F378450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 272 | 189 | 544 | 847 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10000001|Ga0307511_10000001158 |
| Length | 923 |
| Sequence | MAKLKGDLWKSDWFFGLVVSLLFFICAYVVGATGDLLDSLDRKAYDMGVRASSKQPNDRIAIIAIDDASISNIGRWPWSREVHAKMTDLLTGAKAKVIGNTVFFFEPQQDPGLVYINKMLEVYAKAAPEMAQIGALLKEAEANLNTDRRLAESYAKAGNVILPLSLTPGVPRGKPDNPLPDYALKNAFTDKGGENDIISQAVQLPIAPLGRVAAGLGHLNDTQDSDGAIRTEPLVIQYYDQYFPSFSLIVAAKSLNLSVSDIKVKWGEQLKLSKLAITTDPSNRMYTYFYKDRDGKSAFQIDSFYDVLSGKIPASKYADKIVLIGATATGVGTSFATPVAPAMTPVERMAHTVSSILSEHFFVSPSWAVWVKLLVFVAVAAYLIAVLPRLKARPAAIITLVVLVVXLATHFGLMVSAGMWIPLMVPATLLLIGHLLLTTKRYIVTEAGKQKSDVESAESNRMLGLAFQGQGQLDMAFDKFRKVPFDGQLMDNLYNLALDFERKRQFNKAQSVYEHMHTYDPKFKDLGSKITRAKNLSETVILGGGSSRGNASILDTAGAGEKPMLGRYQVEKELGKGAMGVVYQGRDPKIARVVAIKTMALSQEFEADELEEAKARFFREAETAGRLNHPHIVTIYDAGEEHDLCFIAMELLKGKDLVPYTKPETLLPISRVVSITVRVADALGYAHRQNVVHRDIKPANIMYDLDSDNPKVTDFGIARVTDSSKTKTGMVLGTPSYMSPEQLSGKKVDGRSDLFSLAVSLYQMLSGQLPFVGDSMAQLMFKIANETAPDIRTLNPAVPEGLAEVLAYAMAKEAEQRYQTGEELAAALRPFGETPATATGMNIPAVTSGGVRMPTQQVPAQGTRPVANPHAGGTVQLNAPVVPEGDKTVILSAPPAATGAGDTQPIPAQPSGGKPAPDVDISL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 79 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 85 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 86 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 90 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 103 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 106 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 107 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 172 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 173 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 174 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 177 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 178 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 179 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 180 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 181 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 182 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 183 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 184 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 185 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 186 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 187 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 188 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 189 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.22 |
| Metatranscriptomes | 0 |
| Isolates | 4.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.68 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 90.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307511_10000001 | 3300030521 | Bacteria | 206079 |
| 2 | rootL2_10006679 | 3300003322 | Bacteria | 10093 |
| 3 | Ga0055531_10001162 | 3300003794 | Bacteria | 20306 |
| 4 | Ga0070690_100000919 | 3300005330 | Bacteria | 15002 |
| 5 | Ga0068869_100001844 | 3300005334 | Bacteria | 12734 |
| 6 | Ga0070680_100028902 | 3300005336 | Bacteria | 4450 |
| 7 | Ga0070692_10000438 | 3300005345 | Bacteria | 12676 |
| 8 | Ga0070675_100010859 | 3300005354 | Bacteria | 7121 |
| 9 | Ga0070714_100002316 | 3300005435 | Bacteria | 14009 |
| 10 | Ga0070701_10001649 | 3300005438 | Bacteria | 8349 |
| 11 | Ga0070700_100000348 | 3300005441 | Bacteria | 23779 |
| 12 | Ga0070700_100000984 | 3300005441 | Bacteria | 14056 |
| 13 | Ga0070694_100024533 | 3300005444 | Bacteria | 3892 |
| 14 | Ga0070678_100016445 | 3300005456 | Bacteria | 4734 |
| 15 | Ga0070681_10012692 | 3300005458 | Bacteria | 8359 |
| 16 | Ga0068867_100000889 | 3300005459 | Bacteria | 20222 |
| 17 | Ga0070698_100015222 | 3300005471 | Bacteria | 8134 |
| 18 | Ga0070697_100006357 | 3300005536 | Bacteria | 9143 |
| 19 | Ga0070686_100002902 | 3300005544 | Bacteria | 9414 |
| 20 | Ga0070693_100002294 | 3300005547 | Bacteria | 8775 |
| 21 | Ga0070665_100052496 | 3300005548 | Bacteria | 4088 |
| 22 | Ga0070704_100000937 | 3300005549 | Bacteria | 14739 |
| 23 | Ga0070704_100023602 | 3300005549 | Bacteria | 4022 |
| 24 | Ga0070704_100051377 | 3300005549 | Bacteria | 2903 |
| 25 | Ga0068855_100001402 | 3300005563 | Bacteria | 29881 |
| 26 | Ga0068855_100003441 | 3300005563 | Bacteria | 19369 |
| 27 | Ga0068857_100002888 | 3300005577 | Bacteria | 14142 |
| 28 | Ga0070702_100000579 | 3300005615 | Bacteria | 13402 |
| 29 | Ga0070702_100033420 | 3300005615 | Bacteria | 2828 |
| 30 | Ga0068866_10001366 | 3300005718 | Bacteria | 10555 |
| 31 | Ga0068866_10004299 | 3300005718 | Bacteria | 5850 |
| 32 | Ga0068861_100017587 | 3300005719 | Bacteria | 5079 |
| 33 | Ga0068870_10006290 | 3300005840 | Bacteria | 5230 |
| 34 | Ga0068858_100003121 | 3300005842 | Bacteria | 16588 |
| 35 | Ga0068860_100009495 | 3300005843 | Bacteria | 9661 |
| 36 | Ga0068862_100035419 | 3300005844 | Bacteria | 4227 |
| 37 | Ga0075364_10003828 | 3300006051 | Bacteria | 8619 |
| 38 | Ga0075369_10000379 | 3300006186 | Bacteria | 13326 |
| 39 | Ga0075366_10002901 | 3300006195 | Bacteria | 8906 |
| 40 | Ga0075366_10016735 | 3300006195 | Bacteria | 4216 |
| 41 | Ga0068871_100000838 | 3300006358 | Bacteria | 20597 |
| 42 | Ga0075428_100000505 | 3300006844 | Bacteria | 39638 |
| 43 | Ga0075433_10029333 | 3300006852 | Bacteria | 4685 |
| 44 | Ga0075434_100000066 | 3300006871 | Bacteria | 54004 |
| 45 | Ga0075429_100005401 | 3300006880 | Bacteria | 10997 |
| 46 | Ga0075429_100009965 | 3300006880 | Bacteria | 8236 |
| 47 | Ga0068865_100001548 | 3300006881 | Bacteria | 13418 |
| 48 | Ga0068865_100027428 | 3300006881 | Bacteria | 3763 |
| 49 | Ga0075436_100003618 | 3300006914 | Bacteria | 10604 |
| 50 | Ga0075436_100009916 | 3300006914 | Bacteria | 6512 |
| 51 | Ga0099794_10006142 | 3300007265 | Bacteria | 4852 |
| 52 | Ga0105240_10002337 | 3300009093 | Bacteria | 30662 |
| 53 | Ga0111539_10000490 | 3300009094 | Bacteria | 50162 |
| 54 | Ga0111539_10005630 | 3300009094 | Bacteria | 16199 |
| 55 | Ga0111539_10069699 | 3300009094 | Bacteria | 4152 |
| 56 | Ga0105245_10008459 | 3300009098 | Bacteria | 8984 |
| 57 | Ga0114129_10000341 | 3300009147 | Bacteria | 54331 |
| 58 | Ga0105243_10001267 | 3300009148 | Bacteria | 22700 |
| 59 | Ga0105242_10000119 | 3300009176 | Bacteria | 57821 |
| 60 | Ga0105242_10001838 | 3300009176 | Bacteria | 16663 |
| 61 | Ga0105242_10008465 | 3300009176 | Bacteria | 7903 |
| 62 | Ga0105237_10008235 | 3300009545 | Bacteria | 11319 |
| 63 | Ga0105239_10004139 | 3300010375 | Bacteria | 17414 |
| 64 | Ga0105239_10089586 | 3300010375 | Bacteria | 3393 |
| 65 | Ga0157369_10000349 | 3300013105 | Bacteria | 61491 |
| 66 | Ga0157378_10003247 | 3300013297 | Bacteria | 14460 |
| 67 | Ga0157378_10047337 | 3300013297 | Bacteria | 3823 |
| 68 | Ga0163163_10028201 | 3300014325 | Bacteria | 5388 |
| 69 | Ga0157379_10004304 | 3300014968 | Bacteria | 12171 |
| 70 | Ga0209051_1000214 | 3300025303 | Bacteria | 98444 |
| 71 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 72 | Ga0207642_10003986 | 3300025899 | Bacteria | 4710 |
| 73 | Ga0207643_10005679 | 3300025908 | Bacteria | 6674 |
| 74 | Ga0207695_10002750 | 3300025913 | Bacteria | 25639 |
| 75 | Ga0207694_10006734 | 3300025924 | Bacteria | 8727 |
| 76 | Ga0207687_10002209 | 3300025927 | Bacteria | 13267 |
| 77 | Ga0207664_10013185 | 3300025929 | Bacteria | 5922 |
| 78 | Ga0207686_10002635 | 3300025934 | Bacteria | 9733 |
| 79 | Ga0207709_10008850 | 3300025935 | Bacteria | 5554 |
| 80 | Ga0207670_10005809 | 3300025936 | Bacteria | 6812 |
| 81 | Ga0207704_10002580 | 3300025938 | Bacteria | 8168 |
| 82 | Ga0207689_10000159 | 3300025942 | Bacteria | 58241 |
| 83 | Ga0207689_10014287 | 3300025942 | Bacteria | 6757 |
| 84 | Ga0207667_10006209 | 3300025949 | Bacteria | 14505 |
| 85 | Ga0207667_10018883 | 3300025949 | Bacteria | 7713 |
| 86 | Ga0207712_10015829 | 3300025961 | Bacteria | 4872 |
| 87 | Ga0207703_10013226 | 3300026035 | Bacteria | 6428 |
| 88 | Ga0207708_10000248 | 3300026075 | Bacteria | 42511 |
| 89 | Ga0207708_10002210 | 3300026075 | Bacteria | 14382 |
| 90 | Ga0207648_10000248 | 3300026089 | Bacteria | 58258 |
| 91 | Ga0207674_10004859 | 3300026116 | Bacteria | 16095 |
| 92 | Ga0207674_10008191 | 3300026116 | Bacteria | 12112 |
| 93 | Ga0207674_10048281 | 3300026116 | Bacteria | 4357 |
| 94 | Ga0207675_100002692 | 3300026118 | Bacteria | 17530 |
| 95 | Ga0207683_10010700 | 3300026121 | Bacteria | 7819 |
| 96 | Ga0207698_10015905 | 3300026142 | Bacteria | 5057 |
| 97 | Ga0210000_1000231 | 3300027462 | Bacteria | 8004 |
| 98 | Ga0209974_10005010 | 3300027876 | Bacteria | 4684 |
| 99 | Ga0207428_10001574 | 3300027907 | Bacteria | 23762 |
| 100 | Ga0207428_10018979 | 3300027907 | Bacteria | 5863 |
| 101 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 102 | Ga0265334_10000390 | 3300028573 | Bacteria | 23215 |
| 103 | Ga0265338_10003066 | 3300028800 | Bacteria | 23994 |
| 104 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 105 | Ga0265332_10000278 | 3300031238 | Bacteria | 40354 |
| 106 | Ga0265327_10006628 | 3300031251 | Bacteria | 9204 |
| 107 | Ga0265316_10003942 | 3300031344 | Bacteria | 14872 |
| 108 | Ga0307509_10000353 | 3300031507 | Bacteria | 77017 |
| 109 | Ga0307408_100000072 | 3300031548 | Bacteria | 115918 |
| 110 | Ga0307408_100037778 | 3300031548 | Bacteria | 3403 |
| 111 | Ga0316575_10000211 | 3300031665 | Bacteria | 15515 |
| 112 | Ga0265314_10018133 | 3300031711 | Bacteria | 5499 |
| 113 | Ga0265342_10000009 | 3300031712 | Bacteria | 220210 |
| 114 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 115 | Ga0373954_0000081 | 3300035118 | Bacteria | 33886 |
| 116 | Ga0373954_0000113 | 3300035118 | Bacteria | 27416 |
| 117 | Ga0373955_0027181 | 3300035172 | Bacteria | 2955 |
| 118 | Ga0316574_0001441 | 3300035398 | Bacteria | 11286 |
| 119 | Ga0373931_0003761 | 3300035691 | Bacteria | 6861 |
| 120 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 121 | Ga0373927_0021190 | 3300035695 | Bacteria | 4259 |
| 122 | Ga0373933_0022105 | 3300035724 | Bacteria | 3620 |
| 123 | Ga0373937_0001711 | 3300036401 | Bacteria | 18445 |
| 124 | Ga0373937_0003019 | 3300036401 | Bacteria | 14112 |
| 125 | Ga0373937_0023586 | 3300036401 | Bacteria | 5542 |
| 126 | Ga0373937_0027393 | 3300036401 | Bacteria | 5153 |
| 127 | Ga0373937_0059763 | 3300036401 | Bacteria | 3503 |
| 128 | Ga0395899_0007513 | 3300037312 | Bacteria | 8422 |
| 129 | Ga0395899_0052703 | 3300037312 | Bacteria | 3015 |
| 130 | Ga0395900_0021301 | 3300037418 | Bacteria | 6627 |
| 131 | Ga0395898_0020985 | 3300037466 | Bacteria | 6626 |
| 132 | Ga0395905_0009616 | 3300037471 | Bacteria | 9441 |
| 133 | Ga0395901_0002006 | 3300038443 | Bacteria | 20946 |
| 134 | Ga0400483_163685 | 3300039062 | Unclassified | 3883 |
| 135 | Ga0400487_54435 | 3300039110 | Bacteria | 35105 |
| 136 | Ga0436361_0842081 | 3300039447 | Bacteria | 19653 |
| 137 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 138 | Ga0451577_0000126 | 3300042876 | Bacteria | 168037 |
| 139 | Ga0451577_0026291 | 3300042876 | Bacteria | 5273 |
| 140 | Ga0451577_0033722 | 3300042876 | Bacteria | 4616 |
| 141 | Ga0453683_0000033 | 3300044673 | Bacteria | 241479 |
| 142 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 143 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 144 | Ga0453684_0000123 | 3300044712 | Bacteria | 339304 |
| 145 | Ga0453684_0000348 | 3300044712 | Bacteria | 192530 |
| 146 | Ga0453684_0000365 | 3300044712 | Bacteria | 186233 |
| 147 | Ga0453684_0002270 | 3300044712 | Bacteria | 47459 |
| 148 | Ga0453684_0018084 | 3300044712 | Bacteria | 10851 |
| 149 | Ga0453684_0034818 | 3300044712 | Bacteria | 6979 |
| 150 | Ga0453684_0123130 | 3300044712 | Bacteria | 3127 |
| 151 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 152 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 153 | Ga0451576_0000166 | 3300045051 | Bacteria | 166647 |
| 154 | Ga0451576_0000498 | 3300045051 | Bacteria | 86292 |
| 155 | Ga0451576_0001118 | 3300045051 | Bacteria | 48728 |
| 156 | Ga0451576_0009642 | 3300045051 | Bacteria | 11172 |
| 157 | Ga0451576_0010670 | 3300045051 | Bacteria | 10526 |
| 158 | Ga0451576_0015253 | 3300045051 | Bacteria | 8519 |
| 159 | Ga0451576_0020444 | 3300045051 | Bacteria | 7210 |
| 160 | Ga0451576_0044009 | 3300045051 | Bacteria | 4709 |
| 161 | Ga0451576_0055712 | 3300045051 | Bacteria | 4135 |
| 162 | Ga0495592_0001493 | 3300046454 | Bacteria | 16284 |
| 163 | Ga0495592_0004439 | 3300046454 | Bacteria | 10268 |
| 164 | Ga0495592_0008347 | 3300046454 | Bacteria | 7767 |
| 165 | Ga0495592_0018304 | 3300046454 | Bacteria | 5325 |
| 166 | Ga0495641_0005331 | 3300046461 | Bacteria | 8724 |
| 167 | Ga0495651_0015847 | 3300046462 | Bacteria | 5835 |
| 168 | Ga0495580_0005602 | 3300046472 | Bacteria | 10347 |
| 169 | Ga0495639_0001202 | 3300046475 | Bacteria | 11671 |
| 170 | Ga0495662_0006369 | 3300046476 | Bacteria | 5899 |
| 171 | Ga0495664_0003368 | 3300046477 | Bacteria | 8688 |
| 172 | Ga0495628_0000532 | 3300046516 | Bacteria | 34861 |
| 173 | Ga0495628_0002277 | 3300046516 | Bacteria | 17372 |
| 174 | Ga0495628_0017670 | 3300046516 | Bacteria | 5929 |
| 175 | Ga0495630_0004976 | 3300046517 | Bacteria | 9348 |
| 176 | Ga0495630_0027026 | 3300046517 | Bacteria | 4253 |
| 177 | Ga0495666_0002281 | 3300046526 | Bacteria | 9548 |
| 178 | Ga0495652_0002507 | 3300046529 | Bacteria | 18834 |
| 179 | Ga0495640_0001145 | 3300046533 | Bacteria | 20719 |
| 180 | Ga0495640_0021978 | 3300046533 | Bacteria | 4671 |
| 181 | Ga0495640_0035662 | 3300046533 | Bacteria | 3519 |
| 182 | Ga0495586_0011032 | 3300046535 | Bacteria | 4799 |
| 183 | Ga0495587_0012851 | 3300046536 | Bacteria | 5265 |
| 184 | Ga0495645_0001700 | 3300046543 | Bacteria | 14952 |
| 185 | Ga0495645_0002448 | 3300046543 | Bacteria | 12601 |
| 186 | Ga0495667_0030610 | 3300046559 | Bacteria | 3616 |
| 187 | Ga0495634_0018894 | 3300046642 | Bacteria | 4900 |
| 188 | Ga0495599_0001123 | 3300046678 | Bacteria | 15093 |
| 189 | Ga0495647_0000693 | 3300046681 | Bacteria | 10014 |
| 190 | Ga0495658_0003469 | 3300046683 | Bacteria | 7793 |
| 191 | Ga0495624_0024952 | 3300046690 | Bacteria | 3932 |
| 192 | Ga0495600_0002915 | 3300046809 | Bacteria | 9967 |
| 193 | Ga0495604_0059698 | 3300047317 | Bacteria | 2923 |
| 194 | Ga0495636_0017076 | 3300047318 | Bacteria | 2904 |
| 195 | Ga0495680_0012907 | 3300047322 | Bacteria | 7320 |
| 196 | Ga0495675_0002113 | 3300047444 | Bacteria | 11847 |
| 197 | Ga0501033_0006757 | 3300049570 | Bacteria | 8960 |
| 198 | Ga0501036_0000162 | 3300049572 | Bacteria | 43591 |
| 199 | Ga0501036_0030016 | 3300049572 | Bacteria | 4594 |
| 200 | Ga0501037_0034633 | 3300049573 | Bacteria | 3726 |
| 201 | Ga0501038_0001044 | 3300049574 | Bacteria | 25020 |
| 202 | Ga0501039_0002679 | 3300049575 | Bacteria | 13284 |
| 203 | Ga0501039_0041739 | 3300049575 | Bacteria | 3544 |
| 204 | Ga0501040_0000167 | 3300049576 | Bacteria | 37032 |
| 205 | Ga0501041_0008340 | 3300049577 | Bacteria | 6095 |
| 206 | Ga0501042_0000122 | 3300049578 | Bacteria | 33231 |
| 207 | Ga0501042_0029022 | 3300049578 | Bacteria | 3902 |
| 208 | Ga0501046_0001014 | 3300049580 | Bacteria | 27382 |
| 209 | Ga0501048_0000147 | 3300049582 | Bacteria | 43084 |
| 210 | Ga0501068_0001486 | 3300049584 | Bacteria | 12475 |
| 211 | Ga0501069_0004293 | 3300049585 | Bacteria | 7369 |
| 212 | Ga0501070_0003184 | 3300049586 | Bacteria | 14271 |
| 213 | Ga0501071_0038414 | 3300049587 | Bacteria | 3421 |
| 214 | Ga0501072_0003995 | 3300049588 | Bacteria | 11162 |
| 215 | Ga0501072_0004186 | 3300049588 | Bacteria | 10933 |
| 216 | Ga0501073_0000845 | 3300049589 | Bacteria | 21834 |
| 217 | Ga0501073_0003064 | 3300049589 | Bacteria | 12538 |
| 218 | Ga0501074_0002082 | 3300049590 | Bacteria | 13828 |
| 219 | Ga0501074_0041658 | 3300049590 | Bacteria | 3324 |
| 220 | Ga0501075_0004600 | 3300049591 | Bacteria | 9360 |
| 221 | Ga0501076_0000726 | 3300049592 | Bacteria | 21331 |
| 222 | Ga0501076_0006108 | 3300049592 | Bacteria | 8716 |
| 223 | Ga0501076_0010459 | 3300049592 | Bacteria | 6887 |
| 224 | Ga0501077_0000231 | 3300049593 | Bacteria | 32894 |
| 225 | Ga0501077_0018025 | 3300049593 | Bacteria | 4462 |
| 226 | Ga0501223_000213 | 3300049663 | Bacteria | 14820 |
| 227 | Ga0501079_0000211 | 3300049741 | Bacteria | 34187 |
| 228 | Ga0501080_0004006 | 3300049742 | Bacteria | 13041 |
| 229 | Ga0501080_0015886 | 3300049742 | Bacteria | 6944 |
| 230 | Ga0501080_0027900 | 3300049742 | Bacteria | 5250 |
| 231 | Ga0501080_0050380 | 3300049742 | Bacteria | 3876 |
| 232 | Ga0501081_0000636 | 3300049743 | Bacteria | 20058 |
| 233 | Ga0501081_0001106 | 3300049743 | Bacteria | 16196 |
| 234 | Ga0501083_0010804 | 3300049744 | Bacteria | 6421 |
| 235 | Ga0501280_000111 | 3300049776 | Bacteria | 21158 |
| 236 | Ga0501035_0040524 | 3300049822 | Bacteria | 4208 |
| 237 | nmdc:mga05p37_24332_c1 | 3300050507 | Bacteria | 7359 |
| 238 | nmdc:mga09592_13268_c1 | 3300050508 | Bacteria | 6728 |
| 239 | nmdc:mga09592_4441_c1 | 3300050508 | Bacteria | 11352 |
| 240 | nmdc:mga08y16_2793_c2 | 3300050511 | Bacteria | 17491 |
| 241 | nmdc:mga08y16_77467_c1 | 3300050511 | Bacteria | 3467 |
| 242 | nmdc:mga0n895_46_c1 | 3300050512 | Bacteria | 73853 |
| 243 | nmdc:mga08x19_4599_c1 | 3300050514 | Bacteria | 8192 |
| 244 | nmdc:mga0a205_32013_c1 | 3300050515 | Bacteria | 5041 |
| 245 | Ga0495601_0000144 | 3300053077 | Bacteria | 40543 |
| 246 | Ga0495601_0008860 | 3300053077 | Bacteria | 5938 |
| 247 | Ga0495601_0019954 | 3300053077 | Bacteria | 4092 |
| 248 | Ga0495595_0001310 | 3300053084 | Bacteria | 9672 |
| 249 | Ga0495619_0010398 | 3300053085 | Bacteria | 5857 |
| 250 | Ga0500651_0011548 | 3300053093 | Bacteria | 5330 |
| 251 | Ga0500604_0003478 | 3300053151 | Bacteria | 4245 |
| 252 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 253 | Ga0501084_0000262 | 3300054114 | Bacteria | 39735 |
| 254 | Ga0501084_0022584 | 3300054114 | Bacteria | 5251 |
| 255 | Ga0501082_0000215 | 3300060353 | Bacteria | 50556 |
| 256 | Ga0501082_0002140 | 3300060353 | Bacteria | 17327 |
| 257 | Ga0501082_0047276 | 3300060353 | Bacteria | 3708 |
| 258 | Ga0501082_0053820 | 3300060353 | Bacteria | 3469 |
| 259 | Ga0530510_0000114 | 3300061734 | Bacteria | 45503 |
| 260 | 2526213182 | 2526164512 | Bacteria | 4025691 |
| 261 | 2548500420 | 2547132374 | Bacteria | 5530232 |
| 262 | 2548848665 | 2547132512 | Bacteria | 3416496 |
| 263 | 2643864524 | 2643221570 | Bacteria | 5103772 |
| 264 | 2643992863 | 2643221596 | Bacteria | 5006805 |
| 265 | 2644058214 | 2643221609 | Bacteria | 6756331 |
| 266 | 2644073258 | 2643221611 | Bacteria | 6820941 |
| 267 | 2644291785 | 2643221652 | Bacteria | 5140275 |
| 268 | 2644647033 | 2643221717 | Bacteria | 5676132 |
| 269 | 2739244442 | 2738543012 | Bacteria | 7115078 |
| 270 | 2816469885 | 2816332133 | Bacteria | 7249298 |
| 271 | 2919709174 | 2919704043 | Bacteria | 5560311 |
| 272 | 2990715103 | 2990710928 | Bacteria | 5002431 |
| 273 | Ga0307511_10000001 | |||
| 274 | rootL2_10006679 | |||
| 275 | Ga0055531_10001162 | |||
| 276 | Ga0070690_100000919 | |||
| 277 | Ga0068869_100001844 | |||
| 278 | Ga0070680_100028902 | |||
| 279 | Ga0070692_10000438 | |||
| 280 | Ga0070675_100010859 | |||
| 281 | Ga0070714_100002316 | |||
| 282 | Ga0070701_10001649 | |||
| 283 | Ga0070700_100000348 | |||
| 284 | Ga0070700_100000984 | |||
| 285 | Ga0070694_100024533 | |||
| 286 | Ga0070678_100016445 | |||
| 287 | Ga0070681_10012692 | |||
| 288 | Ga0068867_100000889 | |||
| 289 | Ga0070698_100015222 | |||
| 290 | Ga0070697_100006357 | |||
| 291 | Ga0070686_100002902 | |||
| 292 | Ga0070693_100002294 | |||
| 293 | Ga0070665_100052496 | |||
| 294 | Ga0070704_100000937 | |||
| 295 | Ga0070704_100023602 | |||
| 296 | Ga0070704_100051377 | |||
| 297 | Ga0068855_100001402 | |||
| 298 | Ga0068855_100003441 | |||
| 299 | Ga0068857_100002888 | |||
| 300 | Ga0070702_100000579 | |||
| 301 | Ga0070702_100033420 | |||
| 302 | Ga0068866_10001366 | |||
| 303 | Ga0068866_10004299 | |||
| 304 | Ga0068861_100017587 | |||
| 305 | Ga0068870_10006290 | |||
| 306 | Ga0068858_100003121 | |||
| 307 | Ga0068860_100009495 | |||
| 308 | Ga0068862_100035419 | |||
| 309 | Ga0075364_10003828 | |||
| 310 | Ga0075369_10000379 | |||
| 311 | Ga0075366_10002901 | |||
| 312 | Ga0075366_10016735 | |||
| 313 | Ga0068871_100000838 | |||
| 314 | Ga0075428_100000505 | |||
| 315 | Ga0075433_10029333 | |||
| 316 | Ga0075434_100000066 | |||
| 317 | Ga0075429_100005401 | |||
| 318 | Ga0075429_100009965 | |||
| 319 | Ga0068865_100001548 | |||
| 320 | Ga0068865_100027428 | |||
| 321 | Ga0075436_100003618 | |||
| 322 | Ga0075436_100009916 | |||
| 323 | Ga0099794_10006142 | |||
| 324 | Ga0105240_10002337 | |||
| 325 | Ga0111539_10000490 | |||
| 326 | Ga0111539_10005630 | |||
| 327 | Ga0111539_10069699 | |||
| 328 | Ga0105245_10008459 | |||
| 329 | Ga0114129_10000341 | |||
| 330 | Ga0105243_10001267 | |||
| 331 | Ga0105242_10000119 | |||
| 332 | Ga0105242_10001838 | |||
| 333 | Ga0105242_10008465 | |||
| 334 | Ga0105237_10008235 | |||
| 335 | Ga0105239_10004139 | |||
| 336 | Ga0105239_10089586 | |||
| 337 | Ga0157369_10000349 | |||
| 338 | Ga0157378_10003247 | |||
| 339 | Ga0157378_10047337 | |||
| 340 | Ga0163163_10028201 | |||
| 341 | Ga0157379_10004304 | |||
| 342 | Ga0209051_1000214 | |||
| 343 | Ga0209257_1000015 | |||
| 344 | Ga0207642_10003986 | |||
| 345 | Ga0207643_10005679 | |||
| 346 | Ga0207695_10002750 | |||
| 347 | Ga0207694_10006734 | |||
| 348 | Ga0207687_10002209 | |||
| 349 | Ga0207664_10013185 | |||
| 350 | Ga0207686_10002635 | |||
| 351 | Ga0207709_10008850 | |||
| 352 | Ga0207670_10005809 | |||
| 353 | Ga0207704_10002580 | |||
| 354 | Ga0207689_10000159 | |||
| 355 | Ga0207689_10014287 | |||
| 356 | Ga0207667_10006209 | |||
| 357 | Ga0207667_10018883 | |||
| 358 | Ga0207712_10015829 | |||
| 359 | Ga0207703_10013226 | |||
| 360 | Ga0207708_10000248 | |||
| 361 | Ga0207708_10002210 | |||
| 362 | Ga0207648_10000248 | |||
| 363 | Ga0207674_10004859 | |||
| 364 | Ga0207674_10008191 | |||
| 365 | Ga0207674_10048281 | |||
| 366 | Ga0207675_100002692 | |||
| 367 | Ga0207683_10010700 | |||
| 368 | Ga0207698_10015905 | |||
| 369 | Ga0210000_1000231 | |||
| 370 | Ga0209974_10005010 | |||
| 371 | Ga0207428_10001574 | |||
| 372 | Ga0207428_10018979 | |||
| 373 | Ga0265334_10000010 | |||
| 374 | Ga0265334_10000390 | |||
| 375 | Ga0265338_10003066 | |||
| 376 | Ga0265332_10000006 | |||
| 377 | Ga0265332_10000278 | |||
| 378 | Ga0265327_10006628 | |||
| 379 | Ga0265316_10003942 | |||
| 380 | Ga0307509_10000353 | |||
| 381 | Ga0307408_100000072 | |||
| 382 | Ga0307408_100037778 | |||
| 383 | Ga0316575_10000211 | |||
| 384 | Ga0265314_10018133 | |||
| 385 | Ga0265342_10000009 | |||
| 386 | Ga0307406_10000278 | |||
| 387 | Ga0373954_0000081 | |||
| 388 | Ga0373954_0000113 | |||
| 389 | Ga0373955_0027181 | |||
| 390 | Ga0316574_0001441 | |||
| 391 | Ga0373931_0003761 | |||
| 392 | Ga0373927_0000002 | |||
| 393 | Ga0373927_0021190 | |||
| 394 | Ga0373933_0022105 | |||
| 395 | Ga0373937_0001711 | |||
| 396 | Ga0373937_0003019 | |||
| 397 | Ga0373937_0023586 | |||
| 398 | Ga0373937_0027393 | |||
| 399 | Ga0373937_0059763 | |||
| 400 | Ga0395899_0007513 | |||
| 401 | Ga0395899_0052703 | |||
| 402 | Ga0395900_0021301 | |||
| 403 | Ga0395898_0020985 | |||
| 404 | Ga0395905_0009616 | |||
| 405 | Ga0395901_0002006 | |||
| 406 | Ga0400483_163685 | |||
| 407 | Ga0400487_54435 | |||
| 408 | Ga0436361_0842081 | |||
| 409 | Ga0451577_0000013 | |||
| 410 | Ga0451577_0000126 | |||
| 411 | Ga0451577_0026291 | |||
| 412 | Ga0451577_0033722 | |||
| 413 | Ga0453683_0000033 | |||
| 414 | Ga0453684_0000029 | |||
| 415 | Ga0453684_0000085 | |||
| 416 | Ga0453684_0000123 | |||
| 417 | Ga0453684_0000348 | |||
| 418 | Ga0453684_0000365 | |||
| 419 | Ga0453684_0002270 | |||
| 420 | Ga0453684_0018084 | |||
| 421 | Ga0453684_0034818 | |||
| 422 | Ga0453684_0123130 | |||
| 423 | Ga0451576_0000013 | |||
| 424 | Ga0451576_0000018 | |||
| 425 | Ga0451576_0000166 | |||
| 426 | Ga0451576_0000498 | |||
| 427 | Ga0451576_0001118 | |||
| 428 | Ga0451576_0009642 | |||
| 429 | Ga0451576_0010670 | |||
| 430 | Ga0451576_0015253 | |||
| 431 | Ga0451576_0020444 | |||
| 432 | Ga0451576_0044009 | |||
| 433 | Ga0451576_0055712 | |||
| 434 | Ga0495592_0001493 | |||
| 435 | Ga0495592_0004439 | |||
| 436 | Ga0495592_0008347 | |||
| 437 | Ga0495592_0018304 | |||
| 438 | Ga0495641_0005331 | |||
| 439 | Ga0495651_0015847 | |||
| 440 | Ga0495580_0005602 | |||
| 441 | Ga0495639_0001202 | |||
| 442 | Ga0495662_0006369 | |||
| 443 | Ga0495664_0003368 | |||
| 444 | Ga0495628_0000532 | |||
| 445 | Ga0495628_0002277 | |||
| 446 | Ga0495628_0017670 | |||
| 447 | Ga0495630_0004976 | |||
| 448 | Ga0495630_0027026 | |||
| 449 | Ga0495666_0002281 | |||
| 450 | Ga0495652_0002507 | |||
| 451 | Ga0495640_0001145 | |||
| 452 | Ga0495640_0021978 | |||
| 453 | Ga0495640_0035662 | |||
| 454 | Ga0495586_0011032 | |||
| 455 | Ga0495587_0012851 | |||
| 456 | Ga0495645_0001700 | |||
| 457 | Ga0495645_0002448 | |||
| 458 | Ga0495667_0030610 | |||
| 459 | Ga0495634_0018894 | |||
| 460 | Ga0495599_0001123 | |||
| 461 | Ga0495647_0000693 | |||
| 462 | Ga0495658_0003469 | |||
| 463 | Ga0495624_0024952 | |||
| 464 | Ga0495600_0002915 | |||
| 465 | Ga0495604_0059698 | |||
| 466 | Ga0495636_0017076 | |||
| 467 | Ga0495680_0012907 | |||
| 468 | Ga0495675_0002113 | |||
| 469 | Ga0501033_0006757 | |||
| 470 | Ga0501036_0000162 | |||
| 471 | Ga0501036_0030016 | |||
| 472 | Ga0501037_0034633 | |||
| 473 | Ga0501038_0001044 | |||
| 474 | Ga0501039_0002679 | |||
| 475 | Ga0501039_0041739 | |||
| 476 | Ga0501040_0000167 | |||
| 477 | Ga0501041_0008340 | |||
| 478 | Ga0501042_0000122 | |||
| 479 | Ga0501042_0029022 | |||
| 480 | Ga0501046_0001014 | |||
| 481 | Ga0501048_0000147 | |||
| 482 | Ga0501068_0001486 | |||
| 483 | Ga0501069_0004293 | |||
| 484 | Ga0501070_0003184 | |||
| 485 | Ga0501071_0038414 | |||
| 486 | Ga0501072_0003995 | |||
| 487 | Ga0501072_0004186 | |||
| 488 | Ga0501073_0000845 | |||
| 489 | Ga0501073_0003064 | |||
| 490 | Ga0501074_0002082 | |||
| 491 | Ga0501074_0041658 | |||
| 492 | Ga0501075_0004600 | |||
| 493 | Ga0501076_0000726 | |||
| 494 | Ga0501076_0006108 | |||
| 495 | Ga0501076_0010459 | |||
| 496 | Ga0501077_0000231 | |||
| 497 | Ga0501077_0018025 | |||
| 498 | Ga0501223_000213 | |||
| 499 | Ga0501079_0000211 | |||
| 500 | Ga0501080_0004006 | |||
| 501 | Ga0501080_0015886 | |||
| 502 | Ga0501080_0027900 | |||
| 503 | Ga0501080_0050380 | |||
| 504 | Ga0501081_0000636 | |||
| 505 | Ga0501081_0001106 | |||
| 506 | Ga0501083_0010804 | |||
| 507 | Ga0501280_000111 | |||
| 508 | Ga0501035_0040524 | |||
| 509 | nmdc:mga05p37_24332_c1 | |||
| 510 | nmdc:mga09592_13268_c1 | |||
| 511 | nmdc:mga09592_4441_c1 | |||
| 512 | nmdc:mga08y16_2793_c2 | |||
| 513 | nmdc:mga08y16_77467_c1 | |||
| 514 | nmdc:mga0n895_46_c1 | |||
| 515 | nmdc:mga08x19_4599_c1 | |||
| 516 | nmdc:mga0a205_32013_c1 | |||
| 517 | Ga0495601_0000144 | |||
| 518 | Ga0495601_0008860 | |||
| 519 | Ga0495601_0019954 | |||
| 520 | Ga0495595_0001310 | |||
| 521 | Ga0495619_0010398 | |||
| 522 | Ga0500651_0011548 | |||
| 523 | Ga0500604_0003478 | |||
| 524 | Ga0500622_0000002 | |||
| 525 | Ga0501084_0000262 | |||
| 526 | Ga0501084_0022584 | |||
| 527 | Ga0501082_0000215 | |||
| 528 | Ga0501082_0002140 | |||
| 529 | Ga0501082_0047276 | |||
| 530 | Ga0501082_0053820 | |||
| 531 | Ga0530510_0000114 | |||
| 532 | 2526213182 | |||
| 533 | 2548500420 | |||
| 534 | 2548848665 | |||
| 535 | 2643864524 | |||
| 536 | 2643992863 | |||
| 537 | 2644058214 | |||
| 538 | 2644073258 | |||
| 539 | 2644291785 | |||
| 540 | 2644647033 | |||
| 541 | 2739244442 | |||
| 542 | 2816469885 | |||
| 543 | 2919709174 | |||
| 544 | 2990715103 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b2p-assembly1.cif.gz_A-2 | dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis | 0.9163 | 569 | 835 |
| 1o6y-assembly1.cif.gz_A | catalytic domain of pknb kinase from mycobacterium tuberculosis | 0.9139 | 569 | 835 |
| 5u94-assembly1.cif.gz_A | crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693. | 0.9136 | 569 | 835 |
| 3ori-assembly4.cif.gz_D | mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 1) | 0.9102 | 569 | 833 |
| 2fum-assembly2.cif.gz_B | catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone | 0.9005 | 569 | 835 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fumD02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9361 | 655 | 833 | 1.10.510.10 |
| 2fumD02 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9252 | 655 | 833 | 1.10.510.10 |
| af_P9WI65_108_296_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9014 | 657 | 834 | 1.10.510.10 |
| af_P9WI63_100_284_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8939 | 655 | 834 | 1.10.510.10 |
| af_P9WI77_97_289_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.891 | 655 | 835 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537BLU9-F1-model_v4 | Protein kinase domain-containing protein | 0.9786 | 735 | 834 |
GO:0004674
GO:0005524 GO:0016020 |
| AF-A0A1Q6WJU2-F1-model_v4 | Uncharacterized protein | 0.9159 | 566 | 833 |
GO:0004676
GO:0004677 GO:0004679 GO:0004711 GO:0005524 GO:0030553 GO:0035175 GO:0035402 GO:0035403 GO:0035979 GO:0044022 GO:0044023 GO:0044024 GO:0044025 GO:0072354 GO:0072371 GO:0072518 GO:0140823 GO:0140855 GO:0140857 GO:1990244 |
| AF-A0A402AFI9-F1-model_v4 | non-specific serine/threonine protein kinase (EC 2.7.11.1) | 0.9155 | 737 | 844 |
GO:0004674
GO:0005524 GO:0016020 |
| AF-A0A845TW34-F1-model_v4 | Protein kinase | 0.9143 | 565 | 844 |
GO:0004674
GO:0005524 |
| AF-A0A847GTH0-F1-model_v4 | Protein kinase | 0.9044 | 566 | 834 |
GO:0004674
GO:0005524 GO:0016020 |