F378450

General Info

Members Datasets Scaffolds Average Seq Length
272 189 544 847

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000001|Ga0307511_10000001158
Length 923
Sequence MAKLKGDLWKSDWFFGLVVSLLFFICAYVVGATGDLLDSLDRKAYDMGVRASSKQPNDRIAIIAIDDASISNIGRWPWSREVHAKMTDLLTGAKAKVIGNTVFFFEPQQDPGLVYINKMLEVYAKAAPEMAQIGALLKEAEANLNTDRRLAESYAKAGNVILPLSLTPGVPRGKPDNPLPDYALKNAFTDKGGENDIISQAVQLPIAPLGRVAAGLGHLNDTQDSDGAIRTEPLVIQYYDQYFPSFSLIVAAKSLNLSVSDIKVKWGEQLKLSKLAITTDPSNRMYTYFYKDRDGKSAFQIDSFYDVLSGKIPASKYADKIVLIGATATGVGTSFATPVAPAMTPVERMAHTVSSILSEHFFVSPSWAVWVKLLVFVAVAAYLIAVLPRLKARPAAIITLVVLVVXLATHFGLMVSAGMWIPLMVPATLLLIGHLLLTTKRYIVTEAGKQKSDVESAESNRMLGLAFQGQGQLDMAFDKFRKVPFDGQLMDNLYNLALDFERKRQFNKAQSVYEHMHTYDPKFKDLGSKITRAKNLSETVILGGGSSRGNASILDTAGAGEKPMLGRYQVEKELGKGAMGVVYQGRDPKIARVVAIKTMALSQEFEADELEEAKARFFREAETAGRLNHPHIVTIYDAGEEHDLCFIAMELLKGKDLVPYTKPETLLPISRVVSITVRVADALGYAHRQNVVHRDIKPANIMYDLDSDNPKVTDFGIARVTDSSKTKTGMVLGTPSYMSPEQLSGKKVDGRSDLFSLAVSLYQMLSGQLPFVGDSMAQLMFKIANETAPDIRTLNPAVPEGLAEVLAYAMAKEAEQRYQTGEELAAALRPFGETPATATGMNIPAVTSGGVRMPTQQVPAQGTRPVANPHAGGTVQLNAPVVPEGDKTVILSAPPAATGAGDTQPIPAQPSGGKPAPDVDISL

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
178 2547132374 Acidovorax radicis N35 Isolate Unclassified
179 2547132512 Azospira oryzae 6a3 Isolate Unclassified
180 2643221570 Acidovorax sp. Root568 Isolate Unclassified
181 2643221596 Acidovorax sp. Root70 Isolate Unclassified
182 2643221609 Acidovorax sp. Root217 Isolate Unclassified
183 2643221611 Acidovorax sp. Root219 Isolate Unclassified
184 2643221652 Acidovorax sp. Root402 Isolate Unclassified
185 2643221717 Acidovorax sp. Root267 Isolate Unclassified
186 2738543012 Acidovorax sp. CF301 Isolate Unclassified
187 2816332133 Acidovorax radicis 2721A Isolate Unclassified
188 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
189 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.22
Metatranscriptomes 0
Isolates 4.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 0
Rhizosphere 90.07
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10000001 3300030521 Bacteria 206079
2 rootL2_10006679 3300003322 Bacteria 10093
3 Ga0055531_10001162 3300003794 Bacteria 20306
4 Ga0070690_100000919 3300005330 Bacteria 15002
5 Ga0068869_100001844 3300005334 Bacteria 12734
6 Ga0070680_100028902 3300005336 Bacteria 4450
7 Ga0070692_10000438 3300005345 Bacteria 12676
8 Ga0070675_100010859 3300005354 Bacteria 7121
9 Ga0070714_100002316 3300005435 Bacteria 14009
10 Ga0070701_10001649 3300005438 Bacteria 8349
11 Ga0070700_100000348 3300005441 Bacteria 23779
12 Ga0070700_100000984 3300005441 Bacteria 14056
13 Ga0070694_100024533 3300005444 Bacteria 3892
14 Ga0070678_100016445 3300005456 Bacteria 4734
15 Ga0070681_10012692 3300005458 Bacteria 8359
16 Ga0068867_100000889 3300005459 Bacteria 20222
17 Ga0070698_100015222 3300005471 Bacteria 8134
18 Ga0070697_100006357 3300005536 Bacteria 9143
19 Ga0070686_100002902 3300005544 Bacteria 9414
20 Ga0070693_100002294 3300005547 Bacteria 8775
21 Ga0070665_100052496 3300005548 Bacteria 4088
22 Ga0070704_100000937 3300005549 Bacteria 14739
23 Ga0070704_100023602 3300005549 Bacteria 4022
24 Ga0070704_100051377 3300005549 Bacteria 2903
25 Ga0068855_100001402 3300005563 Bacteria 29881
26 Ga0068855_100003441 3300005563 Bacteria 19369
27 Ga0068857_100002888 3300005577 Bacteria 14142
28 Ga0070702_100000579 3300005615 Bacteria 13402
29 Ga0070702_100033420 3300005615 Bacteria 2828
30 Ga0068866_10001366 3300005718 Bacteria 10555
31 Ga0068866_10004299 3300005718 Bacteria 5850
32 Ga0068861_100017587 3300005719 Bacteria 5079
33 Ga0068870_10006290 3300005840 Bacteria 5230
34 Ga0068858_100003121 3300005842 Bacteria 16588
35 Ga0068860_100009495 3300005843 Bacteria 9661
36 Ga0068862_100035419 3300005844 Bacteria 4227
37 Ga0075364_10003828 3300006051 Bacteria 8619
38 Ga0075369_10000379 3300006186 Bacteria 13326
39 Ga0075366_10002901 3300006195 Bacteria 8906
40 Ga0075366_10016735 3300006195 Bacteria 4216
41 Ga0068871_100000838 3300006358 Bacteria 20597
42 Ga0075428_100000505 3300006844 Bacteria 39638
43 Ga0075433_10029333 3300006852 Bacteria 4685
44 Ga0075434_100000066 3300006871 Bacteria 54004
45 Ga0075429_100005401 3300006880 Bacteria 10997
46 Ga0075429_100009965 3300006880 Bacteria 8236
47 Ga0068865_100001548 3300006881 Bacteria 13418
48 Ga0068865_100027428 3300006881 Bacteria 3763
49 Ga0075436_100003618 3300006914 Bacteria 10604
50 Ga0075436_100009916 3300006914 Bacteria 6512
51 Ga0099794_10006142 3300007265 Bacteria 4852
52 Ga0105240_10002337 3300009093 Bacteria 30662
53 Ga0111539_10000490 3300009094 Bacteria 50162
54 Ga0111539_10005630 3300009094 Bacteria 16199
55 Ga0111539_10069699 3300009094 Bacteria 4152
56 Ga0105245_10008459 3300009098 Bacteria 8984
57 Ga0114129_10000341 3300009147 Bacteria 54331
58 Ga0105243_10001267 3300009148 Bacteria 22700
59 Ga0105242_10000119 3300009176 Bacteria 57821
60 Ga0105242_10001838 3300009176 Bacteria 16663
61 Ga0105242_10008465 3300009176 Bacteria 7903
62 Ga0105237_10008235 3300009545 Bacteria 11319
63 Ga0105239_10004139 3300010375 Bacteria 17414
64 Ga0105239_10089586 3300010375 Bacteria 3393
65 Ga0157369_10000349 3300013105 Bacteria 61491
66 Ga0157378_10003247 3300013297 Bacteria 14460
67 Ga0157378_10047337 3300013297 Bacteria 3823
68 Ga0163163_10028201 3300014325 Bacteria 5388
69 Ga0157379_10004304 3300014968 Bacteria 12171
70 Ga0209051_1000214 3300025303 Bacteria 98444
71 Ga0209257_1000015 3300025304 Bacteria 908141
72 Ga0207642_10003986 3300025899 Bacteria 4710
73 Ga0207643_10005679 3300025908 Bacteria 6674
74 Ga0207695_10002750 3300025913 Bacteria 25639
75 Ga0207694_10006734 3300025924 Bacteria 8727
76 Ga0207687_10002209 3300025927 Bacteria 13267
77 Ga0207664_10013185 3300025929 Bacteria 5922
78 Ga0207686_10002635 3300025934 Bacteria 9733
79 Ga0207709_10008850 3300025935 Bacteria 5554
80 Ga0207670_10005809 3300025936 Bacteria 6812
81 Ga0207704_10002580 3300025938 Bacteria 8168
82 Ga0207689_10000159 3300025942 Bacteria 58241
83 Ga0207689_10014287 3300025942 Bacteria 6757
84 Ga0207667_10006209 3300025949 Bacteria 14505
85 Ga0207667_10018883 3300025949 Bacteria 7713
86 Ga0207712_10015829 3300025961 Bacteria 4872
87 Ga0207703_10013226 3300026035 Bacteria 6428
88 Ga0207708_10000248 3300026075 Bacteria 42511
89 Ga0207708_10002210 3300026075 Bacteria 14382
90 Ga0207648_10000248 3300026089 Bacteria 58258
91 Ga0207674_10004859 3300026116 Bacteria 16095
92 Ga0207674_10008191 3300026116 Bacteria 12112
93 Ga0207674_10048281 3300026116 Bacteria 4357
94 Ga0207675_100002692 3300026118 Bacteria 17530
95 Ga0207683_10010700 3300026121 Bacteria 7819
96 Ga0207698_10015905 3300026142 Bacteria 5057
97 Ga0210000_1000231 3300027462 Bacteria 8004
98 Ga0209974_10005010 3300027876 Bacteria 4684
99 Ga0207428_10001574 3300027907 Bacteria 23762
100 Ga0207428_10018979 3300027907 Bacteria 5863
101 Ga0265334_10000010 3300028573 Bacteria 188179
102 Ga0265334_10000390 3300028573 Bacteria 23215
103 Ga0265338_10003066 3300028800 Bacteria 23994
104 Ga0265332_10000006 3300031238 Bacteria 327963
105 Ga0265332_10000278 3300031238 Bacteria 40354
106 Ga0265327_10006628 3300031251 Bacteria 9204
107 Ga0265316_10003942 3300031344 Bacteria 14872
108 Ga0307509_10000353 3300031507 Bacteria 77017
109 Ga0307408_100000072 3300031548 Bacteria 115918
110 Ga0307408_100037778 3300031548 Bacteria 3403
111 Ga0316575_10000211 3300031665 Bacteria 15515
112 Ga0265314_10018133 3300031711 Bacteria 5499
113 Ga0265342_10000009 3300031712 Bacteria 220210
114 Ga0307406_10000278 3300031901 Bacteria 30154
115 Ga0373954_0000081 3300035118 Bacteria 33886
116 Ga0373954_0000113 3300035118 Bacteria 27416
117 Ga0373955_0027181 3300035172 Bacteria 2955
118 Ga0316574_0001441 3300035398 Bacteria 11286
119 Ga0373931_0003761 3300035691 Bacteria 6861
120 Ga0373927_0000002 3300035695 Bacteria 966219
121 Ga0373927_0021190 3300035695 Bacteria 4259
122 Ga0373933_0022105 3300035724 Bacteria 3620
123 Ga0373937_0001711 3300036401 Bacteria 18445
124 Ga0373937_0003019 3300036401 Bacteria 14112
125 Ga0373937_0023586 3300036401 Bacteria 5542
126 Ga0373937_0027393 3300036401 Bacteria 5153
127 Ga0373937_0059763 3300036401 Bacteria 3503
128 Ga0395899_0007513 3300037312 Bacteria 8422
129 Ga0395899_0052703 3300037312 Bacteria 3015
130 Ga0395900_0021301 3300037418 Bacteria 6627
131 Ga0395898_0020985 3300037466 Bacteria 6626
132 Ga0395905_0009616 3300037471 Bacteria 9441
133 Ga0395901_0002006 3300038443 Bacteria 20946
134 Ga0400483_163685 3300039062 Unclassified 3883
135 Ga0400487_54435 3300039110 Bacteria 35105
136 Ga0436361_0842081 3300039447 Bacteria 19653
137 Ga0451577_0000013 3300042876 Bacteria 550689
138 Ga0451577_0000126 3300042876 Bacteria 168037
139 Ga0451577_0026291 3300042876 Bacteria 5273
140 Ga0451577_0033722 3300042876 Bacteria 4616
141 Ga0453683_0000033 3300044673 Bacteria 241479
142 Ga0453684_0000029 3300044712 Bacteria 757969
143 Ga0453684_0000085 3300044712 Bacteria 397817
144 Ga0453684_0000123 3300044712 Bacteria 339304
145 Ga0453684_0000348 3300044712 Bacteria 192530
146 Ga0453684_0000365 3300044712 Bacteria 186233
147 Ga0453684_0002270 3300044712 Bacteria 47459
148 Ga0453684_0018084 3300044712 Bacteria 10851
149 Ga0453684_0034818 3300044712 Bacteria 6979
150 Ga0453684_0123130 3300044712 Bacteria 3127
151 Ga0451576_0000013 3300045051 Bacteria 665120
152 Ga0451576_0000018 3300045051 Bacteria 550689
153 Ga0451576_0000166 3300045051 Bacteria 166647
154 Ga0451576_0000498 3300045051 Bacteria 86292
155 Ga0451576_0001118 3300045051 Bacteria 48728
156 Ga0451576_0009642 3300045051 Bacteria 11172
157 Ga0451576_0010670 3300045051 Bacteria 10526
158 Ga0451576_0015253 3300045051 Bacteria 8519
159 Ga0451576_0020444 3300045051 Bacteria 7210
160 Ga0451576_0044009 3300045051 Bacteria 4709
161 Ga0451576_0055712 3300045051 Bacteria 4135
162 Ga0495592_0001493 3300046454 Bacteria 16284
163 Ga0495592_0004439 3300046454 Bacteria 10268
164 Ga0495592_0008347 3300046454 Bacteria 7767
165 Ga0495592_0018304 3300046454 Bacteria 5325
166 Ga0495641_0005331 3300046461 Bacteria 8724
167 Ga0495651_0015847 3300046462 Bacteria 5835
168 Ga0495580_0005602 3300046472 Bacteria 10347
169 Ga0495639_0001202 3300046475 Bacteria 11671
170 Ga0495662_0006369 3300046476 Bacteria 5899
171 Ga0495664_0003368 3300046477 Bacteria 8688
172 Ga0495628_0000532 3300046516 Bacteria 34861
173 Ga0495628_0002277 3300046516 Bacteria 17372
174 Ga0495628_0017670 3300046516 Bacteria 5929
175 Ga0495630_0004976 3300046517 Bacteria 9348
176 Ga0495630_0027026 3300046517 Bacteria 4253
177 Ga0495666_0002281 3300046526 Bacteria 9548
178 Ga0495652_0002507 3300046529 Bacteria 18834
179 Ga0495640_0001145 3300046533 Bacteria 20719
180 Ga0495640_0021978 3300046533 Bacteria 4671
181 Ga0495640_0035662 3300046533 Bacteria 3519
182 Ga0495586_0011032 3300046535 Bacteria 4799
183 Ga0495587_0012851 3300046536 Bacteria 5265
184 Ga0495645_0001700 3300046543 Bacteria 14952
185 Ga0495645_0002448 3300046543 Bacteria 12601
186 Ga0495667_0030610 3300046559 Bacteria 3616
187 Ga0495634_0018894 3300046642 Bacteria 4900
188 Ga0495599_0001123 3300046678 Bacteria 15093
189 Ga0495647_0000693 3300046681 Bacteria 10014
190 Ga0495658_0003469 3300046683 Bacteria 7793
191 Ga0495624_0024952 3300046690 Bacteria 3932
192 Ga0495600_0002915 3300046809 Bacteria 9967
193 Ga0495604_0059698 3300047317 Bacteria 2923
194 Ga0495636_0017076 3300047318 Bacteria 2904
195 Ga0495680_0012907 3300047322 Bacteria 7320
196 Ga0495675_0002113 3300047444 Bacteria 11847
197 Ga0501033_0006757 3300049570 Bacteria 8960
198 Ga0501036_0000162 3300049572 Bacteria 43591
199 Ga0501036_0030016 3300049572 Bacteria 4594
200 Ga0501037_0034633 3300049573 Bacteria 3726
201 Ga0501038_0001044 3300049574 Bacteria 25020
202 Ga0501039_0002679 3300049575 Bacteria 13284
203 Ga0501039_0041739 3300049575 Bacteria 3544
204 Ga0501040_0000167 3300049576 Bacteria 37032
205 Ga0501041_0008340 3300049577 Bacteria 6095
206 Ga0501042_0000122 3300049578 Bacteria 33231
207 Ga0501042_0029022 3300049578 Bacteria 3902
208 Ga0501046_0001014 3300049580 Bacteria 27382
209 Ga0501048_0000147 3300049582 Bacteria 43084
210 Ga0501068_0001486 3300049584 Bacteria 12475
211 Ga0501069_0004293 3300049585 Bacteria 7369
212 Ga0501070_0003184 3300049586 Bacteria 14271
213 Ga0501071_0038414 3300049587 Bacteria 3421
214 Ga0501072_0003995 3300049588 Bacteria 11162
215 Ga0501072_0004186 3300049588 Bacteria 10933
216 Ga0501073_0000845 3300049589 Bacteria 21834
217 Ga0501073_0003064 3300049589 Bacteria 12538
218 Ga0501074_0002082 3300049590 Bacteria 13828
219 Ga0501074_0041658 3300049590 Bacteria 3324
220 Ga0501075_0004600 3300049591 Bacteria 9360
221 Ga0501076_0000726 3300049592 Bacteria 21331
222 Ga0501076_0006108 3300049592 Bacteria 8716
223 Ga0501076_0010459 3300049592 Bacteria 6887
224 Ga0501077_0000231 3300049593 Bacteria 32894
225 Ga0501077_0018025 3300049593 Bacteria 4462
226 Ga0501223_000213 3300049663 Bacteria 14820
227 Ga0501079_0000211 3300049741 Bacteria 34187
228 Ga0501080_0004006 3300049742 Bacteria 13041
229 Ga0501080_0015886 3300049742 Bacteria 6944
230 Ga0501080_0027900 3300049742 Bacteria 5250
231 Ga0501080_0050380 3300049742 Bacteria 3876
232 Ga0501081_0000636 3300049743 Bacteria 20058
233 Ga0501081_0001106 3300049743 Bacteria 16196
234 Ga0501083_0010804 3300049744 Bacteria 6421
235 Ga0501280_000111 3300049776 Bacteria 21158
236 Ga0501035_0040524 3300049822 Bacteria 4208
237 nmdc:mga05p37_24332_c1 3300050507 Bacteria 7359
238 nmdc:mga09592_13268_c1 3300050508 Bacteria 6728
239 nmdc:mga09592_4441_c1 3300050508 Bacteria 11352
240 nmdc:mga08y16_2793_c2 3300050511 Bacteria 17491
241 nmdc:mga08y16_77467_c1 3300050511 Bacteria 3467
242 nmdc:mga0n895_46_c1 3300050512 Bacteria 73853
243 nmdc:mga08x19_4599_c1 3300050514 Bacteria 8192
244 nmdc:mga0a205_32013_c1 3300050515 Bacteria 5041
245 Ga0495601_0000144 3300053077 Bacteria 40543
246 Ga0495601_0008860 3300053077 Bacteria 5938
247 Ga0495601_0019954 3300053077 Bacteria 4092
248 Ga0495595_0001310 3300053084 Bacteria 9672
249 Ga0495619_0010398 3300053085 Bacteria 5857
250 Ga0500651_0011548 3300053093 Bacteria 5330
251 Ga0500604_0003478 3300053151 Bacteria 4245
252 Ga0500622_0000002 3300053156 Bacteria 646442
253 Ga0501084_0000262 3300054114 Bacteria 39735
254 Ga0501084_0022584 3300054114 Bacteria 5251
255 Ga0501082_0000215 3300060353 Bacteria 50556
256 Ga0501082_0002140 3300060353 Bacteria 17327
257 Ga0501082_0047276 3300060353 Bacteria 3708
258 Ga0501082_0053820 3300060353 Bacteria 3469
259 Ga0530510_0000114 3300061734 Bacteria 45503
260 2526213182 2526164512 Bacteria 4025691
261 2548500420 2547132374 Bacteria 5530232
262 2548848665 2547132512 Bacteria 3416496
263 2643864524 2643221570 Bacteria 5103772
264 2643992863 2643221596 Bacteria 5006805
265 2644058214 2643221609 Bacteria 6756331
266 2644073258 2643221611 Bacteria 6820941
267 2644291785 2643221652 Bacteria 5140275
268 2644647033 2643221717 Bacteria 5676132
269 2739244442 2738543012 Bacteria 7115078
270 2816469885 2816332133 Bacteria 7249298
271 2919709174 2919704043 Bacteria 5560311
272 2990715103 2990710928 Bacteria 5002431
273 Ga0307511_10000001
274 rootL2_10006679
275 Ga0055531_10001162
276 Ga0070690_100000919
277 Ga0068869_100001844
278 Ga0070680_100028902
279 Ga0070692_10000438
280 Ga0070675_100010859
281 Ga0070714_100002316
282 Ga0070701_10001649
283 Ga0070700_100000348
284 Ga0070700_100000984
285 Ga0070694_100024533
286 Ga0070678_100016445
287 Ga0070681_10012692
288 Ga0068867_100000889
289 Ga0070698_100015222
290 Ga0070697_100006357
291 Ga0070686_100002902
292 Ga0070693_100002294
293 Ga0070665_100052496
294 Ga0070704_100000937
295 Ga0070704_100023602
296 Ga0070704_100051377
297 Ga0068855_100001402
298 Ga0068855_100003441
299 Ga0068857_100002888
300 Ga0070702_100000579
301 Ga0070702_100033420
302 Ga0068866_10001366
303 Ga0068866_10004299
304 Ga0068861_100017587
305 Ga0068870_10006290
306 Ga0068858_100003121
307 Ga0068860_100009495
308 Ga0068862_100035419
309 Ga0075364_10003828
310 Ga0075369_10000379
311 Ga0075366_10002901
312 Ga0075366_10016735
313 Ga0068871_100000838
314 Ga0075428_100000505
315 Ga0075433_10029333
316 Ga0075434_100000066
317 Ga0075429_100005401
318 Ga0075429_100009965
319 Ga0068865_100001548
320 Ga0068865_100027428
321 Ga0075436_100003618
322 Ga0075436_100009916
323 Ga0099794_10006142
324 Ga0105240_10002337
325 Ga0111539_10000490
326 Ga0111539_10005630
327 Ga0111539_10069699
328 Ga0105245_10008459
329 Ga0114129_10000341
330 Ga0105243_10001267
331 Ga0105242_10000119
332 Ga0105242_10001838
333 Ga0105242_10008465
334 Ga0105237_10008235
335 Ga0105239_10004139
336 Ga0105239_10089586
337 Ga0157369_10000349
338 Ga0157378_10003247
339 Ga0157378_10047337
340 Ga0163163_10028201
341 Ga0157379_10004304
342 Ga0209051_1000214
343 Ga0209257_1000015
344 Ga0207642_10003986
345 Ga0207643_10005679
346 Ga0207695_10002750
347 Ga0207694_10006734
348 Ga0207687_10002209
349 Ga0207664_10013185
350 Ga0207686_10002635
351 Ga0207709_10008850
352 Ga0207670_10005809
353 Ga0207704_10002580
354 Ga0207689_10000159
355 Ga0207689_10014287
356 Ga0207667_10006209
357 Ga0207667_10018883
358 Ga0207712_10015829
359 Ga0207703_10013226
360 Ga0207708_10000248
361 Ga0207708_10002210
362 Ga0207648_10000248
363 Ga0207674_10004859
364 Ga0207674_10008191
365 Ga0207674_10048281
366 Ga0207675_100002692
367 Ga0207683_10010700
368 Ga0207698_10015905
369 Ga0210000_1000231
370 Ga0209974_10005010
371 Ga0207428_10001574
372 Ga0207428_10018979
373 Ga0265334_10000010
374 Ga0265334_10000390
375 Ga0265338_10003066
376 Ga0265332_10000006
377 Ga0265332_10000278
378 Ga0265327_10006628
379 Ga0265316_10003942
380 Ga0307509_10000353
381 Ga0307408_100000072
382 Ga0307408_100037778
383 Ga0316575_10000211
384 Ga0265314_10018133
385 Ga0265342_10000009
386 Ga0307406_10000278
387 Ga0373954_0000081
388 Ga0373954_0000113
389 Ga0373955_0027181
390 Ga0316574_0001441
391 Ga0373931_0003761
392 Ga0373927_0000002
393 Ga0373927_0021190
394 Ga0373933_0022105
395 Ga0373937_0001711
396 Ga0373937_0003019
397 Ga0373937_0023586
398 Ga0373937_0027393
399 Ga0373937_0059763
400 Ga0395899_0007513
401 Ga0395899_0052703
402 Ga0395900_0021301
403 Ga0395898_0020985
404 Ga0395905_0009616
405 Ga0395901_0002006
406 Ga0400483_163685
407 Ga0400487_54435
408 Ga0436361_0842081
409 Ga0451577_0000013
410 Ga0451577_0000126
411 Ga0451577_0026291
412 Ga0451577_0033722
413 Ga0453683_0000033
414 Ga0453684_0000029
415 Ga0453684_0000085
416 Ga0453684_0000123
417 Ga0453684_0000348
418 Ga0453684_0000365
419 Ga0453684_0002270
420 Ga0453684_0018084
421 Ga0453684_0034818
422 Ga0453684_0123130
423 Ga0451576_0000013
424 Ga0451576_0000018
425 Ga0451576_0000166
426 Ga0451576_0000498
427 Ga0451576_0001118
428 Ga0451576_0009642
429 Ga0451576_0010670
430 Ga0451576_0015253
431 Ga0451576_0020444
432 Ga0451576_0044009
433 Ga0451576_0055712
434 Ga0495592_0001493
435 Ga0495592_0004439
436 Ga0495592_0008347
437 Ga0495592_0018304
438 Ga0495641_0005331
439 Ga0495651_0015847
440 Ga0495580_0005602
441 Ga0495639_0001202
442 Ga0495662_0006369
443 Ga0495664_0003368
444 Ga0495628_0000532
445 Ga0495628_0002277
446 Ga0495628_0017670
447 Ga0495630_0004976
448 Ga0495630_0027026
449 Ga0495666_0002281
450 Ga0495652_0002507
451 Ga0495640_0001145
452 Ga0495640_0021978
453 Ga0495640_0035662
454 Ga0495586_0011032
455 Ga0495587_0012851
456 Ga0495645_0001700
457 Ga0495645_0002448
458 Ga0495667_0030610
459 Ga0495634_0018894
460 Ga0495599_0001123
461 Ga0495647_0000693
462 Ga0495658_0003469
463 Ga0495624_0024952
464 Ga0495600_0002915
465 Ga0495604_0059698
466 Ga0495636_0017076
467 Ga0495680_0012907
468 Ga0495675_0002113
469 Ga0501033_0006757
470 Ga0501036_0000162
471 Ga0501036_0030016
472 Ga0501037_0034633
473 Ga0501038_0001044
474 Ga0501039_0002679
475 Ga0501039_0041739
476 Ga0501040_0000167
477 Ga0501041_0008340
478 Ga0501042_0000122
479 Ga0501042_0029022
480 Ga0501046_0001014
481 Ga0501048_0000147
482 Ga0501068_0001486
483 Ga0501069_0004293
484 Ga0501070_0003184
485 Ga0501071_0038414
486 Ga0501072_0003995
487 Ga0501072_0004186
488 Ga0501073_0000845
489 Ga0501073_0003064
490 Ga0501074_0002082
491 Ga0501074_0041658
492 Ga0501075_0004600
493 Ga0501076_0000726
494 Ga0501076_0006108
495 Ga0501076_0010459
496 Ga0501077_0000231
497 Ga0501077_0018025
498 Ga0501223_000213
499 Ga0501079_0000211
500 Ga0501080_0004006
501 Ga0501080_0015886
502 Ga0501080_0027900
503 Ga0501080_0050380
504 Ga0501081_0000636
505 Ga0501081_0001106
506 Ga0501083_0010804
507 Ga0501280_000111
508 Ga0501035_0040524
509 nmdc:mga05p37_24332_c1
510 nmdc:mga09592_13268_c1
511 nmdc:mga09592_4441_c1
512 nmdc:mga08y16_2793_c2
513 nmdc:mga08y16_77467_c1
514 nmdc:mga0n895_46_c1
515 nmdc:mga08x19_4599_c1
516 nmdc:mga0a205_32013_c1
517 Ga0495601_0000144
518 Ga0495601_0008860
519 Ga0495601_0019954
520 Ga0495595_0001310
521 Ga0495619_0010398
522 Ga0500651_0011548
523 Ga0500604_0003478
524 Ga0500622_0000002
525 Ga0501084_0000262
526 Ga0501084_0022584
527 Ga0501082_0000215
528 Ga0501082_0002140
529 Ga0501082_0047276
530 Ga0501082_0053820
531 Ga0530510_0000114
532 2526213182
533 2548500420
534 2548848665
535 2643864524
536 2643992863
537 2644058214
538 2644073258
539 2644291785
540 2644647033
541 2739244442
542 2816469885
543 2919709174
544 2990715103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00069

Pkinase

Protein kinase domain

568

826

0.89

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

568

826

0.88

PF05226

CHASE2

CHASE2 domain

19

386

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b2p-assembly1.cif.gz_A-2 dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis 0.9163 569 835
1o6y-assembly1.cif.gz_A catalytic domain of pknb kinase from mycobacterium tuberculosis 0.9139 569 835
5u94-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693. 0.9136 569 835
3ori-assembly4.cif.gz_D mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 1) 0.9102 569 833
2fum-assembly2.cif.gz_B catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone 0.9005 569 835
ID Description Score Start End Superfamily
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9361 655 833 1.10.510.10
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9252 655 833 1.10.510.10
af_P9WI65_108_296_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9014 657 834 1.10.510.10
af_P9WI63_100_284_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8939 655 834 1.10.510.10
af_P9WI77_97_289_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.891 655 835 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A537BLU9-F1-model_v4 Protein kinase domain-containing protein 0.9786 735 834 GO:0004674
GO:0005524
GO:0016020
AF-A0A1Q6WJU2-F1-model_v4 Uncharacterized protein 0.9159 566 833 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0030553
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A402AFI9-F1-model_v4 non-specific serine/threonine protein kinase (EC 2.7.11.1) 0.9155 737 844 GO:0004674
GO:0005524
GO:0016020
AF-A0A845TW34-F1-model_v4 Protein kinase 0.9143 565 844 GO:0004674
GO:0005524
AF-A0A847GTH0-F1-model_v4 Protein kinase 0.9044 566 834 GO:0004674
GO:0005524
GO:0016020

Map