075 Bacteria 94590
164 Ga0207641_10115388 3300026088 Bacteria 2388
165 Ga0207648_10026724 3300026089 Bacteria 5126
166 Ga0207676_10032264 3300026095 Bacteria 3945
167 Ga0207676_10037707 3300026095 Bacteria 3685
168 Ga0207674_10005765 3300026116 Bacteria 14690
169 Ga0207674_10049484 3300026116 Bacteria 4298
170 Ga0207674_10138480 3300026116 Bacteria 2394
171 Ga0207698_10083553 3300026142 Bacteria 2585
172 Ga0207698_10274428 3300026142 Bacteria 1556
173 Ga0207428_10009314 3300027907 Bacteria 8809
174 Ga0207428_10024060 3300027907 Bacteria 5114
175 Ga0268266_10000001 3300028379 Bacteria 4040580
176 Ga0268266_10180057 3300028379 Bacteria 1924
177 Ga0268264_10010814 3300028381 Bacteria 7539
178 Ga0268264_10153966 3300028381 Bacteria 2064
179 Ga0307515_10001570 3300028794 Bacteria 51012
180 Ga0307408_100005984 3300031548 Bacteria 8097
181 Ga0307408_100020601 3300031548 Bacteria 4453
182 Ga0307408_100357285 3300031548 Bacteria 1241
183 Ga0307516_10000128 3300031730 Bacteria 90057
184 Ga0307405_10121138 3300031731 Bacteria 1790
185 Ga0307413_10007578 3300031824 Bacteria 5053
186 Ga0307413_10114535 3300031824 Bacteria 1812
187 Ga0307410_10010606 3300031852 Bacteria 5229
188 Ga0307410_10143323 3300031852 Bacteria 1770
189 Ga0307410_10262246 3300031852 Bacteria 1348
190 Ga0307406_10103273 3300031901 Bacteria 1946
191 Ga0307407_10026251 3300031903 Bacteria 3081
192 Ga0307412_10039429 3300031911 Bacteria 3049
193 Ga0307412_10110434 3300031911 Bacteria 1962
194 Ga0307416_100102119 3300032002 Bacteria 2499
195 Ga0307416_100189287 3300032002 Bacteria 1938
196 Ga0307414_10275103 3300032004 Bacteria 1412
197 Ga0307411_10014485 3300032005 Bacteria 4390
198 Ga0307415_100031492 3300032126 Bacteria 3417
199 Ga0307415_100078592 3300032126 Bacteria 2347
200 Ga0373929_0000622 3300035085 Bacteria 6828
201 Ga0373949_0001602 3300035090 Bacteria 6372
202 Ga0373951_0000196 3300035091 Bacteria 21838
203 Ga0373952_0001741 3300035092 Bacteria 3952
204 Ga0373932_0001125 3300035112 Bacteria 7718
205 Ga0373939_0000285 3300035114 Bacteria 13406
206 Ga0373941_0000900 3300035115 Bacteria 6131
207 Ga0373960_0001071 3300035121 Bacteria 5903
208 Ga0373955_0096230 3300035172 Bacteria 1694
209 Ga0373961_0000213 3300035241 Bacteria 27352
210 Ga0373931_0001549 3300035691 Bacteria 9915
211 Ga0373937_0291190 3300036401 Bacteria 1543
212 Ga0395900_0001662 3300037418 Bacteria 26033
213 Ga0436362_0098289 3300039453 Bacteria 11599
214 Ga0439435_0012599 3300042436 Bacteria 2052
215 Ga0439464_0011898 3300042439 Bacteria 2311
216 Ga0451576_0003158 3300045051 Bacteria 23052
217 Ga0451576_0040562 3300045051 Bacteria 4926
218 Ga0495582_0035826 3300046473 Bacteria 2729
219 Ga0495665_0095583 3300046531 Bacteria 1560
220 Ga0495586_0094747 3300046535 Bacteria 1652
221 Ga0495599_0019021 3300046678 Bacteria 4283
222 Ga0495647_0004204 3300046681 Bacteria 4663
223 Ga0495647_0019467 3300046681 Bacteria 2427
224 Ga0495581_0135736 3300047315 Bacteria 1434
225 Ga0495684_0008626 3300047471 Bacteria 7888
226 Ga0495602_0065379 3300048088 Bacteria 3139
227 Ga0496102_0257969 3300048905 Bacteria 1644
228 Ga0496104_0000045 3300048907 Bacteria 152445
229 Ga0496105_0000024 3300048908 Bacteria 153740
230 Ga0496118_0003817 3300048921 Bacteria 18562
231 Ga0501032_0017572 3300049569 Bacteria 5020
232 Ga0501034_0138885 3300049571 Bacteria 2410
233 Ga0501038_0050887 3300049574 Bacteria 3578
234 Ga0501039_0156776 3300049575 Bacteria 1789
235 Ga0501040_0153167 3300049576 Bacteria 1627
236 Ga0501046_0029181 3300049580 Bacteria 4486
237 Ga0501047_0023222 3300049581 Bacteria 5954
238 Ga0501070_0143986 3300049586 Bacteria 1968
239 Ga0501071_0034723 3300049587 Bacteria 3591
240 Ga0501073_0138882 3300049589 Bacteria 1684
241 Ga0501075_0080510 3300049591 Bacteria 2465
242 Ga0501079_0228328 3300049741 Bacteria 1454
243 Ga0501080_0044206 3300049742 Bacteria 4147
244 Ga0501081_0221784 3300049743 Bacteria 1375
245 Ga0501035_0008862 3300049822 Bacteria 9361
246 Ga0501045_0091165 3300049824 Bacteria 2253
247 nmdc:mga04h51_15751_c1 3300050495 Bacteria 2183
248 nmdc:mga07m45_87914_c1 3300050496 Bacteria 1778
249 nmdc:mga05p37_257084_c1 3300050507 Bacteria 2092
250 nmdc:mga05p37_423906_c1 3300050507 Bacteria 1548
251 nmdc:mga05p37_65344_c1 3300050507 Bacteria 4476
252 nmdc:mga05p37_822_c1 3300050507 Bacteria 34799
253 nmdc:mga09592_16392_c1 3300050508 Bacteria 6061
254 nmdc:mga09592_91111_c1 3300050508 Bacteria 2605
255 nmdc:mga0qj67_53414_c1 3300050509 Bacteria 3199
256 nmdc:mga06r32_3109_c1 3300050510 Bacteria 14863
257 nmdc:mga06r32_330131_c1 3300050510 Bacteria 1510
258 nmdc:mga08y16_113106_c1 3300050511 Bacteria 2826
259 nmdc:mga08y16_5268_c1 3300050511 Bacteria 13513
260 nmdc:mga08y16_8824_c1 3300050511 Bacteria 10581
261 nmdc:mga0n895_40_c1 3300050512 Bacteria 75471
262 nmdc:mga0rr50_106534_c1 3300050513 Bacteria 2212
263 nmdc:mga0rr50_73705_c1 3300050513 Bacteria 2611
264 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
265 nmdc:mga08x19_12662_c1 3300050514 Bacteria 5085
266 nmdc:mga08x19_60_c1 3300050514 Bacteria 116399
267 nmdc:mga0a205_148291_c1 3300050515 Bacteria 2246
268 Ga0500610_0000078 3300053079 Bacteria 29228
269 Ga0590071_006453 3300059421 Bacteria 2791
270 Ga0590075_000221 3300059424 Bacteria 15886
271 Ga0590075_002553 3300059424 Bacteria 4354
272 Ga0590077_001442 3300059426 Bacteria 5572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10037174 Ga0207680_100371741 298
2 3300025949 Ga0207667_10159414 Ga0207667_101594142 305
3 3300026116 Ga0207674_10138480 Ga0207674_101384802 305
4 3300005539 Ga0068853_100031611 Ga0068853_1000316114 311
5 3300005577 Ga0068857_100027455 Ga0068857_1000274552 311
6 3300005616 Ga0068852_100327280 Ga0068852_1003272802 311
7 3300010375 Ga0105239_10011471 Ga0105239_100114716 311
8 3300026041 Ga0207639_10009138 Ga0207639_100091383 311
9 3300026116 Ga0207674_10049484 Ga0207674_100494842 311
10 3300049569 Ga0501032_0017572 Ga0501032_0017572_2331_3407 319
11 3300049574 Ga0501038_0050887 Ga0501038_0050887_128_1204 319
12 3300049580 Ga0501046_0029181 Ga0501046_0029181_3320_4396 319
13 3300049586 Ga0501070_0143986 Ga0501070_0143986_482_1558 319
14 3300049822 Ga0501035_0008862 Ga0501035_0008862_3091_4167 319
15 3300005458 Ga0070681_10136610 Ga0070681_101366102 324
16 3300005843 Ga0068860_100002733 Ga0068860_1000027334 324
17 3300013104 Ga0157370_10010587 Ga0157370_1001058710 324
18 3300025912 Ga0207707_10066200 Ga0207707_100662002 324
19 3300028381 Ga0268264_10010814 Ga0268264_100108149 324
20 3300050507 nmdc:mga05p37_257084_c1 nmdc:mga05p37_257084_c1_233_1294 324
21 3300005354 Ga0070675_100000002 Ga0070675_1000000028 329
22 3300009036 Ga0105244_10006409 Ga0105244_100064092 329
23 3300025926 Ga0207659_10000031 Ga0207659_10000031110 329
24 3300042436 Ga0439435_0012599 Ga0439435_0012599_10_1128 329
25 3300005985 Ga0081539_10004646 Ga0081539_1000464617 330
26 3300006847 Ga0075431_100062800 Ga0075431_1000628003 330
27 3300009147 Ga0114129_10227763 Ga0114129_102277633 330
28 3300025960 Ga0207651_10038687 Ga0207651_100386874 330
29 3300048905 Ga0496102_0257969 Ga0496102_0257969_284_1276 330
30 3300053079 Ga0500610_0000078 Ga0500610_0000078_7140_8225 330
31 3300005367 Ga0070667_100242359 Ga0070667_1002423592 331
32 3300005843 Ga0068860_100272464 Ga0068860_1002724642 331
33 3300009147 Ga0114129_10022652 Ga0114129_1002265210 331
34 3300025926 Ga0207659_10158640 Ga0207659_101586403 331
35 3300005467 Ga0070706_100052460 Ga0070706_1000524604 332
36 3300025910 Ga0207684_10070445 Ga0207684_100704453 332
37 3300005471 Ga0070698_100030083 Ga0070698_1000300833 334
38 3300007076 Ga0075435_100001551 Ga0075435_1000015518 334
39 3300013306 Ga0163162_10221866 Ga0163162_102218663 334
40 3300014969 Ga0157376_10000013 Ga0157376_10000013107 334
41 3300025918 Ga0207662_10048680 Ga0207662_100486802 334
42 3300025932 Ga0207690_10129120 Ga0207690_101291203 334
43 3300025940 Ga0207691_10010428 Ga0207691_100104286 334
44 3300025941 Ga0207711_10045769 Ga0207711_100457692 334
45 3300031548 Ga0307408_100357285 Ga0307408_1003572852 334
46 3300031731 Ga0307405_10121138 Ga0307405_101211382 334
47 3300031824 Ga0307413_10114535 Ga0307413_101145351 334
48 3300031852 Ga0307410_10143323 Ga0307410_101433231 334
49 3300031911 Ga0307412_10110434 Ga0307412_101104341 334
50 3300032002 Ga0307416_100189287 Ga0307416_1001892872 334
51 3300032004 Ga0307414_10275103 Ga0307414_102751032 334
52 3300032126 Ga0307415_100078592 Ga0307415_1000785922 334
53 3300050513 nmdc:mga0rr50_73705_c1 nmdc:mga0rr50_73705_c1_876_1880 334
54 3300005343 Ga0070687_100003112 Ga0070687_1000031125 335
55 3300005353 Ga0070669_100000016 Ga0070669_100000016119 335
56 3300025918 Ga0207662_10012025 Ga0207662_100120255 335
57 3300025923 Ga0207681_10000025 Ga0207681_1000002557 335
58 3300026088 Ga0207641_10115388 Ga0207641_101153882 335
59 3300028379 Ga0268266_10180057 Ga0268266_101800572 335
60 3300005617 Ga0068859_100000005 Ga0068859_10000000599 336
61 3300006931 Ga0097620_100000005 Ga0097620_10000000599 336
62 3300031548 Ga0307408_100020601 Ga0307408_1000206012 336
63 3300031824 Ga0307413_10007578 Ga0307413_100075789 336
64 3300031852 Ga0307410_10010606 Ga0307410_100106062 336
65 3300031903 Ga0307407_10026251 Ga0307407_100262512 336
66 3300032126 Ga0307415_100031492 Ga0307415_1000314925 336
67 3300059421 Ga0590071_006453 Ga0590071_006453_836_1906 336
68 3300059424 Ga0590075_000221 Ga0590075_000221_1668_2738 336
69 3300059424 Ga0590075_002553 Ga0590075_002553_3061_4131 336
70 3300059426 Ga0590077_001442 Ga0590077_001442_2885_3955 336
71 3300049824 Ga0501045_0091165 Ga0501045_0091165_295_1353 337
72 3300048921 Ga0496118_0003817 Ga0496118_0003817_4160_5272 339
73 3300049743 Ga0501081_0221784 Ga0501081_0221784_232_1320 339
74 3300009174 Ga0105241_10098780 Ga0105241_100987801 340
75 3300031852 Ga0307410_10262246 Ga0307410_102622461 340
76 3300032002 Ga0307416_100102119 Ga0307416_1001021191 340
77 3300049571 Ga0501034_0138885 Ga0501034_0138885_1177_2253 340
78 3300049581 Ga0501047_0023222 Ga0501047_0023222_411_1487 340
79 3300049589 Ga0501073_0138882 Ga0501073_0138882_324_1400 340
80 3300049742 Ga0501080_0044206 Ga0501080_0044206_476_1552 340
81 3300005618 Ga0068864_100052819 Ga0068864_1000528193 341
82 3300009551 Ga0105238_10104192 Ga0105238_101041923 341
83 3300013296 Ga0157374_10080495 Ga0157374_100804951 341
84 3300013308 Ga0157375_10092721 Ga0157375_100927212 341
85 3300026095 Ga0207676_10032264 Ga0207676_100322642 341
86 3300026095 Ga0207676_10037707 Ga0207676_100377072 341
87 3300049575 Ga0501039_0156776 Ga0501039_0156776_109_1167 341
88 3300049576 Ga0501040_0153167 Ga0501040_0153167_387_1445 341
89 3300049741 Ga0501079_0228328 Ga0501079_0228328_88_1146 341
90 3300005615 Ga0070702_100011465 Ga0070702_1000114654 342
91 3300005834 Ga0068851_10045821 Ga0068851_100458212 342
92 3300009093 Ga0105240_10237893 Ga0105240_102378931 342
93 3300005338 Ga0068868_100000080 Ga0068868_10000008046 343
94 3300026023 Ga0207677_10002854 Ga0207677_100028545 343
95 3300026041 Ga0207639_10315273 Ga0207639_103152732 343
96 3300005549 Ga0070704_100301188 Ga0070704_1003011881 344
97 3300006237 Ga0097621_100263671 Ga0097621_1002636712 344
98 3300006914 Ga0075436_100020238 Ga0075436_1000202385 344
99 3300005435 Ga0070714_100045374 Ga0070714_1000453741 345
100 3300006028 Ga0070717_10145205 Ga0070717_101452052 345
101 3300006852 Ga0075433_10125347 Ga0075433_101253472 345
102 3300007076 Ga0075435_100045967 Ga0075435_1000459673 345
103 3300031548 Ga0307408_100005984 Ga0307408_1000059846 345
104 3300039453 Ga0436362_0098289 Ga0436362_0098289_7633_8670 345
105 3300050515 nmdc:mga0a205_148291_c1 nmdc:mga0a205_148291_c1_1032_2102 345
106 3300005434 Ga0070709_10049810 Ga0070709_100498102 347
107 3300006846 Ga0075430_100030320 Ga0075430_1000303204 347
108 3300006847 Ga0075431_100464702 Ga0075431_1004647022 347
109 3300009094 Ga0111539_10022430 Ga0111539_100224308 347
110 3300009147 Ga0114129_10003296 Ga0114129_1000329616 347
111 3300009174 Ga0105241_10002515 Ga0105241_1000251510 347
112 3300013105 Ga0157369_10000028 Ga0157369_10000028144 347
113 3300025906 Ga0207699_10034476 Ga0207699_100344763 347
114 3300025913 Ga0207695_10005144 Ga0207695_1000514410 347
115 3300025914 Ga0207671_10002024 Ga0207671_1000202410 347
116 3300025924 Ga0207694_10073138 Ga0207694_100731383 347
117 3300027907 Ga0207428_10009314 Ga0207428_100093144 347
118 3300042439 Ga0439464_0011898 Ga0439464_0011898_758_1822 347
119 3300046531 Ga0495665_0095583 Ga0495665_0095583_331_1413 347
120 3300046681 Ga0495647_0019467 Ga0495647_0019467_954_2036 347
121 3300047471 Ga0495684_0008626 Ga0495684_0008626_1840_2922 347
122 3300050507 nmdc:mga05p37_822_c1 nmdc:mga05p37_822_c1_7020_8084 347
123 3300050508 nmdc:mga09592_16392_c1 nmdc:mga09592_16392_c1_553_1617 347
124 3300050509 nmdc:mga0qj67_53414_c1 nmdc:mga0qj67_53414_c1_1817_2881 347
125 3300050511 nmdc:mga08y16_5268_c1 nmdc:mga08y16_5268_c1_10765_11829 347
126 3300031901 Ga0307406_10103273 Ga0307406_101032732 348
127 3300031911 Ga0307412_10039429 Ga0307412_100394292 348
128 3300032005 Ga0307411_10014485 Ga0307411_100144852 348
129 3300005347 Ga0070668_100282195 Ga0070668_1002821952 349
130 3300005353 Ga0070669_100103873 Ga0070669_1001038732 349
131 3300005367 Ga0070667_100327080 Ga0070667_1003270801 349
132 3300005445 Ga0070708_100018844 Ga0070708_1000188441 349
133 3300005458 Ga0070681_10036131 Ga0070681_100361311 349
134 3300009098 Ga0105245_10033155 Ga0105245_100331553 349
135 3300009545 Ga0105237_10253415 Ga0105237_102534152 349
136 3300013105 Ga0157369_10055736 Ga0157369_100557364 349
137 3300013307 Ga0157372_10025381 Ga0157372_100253816 349
138 3300025927 Ga0207687_10104168 Ga0207687_101041682 349
139 3300025939 Ga0207665_10131162 Ga0207665_101311622 349
140 3300025986 Ga0207658_10204457 Ga0207658_102044572 349
141 3300026035 Ga0207703_10031026 Ga0207703_100310265 349
142 3300005330 Ga0070690_100011741 Ga0070690_1000117414 350
143 3300005335 Ga0070666_10000582 Ga0070666_100005824 350
144 3300005563 Ga0068855_100005031 Ga0068855_10000503114 350
145 3300006914 Ga0075436_100079308 Ga0075436_1000793082 350
146 3300009093 Ga0105240_10002939 Ga0105240_1000293919 350
147 3300009174 Ga0105241_10219374 Ga0105241_102193742 350
148 3300025913 Ga0207695_10016204 Ga0207695_100162045 350
149 3300025949 Ga0207667_10002976 Ga0207667_1000297614 350
150 3300050514 nmdc:mga08x19_12662_c1 nmdc:mga08x19_12662_c1_1745_2815 350
151 3300006914 Ga0075436_100000027 Ga0075436_10000002715 352
152 3300007076 Ga0075435_100000003 Ga0075435_10000000377 352
153 3300035085 Ga0373929_0000622 Ga0373929_0000622_5034_6092 352
154 3300035090 Ga0373949_0001602 Ga0373949_0001602_737_1795 352
155 3300035091 Ga0373951_0000196 Ga0373951_0000196_15471_16529 352
156 3300035092 Ga0373952_0001741 Ga0373952_0001741_2481_3539 352
157 3300035112 Ga0373932_0001125 Ga0373932_0001125_5785_6843 352
158 3300035114 Ga0373939_0000285 Ga0373939_0000285_9297_10355 352
159 3300035115 Ga0373941_0000900 Ga0373941_0000900_972_2030 352
160 3300035121 Ga0373960_0001071 Ga0373960_0001071_4824_5882 352
161 3300035241 Ga0373961_0000213 Ga0373961_0000213_20579_21637 352
162 3300035691 Ga0373931_0001549 Ga0373931_0001549_7622_8680 352
163 3300037418 Ga0395900_0001662 Ga0395900_0001662_16095_17165 352
164 3300045051 Ga0451576_0003158 Ga0451576_0003158_20737_21795 352
165 3300049587 Ga0501071_0034723 Ga0501071_0034723_1191_2261 352
166 3300049591 Ga0501075_0080510 Ga0501075_0080510_227_1297 352
167 3300050512 nmdc:mga0n895_40_c1 nmdc:mga0n895_40_c1_47150_48208 352
168 3300050513 nmdc:mga0rr50_7_c1 nmdc:mga0rr50_7_c1_104166_105224 352
169 3300050514 nmdc:mga08x19_60_c1 nmdc:mga08x19_60_c1_88590_89648 352
170 3300005563 Ga0068855_100136202 Ga0068855_1001362022 353
171 3300050510 nmdc:mga06r32_330131_c1 nmdc:mga06r32_330131_c1_67_1131 353
172 3300028794 Ga0307515_10001570 Ga0307515_1000157024 354
173 3300031730 Ga0307516_10000128 Ga0307516_1000012843 354
174 3300046473 Ga0495582_0035826 Ga0495582_0035826_104_1186 354
175 3300047315 Ga0495581_0135736 Ga0495581_0135736_135_1217 354
176 3300050508 nmdc:mga09592_91111_c1 nmdc:mga09592_91111_c1_1402_2478 354
177 3300050510 nmdc:mga06r32_3109_c1 nmdc:mga06r32_3109_c1_4137_5213 354
178 3300050511 nmdc:mga08y16_113106_c1 nmdc:mga08y16_113106_c1_1377_2453 354
179 3300009177 Ga0105248_10067518 Ga0105248_100675185 355
180 3300014325 Ga0163163_10000005 Ga0163163_10000005269 355
181 3300025941 Ga0207711_10029740 Ga0207711_100297402 355
182 3300026035 Ga0207703_10109069 Ga0207703_101090692 355
183 3300045051 Ga0451576_0040562 Ga0451576_0040562_2379_3446 355
184 3300005330 Ga0070690_100003553 Ga0070690_1000035532 356
185 3300005331 Ga0070670_100000080 Ga0070670_10000008011 356
186 3300005335 Ga0070666_10085724 Ga0070666_100857242 356
187 3300005337 Ga0070682_100022676 Ga0070682_1000226762 356
188 3300005337 Ga0070682_100031065 Ga0070682_1000310653 356
189 3300005338 Ga0068868_100190493 Ga0068868_1001904933 356
190 3300005355 Ga0070671_100344362 Ga0070671_1003443621 356
191 3300005356 Ga0070674_100228922 Ga0070674_1002289222 356
192 3300005364 Ga0070673_100006917 Ga0070673_1000069176 356
193 3300005367 Ga0070667_100006902 Ga0070667_1000069027 356
194 3300005441 Ga0070700_100000126 Ga0070700_10000012615 356
195 3300005445 Ga0070708_100042243 Ga0070708_1000422433 356
196 3300005458 Ga0070681_10206216 Ga0070681_102062162 356
197 3300005459 Ga0068867_100051392 Ga0068867_1000513922 356
198 3300005467 Ga0070706_100022676 Ga0070706_1000226762 356
199 3300005471 Ga0070698_100000754 Ga0070698_10000075435 356
200 3300005518 Ga0070699_100059304 Ga0070699_1000593042 356
201 3300005530 Ga0070679_100094847 Ga0070679_1000948474 356
202 3300005536 Ga0070697_100059495 Ga0070697_1000594954 356
203 3300005539 Ga0068853_100061866 Ga0068853_1000618663 356
204 3300005547 Ga0070693_100054853 Ga0070693_1000548533 356
205 3300005547 Ga0070693_100091265 Ga0070693_1000912652 356
206 3300005548 Ga0070665_100000211 Ga0070665_10000021135 356
207 3300005549 Ga0070704_100031292 Ga0070704_1000312922 356
208 3300005564 Ga0070664_100033879 Ga0070664_1000338792 356
209 3300005614 Ga0068856_100085609 Ga0068856_1000856094 356
210 3300005616 Ga0068852_100073578 Ga0068852_1000735784 356
211 3300006178 Ga0075367_10013173 Ga0075367_100131733 356
212 3300006237 Ga0097621_100002811 Ga0097621_1000028118 356
213 3300006358 Ga0068871_100020648 Ga0068871_1000206487 356
214 3300006880 Ga0075429_100243264 Ga0075429_1002432641 356
215 3300006881 Ga0068865_100002709 Ga0068865_1000027095 356
216 3300007076 Ga0075435_100029699 Ga0075435_1000296992 356
217 3300009093 Ga0105240_10035928 Ga0105240_100359286 356
218 3300009094 Ga0111539_10050857 Ga0111539_100508573 356
219 3300009147 Ga0114129_10058128 Ga0114129_100581285 356
220 3300009147 Ga0114129_10083709 Ga0114129_100837093 356
221 3300009176 Ga0105242_10000488 Ga0105242_1000048824 356
222 3300009176 Ga0105242_10014396 Ga0105242_100143964 356
223 3300009177 Ga0105248_10090457 Ga0105248_100904573 356
224 3300009177 Ga0105248_10276691 Ga0105248_102766912 356
225 3300009545 Ga0105237_10106952 Ga0105237_101069523 356
226 3300010375 Ga0105239_10410727 Ga0105239_104107272 356
227 3300011119 Ga0105246_10030979 Ga0105246_100309793 356
228 3300013307 Ga0157372_10084476 Ga0157372_100844762 356
229 3300013308 Ga0157375_10000457 Ga0157375_1000045723 356
230 3300014969 Ga0157376_10001423 Ga0157376_100014235 356
231 3300014969 Ga0157376_10094401 Ga0157376_100944012 356
232 3300025321 Ga0207656_10035683 Ga0207656_100356832 356
233 3300025907 Ga0207645_10087177 Ga0207645_100871773 356
234 3300025910 Ga0207684_10035494 Ga0207684_100354947 356
235 3300025910 Ga0207684_10084422 Ga0207684_100844225 356
236 3300025914 Ga0207671_10149403 Ga0207671_101494032 356
237 3300025919 Ga0207657_10005890 Ga0207657_1000589012 356
238 3300025921 Ga0207652_10405703 Ga0207652_104057031 356
239 3300025922 Ga0207646_10217777 Ga0207646_102177772 356
240 3300025924 Ga0207694_10000002 Ga0207694_10000002127 356
241 3300025924 Ga0207694_10000003 Ga0207694_10000003973 356
242 3300025925 Ga0207650_10000026 Ga0207650_10000026167 356
243 3300025933 Ga0207706_10025931 Ga0207706_100259316 356
244 3300025934 Ga0207686_10031005 Ga0207686_100310052 356
245 3300025934 Ga0207686_10049382 Ga0207686_100493822 356
246 3300025936 Ga0207670_10026515 Ga0207670_100265152 356
247 3300025938 Ga0207704_10092032 Ga0207704_100920322 356
248 3300025981 Ga0207640_10005797 Ga0207640_100057972 356
249 3300025986 Ga0207658_10008022 Ga0207658_100080227 356
250 3300026023 Ga0207677_10165310 Ga0207677_101653102 356
251 3300026075 Ga0207708_10000059 Ga0207708_1000005956 356
252 3300026089 Ga0207648_10026724 Ga0207648_100267243 356
253 3300026116 Ga0207674_10005765 Ga0207674_100057652 356
254 3300026142 Ga0207698_10083553 Ga0207698_100835532 356
255 3300026142 Ga0207698_10274428 Ga0207698_102744281 356
256 3300027907 Ga0207428_10024060 Ga0207428_100240602 356
257 3300028379 Ga0268266_10000001 Ga0268266_100000012067 356
258 3300028381 Ga0268264_10153966 Ga0268264_101539662 356
259 3300035172 Ga0373955_0096230 Ga0373955_0096230_52_1242 356
260 3300036401 Ga0373937_0291190 Ga0373937_0291190_347_1417 356
261 3300046535 Ga0495586_0094747 Ga0495586_0094747_253_1443 356
262 3300046678 Ga0495599_0019021 Ga0495599_0019021_1315_2385 356
263 3300046681 Ga0495647_0004204 Ga0495647_0004204_202_1392 356
264 3300048088 Ga0495602_0065379 Ga0495602_0065379_879_1949 356
265 3300048907 Ga0496104_0000045 Ga0496104_0000045_61834_62916 356
266 3300048908 Ga0496105_0000024 Ga0496105_0000024_137375_138457 356
267 3300050495 nmdc:mga04h51_15751_c1 nmdc:mga04h51_15751_c1_597_1667 356
268 3300050496 nmdc:mga07m45_87914_c1 nmdc:mga07m45_87914_c1_685_1755 356
269 3300050507 nmdc:mga05p37_423906_c1 nmdc:mga05p37_423906_c1_240_1322 356
270 3300050507 nmdc:mga05p37_65344_c1 nmdc:mga05p37_65344_c1_1856_2926 356
271 3300050511 nmdc:mga08y16_8824_c1 nmdc:mga08y16_8824_c1_6629_7699 356
272 3300050513 nmdc:mga0rr50_106534_c1 nmdc:mga0rr50_106534_c1_426_1496 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

221

300

0.91

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

317

411

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h70-assembly1.cif.gz_A crystal structure of the catalytic atp-binding domain of the phor sensor histidine kinase from vibrio cholera 0.768 220 354
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7591 220 354
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.7526 220 354
4bxi-assembly1.cif.gz_A-2 crystal structure of atp binding domain of agrc from staphylococcus aureus 0.7524 223 355
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.7486 218 354
ID Description Score Start End Superfamily
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.9054 221 353 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8865 221 353 3.30.565.10
af_Q53705_433_584_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8709 221 355 3.30.565.10
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8465 198 356 3.30.565.10
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8211 221 355 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6J4L5E0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8948 246 356 GO:0000155
AF-A0A7Y3TLD6-F1-model_v4 Histidine kinase 0.8937 155 355 GO:0000155
GO:0016020
AF-A0A7Y3TLD6-F1-model_v4 Histidine kinase 0.8815 155 355 GO:0000155
GO:0016020
AF-J9BZK4-F1-model_v4 Integral membrane sensor signal transduction histidine kinase 0.8789 220 354 GO:0016301
AF-A0A353BL97-F1-model_v4 deleted 0.8725 158 354

Feature Viewer

pLDDT pTM Quality
76.89 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map